Advanced Search (OLGA)

Gene: Tslp (thymic stromal lymphopoietin) Chinchilla lanigera

Analyze

Symbol:

Tslp

Name:

thymic stromal lymphopoietin

RGD ID:

8912965

Description:

ENCODES a protein that exhibits cytokine activity (ortholog); interleukin-7 receptor binding (ortholog); INVOLVED IN antimicrobial humoral immune response mediated by antimicrobial peptide (ortholog); cell surface receptor signaling pathway via JAK-STAT (ortholog); cytokine-mediated signaling pathway (ortholog); ASSOCIATED WITH Albuminuria (ortholog); allergic contact dermatitis (ortholog); allergic disease (ortholog); FOUND IN extracellular region (ortholog); extracellular space (ortholog)

Type:

protein-coding

RefSeq Status:

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

ChiLan1.0 - Chinchilla ChiLan1.0 Assembly

Position:

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955418	4,041,529 - 4,045,534 (-)	NCBI	ChiLan1.0	ChiLan1.0

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Albuminuria (ISO)

allergic contact dermatitis (ISO)

allergic disease (ISO)

asthma (ISO)

atopic dermatitis (ISO)

autoimmune hemolytic anemia (ISO)

common cold (ISO)

cryoglobulinemia (ISO)

cryoglobulinemic vasculitis (ISO)

eosinophilic esophagitis (ISO)

familial adenomatous polyposis 1 (ISO)

Fungal Keratitis (ISO)

hepatocellular carcinoma (ISO)

Hereditary Neoplastic Syndromes (ISO)

Inflammation (ISO)

malaria (ISO)

membranoproliferative glomerulonephritis (ISO)

membranous glomerulonephritis (ISO)

Neurodevelopmental Disorders (ISO)

Picornaviridae Infections (ISO)

Pseudomonas Aeruginosa Keratitis (ISO)

respiratory allergy (ISO)

Respiratory Signs and Symptoms (ISO)

respiratory syncytial virus infectious disease (ISO)

Schistosomiasis Mansoni (ISO)

Sepsis (ISO)

sleeping sickness (ISO)

swine influenza (ISO)

toxascariasis (ISO)

trichinosis (ISO)

trichuriasis (ISO)

Viral Bronchiolitis (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

antimicrobial humoral immune response mediated by antimicrobial peptide (ISO)

cell surface receptor signaling pathway via JAK-STAT (ISO)

cytokine-mediated signaling pathway (ISO)

defense response to fungus (ISO)

defense response to Gram-negative bacterium (ISO)

interleukin-7-mediated signaling pathway (ISO)

negative regulation of apoptotic process (ISO)

positive regulation of cell population proliferation (ISO)

positive regulation of chemokine (C-C motif) ligand 1 production (ISO)

positive regulation of chemokine production (ISO)

positive regulation of cytokine-mediated signaling pathway (ISO)

positive regulation of granulocyte colony-stimulating factor production (ISO)

positive regulation of inflammatory response (ISO)

positive regulation of interleukin-10 production (ISO)

positive regulation of interleukin-13 production (ISO)

positive regulation of interleukin-5 production (ISO)

positive regulation of interleukin-6 production (ISO)

positive regulation of mast cell activation (ISO)

positive regulation of receptor signaling pathway via STAT (ISO)

Cellular Component

extracellular region (ISO)

extracellular space (ISO)

Molecular Function

cytokine activity (ISO)

interleukin-7 receptor binding (ISO)

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Transitive Annotation Pipeline	Automated assignment of GO, PW and RDO ISO annotations across species

Additional References at PubMed

PMID:22301074	PMID:30032202

Genomics

Comparative Map Data

Tslp
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955418	4,041,529 - 4,045,534 (-)	NCBI	ChiLan1.0	ChiLan1.0

TSLP
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	5	111,070,062 - 111,078,026 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	5	111,070,062 - 111,078,026 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	5	110,405,760 - 110,413,724 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	5	110,435,289 - 110,441,623 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	5	106,353,329 - 106,359,661 (+)	NCBI		Celera
Cytogenetic Map	5	q22.1	NCBI
HuRef	5	105,584,896 - 105,592,841 (+)	NCBI		HuRef
CHM1_1	5	109,839,103 - 109,847,047 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	5	111,580,695 - 111,588,660 (+)	NCBI		T2T-CHM13v2.0

Tslp
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	18	32,948,436 - 32,952,852 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	18	32,948,436 - 32,952,850 (+)	Ensembl		GRCm39 Ensembl
GRCm38	18	32,815,383 - 32,819,799 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	18	32,815,383 - 32,819,797 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	18	32,975,037 - 32,979,453 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	18	32,958,393 - 32,962,802 (+)	NCBI		MGSCv36	mm8
Celera	18	33,286,509 - 33,290,920 (+)	NCBI		Celera
Cytogenetic Map	18	B1	NCBI
cM Map	18	18.12	NCBI

Tslp
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	18	24,723,990 - 24,728,419 (+)	NCBI		GRCr8
mRatBN7.2	18	24,447,409 - 24,454,244 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	18	24,449,844 - 24,453,548 (+)	Ensembl		mRatBN7.2 Ensembl
Rnor_6.0	18	25,613,601 - 25,618,066 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	18	25,613,831 - 25,617,361 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	18	25,326,396 - 25,333,230 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	18	25,268,082 - 25,274,214 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	18	24,198,059 - 24,202,524 (+)	NCBI		Celera
Cytogenetic Map	18	p12	NCBI

TSLP
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	4	106,340,561 - 106,348,525 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	5	104,494,184 - 104,502,180 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	5	106,440,136 - 106,446,849 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	5	112,242,490 - 112,249,200 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	5	112,242,490 - 112,250,130 (+)	Ensembl	panpan1.1		panPan2

TSLP
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	3	1,502,469 - 1,507,696 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	3	1,503,188 - 1,507,696 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	3	2,907,296 - 2,971,755 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	3	1,393,149 - 1,400,425 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	3	1,393,868 - 1,398,504 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	3	1,339,901 - 1,404,345 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	3	1,341,683 - 1,348,998 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	3	1,506,469 - 1,571,642 (-)	NCBI		UU_Cfam_GSD_1.0

Tslp
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024407213	156,110,394 - 156,115,633 (-)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936531	5,495,872 - 5,500,462 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

TSLP
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1	2	115,832,152 - 115,837,572 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	2	120,289,894 - 120,323,977 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

TSLP
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	23	14,419,820 - 14,423,331 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666034	64,056,775 - 64,060,255 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Sequence

Nucleotide Sequences


RefSeq Transcripts	XM_005382342	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AGCD01018807	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

XM_005382342 ⟹ XP_005382399

Type:

CODING

Position:

Chinchilla Assembly	Chr	Position (strand)	Source
ChiLan1.0	NW_004955418	4,041,529 - 4,045,534 (-)	NCBI

Sequence:

show sequence

ATGACATCAAAGAAAATCATTGGTCTAGGAGAAAAGAGCCCCACATTTCCTAATGCCTTACTAC
TTCTTCTATCAGGTTTCTTCAAGATCTTCCTCTTCCAACTGGTAGGGTTGGTGTTAACTTTCAA
CTTCAATAACTGTGACTTCAAGAAGATTCGGGACGACTATGACAATCTTATTGTCCATAACCTG
AATGACTATATGAACAAGCGGGCAGTCAGGCTGGCTTTCAGGGAGGGTGTGTTGAACCCCAGGC
GTTTGCTGCGCCCAGCTTGGGACTTCGGTTCCAATTTAGAGAGAGGAGGTCTGTGTCGGGTAGG
GCGGGGTTCCGAGAGAGGCTGTCCCTTCTTCCCTCCAGCTCAGGCCAGCGCTCCTGGCCGTGAA
GGCAATGGGAAACCGGCCAAGGCGCGCAGCCCAGGGCCCCCCTCGGAGCGCCCCCTTTTGCGCT
GCTTCCTGGCGCCGCCTGCGTGGCCCTTGCGCCCGGCTCCCGCCGCCTGGCAACGCCCCTCCCC
ACCGGGTGCTTCTCTTTCCCTCTCCGCCCGCGACCTCTCCGCTTGCCCTGCCGCTTTGACTCCA
TTCTTACTGACTCTGTCACCCCACCCCACCCCCTTTCCGGCGTTTTCTCGCGTCTTCCTAAACG
TCACCGCCGCCTGTGAGCAGTCAGATTGCCTCACTAAAATCGTGCGCCACACCTTCAACTCCAC
CACCTGCCCGTCACTCTCCGAGGAACTCTTTGCCTGGAGAACTAATGCTACCCTCGCTCGCTAT
TGCCCAGAGTACTCTACAGTTCAGATAAATAATACCCAGAAAATGCAGCAAAAAGTCACCCGTG
AGTGCCTGGAGCAAACATCACAAATAATAGGATGGTGGCGTTTTTTCAGCCGACTTTTGGGAAA
AAAAAACTATCTTCATTAGCATCATATTTTATAGTATTAAAATAAATGATATTTATTAAG

hide sequence

Protein Sequences


Protein RefSeqs	XP_005382399	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

XP_005382399 ⟸ XM_005382342

- Sequence:

show sequence

MTSKKIIGLGEKSPTFPNALLLLLSGFFKIFLFQLVGLVLTFNFNNCDFKKIRDDYDNLIVHNL
NDYMNKRAVRLAFREGVLNPRRLLRPAWDFGSNLERGGLCRVGRGSERGCPFFPPAQASAPGRE
GNGKPAKARSPGPPSERPLLRCFLAPPAWPLRPAPAAWQRPSPPGASLSLSARDLSACPAALTP
FLLTLSPHPTPFPAFSRVFLNVTAACEQSDCLTKIVRHTFNSTTCPSLSEELFAWRTNATLARY
CPEYSTVQINNTQKMQQKVTRECLEQTSQIIGWWRFFSRLLGKKNYLH

hide sequence

Additional Information

External Database Links

Database	Acc Id	Source(s)
NCBI Gene	LOC102025006	ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-08-25	Tslp	thymic stromal lymphopoietin	LOC102025006	uncharacterized LOC102025006	Symbol and/or name change	5135510	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI