Advanced Search (OLGA)

Gene: Apoa1 (apolipoprotein A1) Chinchilla lanigera

Analyze

Symbol:

Apoa1

Name:

apolipoprotein A1

RGD ID:

8794334

Description:

ENCODES a protein that exhibits amyloid-beta binding (ortholog); apolipoprotein A-I receptor binding (ortholog); apolipoprotein receptor binding (ortholog); INVOLVED IN adrenal gland development (ortholog); amyloid-beta formation (ortholog); animal organ regeneration (ortholog); PARTICIPATES IN altered lipoprotein metabolic pathway; forkhead class A signaling pathway; lipoprotein metabolic pathway; ASSOCIATED WITH Acute Lung Injury (ortholog); Acute Tubulointerstitial Nephritis (ortholog); adenocarcinoma (ortholog); FOUND IN cell surface (ortholog); cytoplasmic vesicle (ortholog); discoidal high-density lipoprotein particle (ortholog)

Type:

protein-coding

RefSeq Status:

MODEL

Previously known as:

Apo-AI; ApoA-I; apolipoprotein A-I

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	APOA1 (apolipoprotein A1)	NCBI	Ortholog
Mus musculus (house mouse):	Apoa1 (apolipoprotein A-I)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus norvegicus (Norway rat):	Apoa1 (apolipoprotein A1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	APOA1 (apolipoprotein A1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	APOA1 (apolipoprotein A1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Apoa1 (apolipoprotein A1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	APOA1 (apolipoprotein A1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	APOA1 (apolipoprotein A1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Apoa1 (apolipoprotein A1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline

Latest Assembly:

ChiLan1.0 - Chinchilla ChiLan1.0 Assembly

Position:

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955412	18,170,331 - 18,172,298 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955412	18,170,331 - 18,172,298 (-)	NCBI	ChiLan1.0	ChiLan1.0

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Acute Lung Injury (ISO)

Acute Tubulointerstitial Nephritis (ISO)

adenocarcinoma (ISO)

Alzheimer's disease (ISO)

arteriosclerosis (ISO)

atherosclerosis (ISO)

Behcet's disease (ISO)

Budd-Chiari syndrome (ISO)

cardiomyopathy (ISO)

CD3epsilon deficiency (ISO)

cerebral amyloid angiopathy (ISO)

Chemical and Drug Induced Liver Injury (ISO)

cholangiocarcinoma (ISO)

chromosome 11 partial duplication syndrome (ISO)

Chronic Hepatitis B (ISO)

chronic kidney disease (ISO)

congestive heart failure (ISO)

coronary artery disease (ISO)

Death (ISO)

Diabetic Cardiomyopathies (ISO)

Diabetic Nephropathies (ISO)

Drug Eruptions (ISO)

Dwarfism (ISO)

Edema (ISO)

end stage renal disease (ISO)

Endotoxemia (ISO)

Experimental Diabetes Mellitus (ISO)

Experimental Liver Cirrhosis (ISO)

Familial Amyloid Polyneuropathies (ISO)

Familial Amyloidosis (ISO)

familial isolated deficiency of vitamin E (ISO)

familial visceral amyloidosis (ISO)

hepatitis C (ISO)

hepatoblastoma (ISO)

hepatocellular carcinoma (ISO)

hereditary spastic paraplegia 50 (ISO)

human immunodeficiency virus infectious disease (ISO)

Hypercholesterolemia (ISO)

Hyperlipoproteinemia Type II (ISO)

hypertension (ISO)

hyperthyroidism (ISO)

Hypertriglyceridemia (ISO)

Hypoalphalipoproteinemias (ISO)

hypolipoproteinemia (ISO)

Hypoproteinemia (ISO)

Hypoxia (ISO)

idiopathic pulmonary fibrosis (ISO)

immunodeficiency 17 (ISO)

immunodeficiency 18 (ISO)

immunodeficiency 19 (ISO)

Inflammation (ISO)

inflammatory bowel disease 28 (ISO)

intellectual disability (ISO)

isolated microphthalmia 5 (ISO)

Kidney Reperfusion Injury (ISO)

lipid metabolism disorder (ISO)

liver cirrhosis (ISO)

lung adenocarcinoma (ISO)

Lung Neoplasms (ISO)

lung small cell carcinoma (ISO)

major depressive disorder (ISO)

malignant mesothelioma (ISO)

membranous glomerulonephritis (ISO)

metabolic dysfunction-associated steatohepatitis (ISO)

metabolic dysfunction-associated steatotic liver disease (ISO)

Metabolic Syndrome (ISO)

multiple sclerosis (ISO)

myocardial infarction (ISO)

nephronophthisis 15 (ISO)

nephrotic syndrome (ISO)

Norum disease (ISO)

obesity (ISO)

ocular hypertension (ISO)

pancreatic cancer (ISO)

Parkinson's disease (ISO)

Pediatric Obesity (ISO)

polycystic kidney disease (ISO)

primary hypoalphalipoproteinemia 1 (ISO)

primary hypoalphalipoproteinemia 2 (ISO)

pulmonary fibrosis (ISO)

RASopathy (ISO)

sciatic neuropathy (ISO)

Sepsis (ISO)

steatotic liver disease (ISO)

Stomach Neoplasms (ISO)

Stroke (ISO)

systemic lupus erythematosus (ISO)

Tangier disease (ISO)

transitional cell carcinoma (ISO)

Transplant Rejection (ISO)

type 1 diabetes mellitus (ISO)

type 2 diabetes mellitus (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

adrenal gland development (ISO)

amyloid-beta formation (ISO)

animal organ regeneration (ISO)

axon regeneration (ISO)

blood vessel endothelial cell migration (ISO)

cellular response to lipoprotein particle stimulus (ISO)

cholesterol biosynthetic process (ISO)

cholesterol efflux (ISO)

cholesterol homeostasis (ISO)

cholesterol import (ISO)

cholesterol metabolic process (ISO)

cholesterol transport (ISO)

endothelial cell proliferation (ISO)

ERK1 and ERK2 cascade (ISO)

G protein-coupled receptor signaling pathway (ISO)

glucocorticoid metabolic process (ISO)

high-density lipoprotein particle assembly (ISO)

high-density lipoprotein particle remodeling (ISO)

integrin-mediated signaling pathway (ISO)

lipid storage (ISO)

lipoprotein biosynthetic process (ISO)

negative chemotaxis (ISO)

negative regulation of cell adhesion molecule production (ISO)

negative regulation of cytokine production involved in immune response (ISO)

negative regulation of heterotypic cell-cell adhesion (ISO)

negative regulation of hydrolase activity (ISO)

negative regulation of inflammatory response (ISO)

negative regulation of interleukin-1 beta production (ISO)

negative regulation of lipase activity (ISO)

negative regulation of response to cytokine stimulus (ISO)

negative regulation of tumor necrosis factor-mediated signaling pathway (ISO)

negative regulation of very-low-density lipoprotein particle remodeling (ISO)

peptidyl-methionine modification (ISO)

peripheral nervous system axon regeneration (ISO)

phosphatidylcholine biosynthetic process (ISO)

phospholipid efflux (ISO)

phospholipid homeostasis (ISO)

phospholipid metabolic process (ISO)

phospholipid transport (ISO)

positive regulation of cholesterol efflux (ISO)

positive regulation of cholesterol metabolic process (ISO)

positive regulation of phagocytosis (ISO)

positive regulation of phospholipid efflux (ISO)

positive regulation of Rho protein signal transduction (ISO)

positive regulation of stress fiber assembly (ISO)

positive regulation of substrate adhesion-dependent cell spreading (ISO)

positive regulation of transferase activity (ISO)

protein localization (ISO)

protein oxidation (ISO)

protein stabilization (ISO)

regulation of Cdc42 protein signal transduction (ISO)

regulation of intestinal cholesterol absorption (ISO)

regulation of protein phosphorylation (ISO)

response to estrogen (ISO)

response to nutrient (ISO)

response to xenobiotic stimulus (ISO)

reverse cholesterol transport (ISO)

transforming growth factor beta receptor signaling pathway (ISO)

triglyceride homeostasis (ISO)

vitamin transport (ISO)

Cellular Component

cell surface (ISO)

cytoplasmic vesicle (ISO)

discoidal high-density lipoprotein particle (ISO)

endocytic vesicle (ISO)

extracellular region (ISO)

extracellular space (ISO)

high-density lipoprotein particle (ISO)

intermediate-density lipoprotein particle (ISO)

low-density lipoprotein particle (ISO)

spherical high-density lipoprotein particle (ISO)

very-low-density lipoprotein particle (ISO)

Molecular Function

Molecular Pathway Annotations Click to see Annotation Detail View

altered lipoprotein metabolic pathway (ISO)

forkhead class A signaling pathway (ISO)

lipoprotein metabolic pathway (ISO)

reverse cholesterol transport pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Transitive Annotation Pipeline	Automated assignment of GO, PW and RDO ISO annotations across species
2.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline

Additional References at PubMed

PMID:22301074	PMID:30032202

Genomics

Comparative Map Data

Apoa1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955412	18,170,331 - 18,172,298 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955412	18,170,331 - 18,172,298 (-)	NCBI	ChiLan1.0	ChiLan1.0

APOA1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	11	116,835,751 - 116,837,622 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	11	116,835,751 - 116,837,622 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	11	116,706,467 - 116,708,338 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	11	116,211,679 - 116,213,548 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	11	113,864,272 - 113,866,141 (-)	NCBI		Celera
Cytogenetic Map	11	q23.3	NCBI
HuRef	11	112,638,728 - 112,640,597 (-)	NCBI		HuRef
CHM1_1	11	116,591,221 - 116,593,090 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	11	116,850,858 - 116,852,729 (-)	NCBI		T2T-CHM13v2.0

Apoa1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	9	46,139,928 - 46,141,767 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	9	46,139,878 - 46,141,764 (+)	Ensembl		GRCm39 Ensembl
GRCm38	9	46,228,630 - 46,230,469 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	9	46,228,580 - 46,230,466 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	9	46,036,713 - 46,038,549 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	9	45,979,705 - 45,981,461 (+)	NCBI		MGSCv36	mm8
Celera	9	43,517,584 - 43,519,420 (+)	NCBI		Celera
Cytogenetic Map	9	A5.2	NCBI
cM Map	9	25.36	NCBI

Apoa1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	8	55,423,945 - 55,425,729 (+)	NCBI		GRCr8
mRatBN7.2	8	46,527,251 - 46,529,035 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	46,527,144 - 46,529,035 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	8	52,028,451 - 52,030,242 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	50,307,226 - 50,309,017 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	48,171,497 - 48,173,288 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	8	50,525,091 - 50,526,875 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	50,525,091 - 50,526,875 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	8	49,151,163 - 49,152,947 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
Celera	8	46,109,311 - 46,111,065 (+)	NCBI		Celera
RH 3.4 Map	8	472.0	RGD
Cytogenetic Map	8	q22	NCBI

APOA1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	9	117,539,267 - 117,542,245 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	11	118,644,446 - 118,647,456 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	11	111,673,539 - 111,675,428 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	11	115,606,136 - 115,608,335 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	11	115,606,136 - 115,608,122 (-)	Ensembl	panpan1.1		panPan2

APOA1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	5	16,740,071 - 16,742,081 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	5	16,740,130 - 16,741,943 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	5	16,792,234 - 16,794,244 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	5	16,686,357 - 16,688,357 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	5	16,686,468 - 16,688,346 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	5	16,823,454 - 16,825,453 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	5	16,726,037 - 16,728,039 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	5	16,768,944 - 16,770,956 (+)	NCBI		UU_Cfam_GSD_1.0

Apoa1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404947	99,189,637 - 99,191,475 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936542	2,111,052 - 2,112,854 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936542	2,111,055 - 2,112,626 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

APOA1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	9	44,216,392 - 44,218,713 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	9	44,216,481 - 44,218,360 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	9	49,288,730 - 49,290,611 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3
Pig Cytomap	9	p12-p11	NCBI

APOA1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	1	108,201,967 - 108,203,902 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	1	108,201,439 - 108,203,609 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666043	17,846,715 - 17,848,683 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Apoa1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624784	12,249,283 - 12,251,136 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624784	12,249,283 - 12,251,215 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Sequence

Nucleotide Sequences


RefSeq Transcripts	XM_005378193	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AGCD01012927	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	GBDJ01086480	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSCLAT00000017002 ⟹ ENSCLAP00000016837

Type:

CODING

Position:

Chinchilla Assembly	Chr	Position (strand)	Source
ChiLan1.0 Ensembl	NW_004955412	18,170,331 - 18,172,298 (-)	Ensembl

RefSeq Acc Id:

XM_005378193 ⟹ XP_005378250

Type:

CODING

Position:

Chinchilla Assembly	Chr	Position (strand)	Source
ChiLan1.0	NW_004955412	18,170,331 - 18,172,298 (-)	NCBI

Sequence:

show sequence

GCCCCTTCCTAAACCCTTGACCCCTGCCTTGTAGCCCCCGCAGTTTCCTGTTTGCCCATTCTAT
TTGCCCGGCCCAGGGACAGAGCTGATCCTTGAACTCTCAGTTCCACATCGCCAGAACCAGTGAG
CAGTGACAGGGCTCATCTGGGCTTATCAGCCTTCCAGCCCAGCCCCTGCCTGGAGACATAAATA
GGCCGGGAGGGCTGGATGCTCGCTGAGAGACTAGCTCAGGGACTTTTCTAGGAGCTCCAGGGAG
GTCACCCACGCCCTGCAGGATGAAAGCTGTGGTGCTGGCCGTGGCTGTGCTCTTCCTGACTGGG
AGCCAGGCTCGGCACTTCTGGCAGCGAGATGAACCCCAGACCCCATGGGATCGCGTGAAGGATT
TTGCTACTGTGTATGTGGATGCCATCAAAGAGAGCGGCAGAGACTACGTGGCCCAGCTGGAAAC
CTCTGTCTTGGGGAAACACCTAAACCTGAAGCTCTTGGACAATTGGGACACCTTGAGCACCACC
TTCAGTAAGCTGCGTGCAGATCTTGGGCCGGTGACTCAGGAGTTCTGGGACAACCTGGAAAAAG
ACACAGAGTGGCTGAGGCAGGAGATGAACAAGGATCTGCAGGAGGTGAAGCAGAAGGTGCAGCC
CTACCTGGACAACTTCCACAAGAAGATGCAGGAGGAGATGGAGCGTTATCGCGAGAAAGTGGGG
CCCCTGGGCACCGAACTGCGCGAAGGCGCTCGCCAGAAGCTGCAGGAACTTCAGGAGAAGCTGA
CCCCGCTGGGCGAGGACCTCCGCGACCGCGCGCGCGAGCACGTGGACACGCTGCGCACGCAGCT
GGCGCCCTACAGCGACGACATGCGCCAGCGCCTGACCCAGCGGCTCGAGGCGCTCAGGGATAGC
ACCACCTTCGCTGATTACCAGGCCAAGGCCAGTGAGCACCTGAAAACGTTCAGCGAGAAGGCCA
AGCCCGCGCTGGAGGACCTTCGCCAGGGCCTGCTACCCGTGCTGGAGAGCCTGAAGGCCAGCAT
CCTGAGCTCCATCGACCAGGCCACCAAGCAGCTCACCGCCCAATGAGGTGCTCTCGGCTGCCGC
TGCCTCCTCCCCTTCCCAGCTTTCACTTTCTTAGAATAAACATTTCCAGAGTGGGAAA

hide sequence

Protein Sequences


Protein RefSeqs	XP_005378250	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSCLAP00000016837
	ENSCLAP00000016837.1
GenBank Protein	P0DMS2	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

XP_005378250 ⟸ XM_005378193

- UniProtKB:

P0DMS2 (UniProtKB/Swiss-Prot)

- Sequence:

show sequence

MKAVVLAVAVLFLTGSQARHFWQRDEPQTPWDRVKDFATVYVDAIKESGRDYVAQLETSVLGKH
LNLKLLDNWDTLSTTFSKLRADLGPVTQEFWDNLEKDTEWLRQEMNKDLQEVKQKVQPYLDNFH
KKMQEEMERYREKVGPLGTELREGARQKLQELQEKLTPLGEDLRDRAREHVDTLRTQLAPYSDD
MRQRLTQRLEALRDSTTFADYQAKASEHLKTFSEKAKPALEDLRQGLLPVLESLKASILSSIDQ
ATKQLTAQ

hide sequence

Ensembl Acc Id:

ENSCLAP00000016837 ⟸ ENSCLAT00000017002

Additional Information

External Database Links

Database	Acc Id	Source(s)
Ensembl Genes	ENSCLAG00000011551	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSCLAT00000017002	ENTREZGENE
	ENSCLAT00000017002.1	UniProtKB/Swiss-Prot
Gene3D-CATH	1.20.5.20	UniProtKB/Swiss-Prot
	6.10.140.380	UniProtKB/Swiss-Prot
	Apolipoprotein	UniProtKB/Swiss-Prot
InterPro	ApoA_E	UniProtKB/Swiss-Prot
	Apolipoprotein_A1/A4/E	UniProtKB/Swiss-Prot
NCBI Gene	Apoa1	ENTREZGENE
PANTHER	APOLIPOPROTEIN	UniProtKB/Swiss-Prot
	APOLIPOPROTEIN A-I	UniProtKB/Swiss-Prot
Pfam	Apolipoprotein	UniProtKB/Swiss-Prot
Superfamily-SCOP	Apolipoprotein A-I	UniProtKB/Swiss-Prot
UniProt	APOA1_CHILA	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-08-03	Apoa1	apolipoprotein A1		apolipoprotein A-I	Symbol and/or name change	5135510	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - PID (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - PID (archival)