Advanced Search (OLGA)

Gene: Sry (sex determining region of Chr Y) Mus musculus

Analyze

Symbol:

Sry

Name:

sex determining region of Chr Y

RGD ID:

737206

MGI Page

MGI

Description:

Enables DNA binding activity, bending and DNA-binding transcription factor activity, RNA polymerase II-specific. Involved in male gonad development and male sex determination. Acts upstream of or within negative regulation of macromolecule biosynthetic process; positive regulation of male gonad development; and spermatogenesis. Located in nucleus. Part of transcription regulator complex. Is expressed in several structures, including brain; early conceptus; and genitourinary system. Human ortholog(s) of this gene implicated in 46,XX sex reversal 1; 46,XY complete gonadal dysgenesis; and 46,XY sex reversal 1. Orthologous to human SRY (sex determining region Y).

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

MGC129295; sex-determining region Y protein; Tdf; Tdy; testis determining-Y; testis-determining factor

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	SRY (sex determining region Y)	HGNC	Ensembl, HGNC, OrthoDB, PhylomeDB
Rattus norvegicus (Norway rat):	Sry (sex determining region Y)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	SRY (sex determining region Y)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	SRY (sex determining region Y)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	SRY (sex determining region Y)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	SRY (sex determining region Y)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	SOX14 (SRY-box transcription factor 14)	HGNC	Panther
Alliance orthologs ³
Rattus norvegicus (Norway rat):	Sry (sex determining region Y)	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	SRY (sex determining region Y)	Alliance	DIOPT (Ensembl Compara\|HGNC\|OrthoFinder\|OrthoInspector\|PhylomeDB)
Danio rerio (zebrafish):	sox32 (SRY (sex determining region Y)-box 32)	Alliance	DIOPT (Ensembl Compara\|PANTHER)
Caenorhabditis elegans (roundworm):	sox-4	Alliance	DIOPT (Ensembl Compara\|PANTHER)

Latest Assembly:

GRCm39 - Mouse Genome Assembly GRCm39

Position:

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	Y	2,662,471 - 2,663,658 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	Y	2,662,471 - 2,663,658 (-)	Ensembl		GRCm39 Ensembl
GRCm38	Y	2,662,471 - 2,663,658 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	Y	2,662,471 - 2,663,658 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	Y	1,918,381 - 1,919,568 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	Y	1,947,341 - 1,948,528 (-)	NCBI		MGSCv36	mm8
Celera	Y	5,570,827 - 5,572,014 (+)	NCBI		Celera
Cytogenetic Map	Y	pter	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

46, XY Disorders of Sex Development (ISO)

46,XX sex reversal 1 (ISO)

46,XY complete gonadal dysgenesis (ISO)

46,XY sex reversal 1 (ISO)

46,Xy True Hermaphroditism, Sry-Related (ISO)

autistic disorder (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

2-hydroxypropanoic acid (ISO)

acrylamide (EXP)

ammonium chloride (ISO)

arsenite(3-) (ISO)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (EXP)

bisphenol A (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

cadmium sulfate (ISO)

carmustine (ISO)

clofibrate (EXP)

cobalt dichloride (ISO)

copper atom (ISO)

copper(0) (ISO)

Cuprizon (ISO)

cyclosporin A (ISO)

FR900359 (ISO)

indole-3-methanol (ISO)

lead(II) chloride (ISO)

N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (ISO)

progesterone (ISO)

rac-lactic acid (ISO)

urethane (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cell differentiation (IBA,IEA)

male gonad development (IDA)

male sex determination (IBA,IDA,IGI,ISO)

negative regulation of gene expression (IDA)

negative regulation of transcription by RNA polymerase II (IGI)

positive regulation of DNA-templated transcription (ISO)

positive regulation of gene expression (ISO,ISS)

positive regulation of male gonad development (IGI,ISO)

positive regulation of transcription by RNA polymerase II (IBA,ISO)

sex determination (IDA,IGI)

spermatogenesis (IGI)

Cellular Component

cytoplasm (IEA)

nuclear speck (IEA)

nucleoplasm (TAS)

nucleus (IBA,IDA,ISO)

transcription regulator complex (IDA)

Molecular Function

calmodulin binding (IEA)

DNA binding (IDA,ISO)

DNA binding, bending (IDA)

DNA-binding transcription activator activity, RNA polymerase II-specific (IBA)

DNA-binding transcription factor activity, RNA polymerase II-specific (IDA,ISO)

DNA-binding transcription factor binding (ISO)

enzyme binding (ISO)

protein binding (IPI)

RNA polymerase II cis-regulatory region sequence-specific DNA binding (IBA)

sequence-specific DNA binding (ISO)

Phenotype Annotations Click to see Annotation Detail View

Mammalian Phenotype

abnormal acrosome morphology (IAGP)

abnormal circulating testosterone level (IAGP)

abnormal internal male genitalia morphology (IAGP)

abnormal ovarian follicle morphology (IAGP)

abnormal primary sex determination (IAGP)

abnormal secondary sex determination (IAGP)

abnormal testis development (IAGP)

decreased tertiary ovarian follicle number (IAGP)

decreased testis weight (IEA)

female infertility (IAGP)

lethality throughout fetal growth and development, incomplete penetrance (IAGP)

male infertility (IAGP)

ovotestis (IAGP)

primary sex reversal (IAGP)

prolonged estrus (IAGP)

secondary sex reversal (IAGP)

sex reversal (IAGP)

small testis (IAGP)

true hermaphroditism (IAGP)

References

References - curated

#	Reference Title	Reference Citation
1.	Mutational analysis of SRY in XY females.	Hawkins JR Hum Mutat. 1993;2(5):347-50.
2.	A human XY female with a frame shift mutation in the candidate testis-determining gene SRY.	Jager RJ, etal., Nature. 1990 Nov 29;348(6300):452-4.
3.	Electronic Transfer of Homolog Data	MGD and Homologene mouse data transfer
4.	MGDs mouse GO annotations	MGD data from the GO Consortium
5.	MGD IEA	MGD IEA
6.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
7.	Mouse MP Annotation Import Pipeline	RGD automated import pipeline
8.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
9.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:1339380	PMID:1349578	PMID:1352158	PMID:1396566	PMID:1518820	PMID:1599466	PMID:1614875	PMID:1698142	PMID:1782876	PMID:2030730	PMID:2247149	PMID:2247150
PMID:2365357	PMID:2374589	PMID:2401216	PMID:2497440	PMID:2563174	PMID:2806881	PMID:2901661	PMID:3234755	PMID:3261868	PMID:3413106	PMID:3503711	PMID:3690661
PMID:6663259	PMID:7089579	PMID:7479793	PMID:7507663	PMID:7516683	PMID:7567444	PMID:7587380	PMID:7600978	PMID:7647467	PMID:7670499	PMID:7682420	PMID:7684656
PMID:7695616	PMID:7741724	PMID:7749230	PMID:7766412	PMID:7774816	PMID:7815926	PMID:7826621	PMID:7838151	PMID:7849739	PMID:7896271	PMID:7928393	PMID:7928394
PMID:7958412	PMID:7985018	PMID:7999045	PMID:8012385	PMID:8015441	PMID:8015446	PMID:8043307	PMID:8097047	PMID:8105086	PMID:8122913	PMID:8159753	PMID:8190643
PMID:8244390	PMID:8275095	PMID:8321234	PMID:8355784	PMID:8430091	PMID:8464005	PMID:8499334	PMID:8570690	PMID:8617507	PMID:8625802	PMID:8678984	PMID:8774960
PMID:8793057	PMID:8951075	PMID:9000753	PMID:9115712	PMID:9303351	PMID:9369180	PMID:9383069	PMID:9486644	PMID:9499427	PMID:9527878	PMID:9678346	PMID:9826679
PMID:9843206	PMID:9879712	PMID:10410901	PMID:10412367	PMID:10430663	PMID:10431249	PMID:10486311	PMID:10588871	PMID:10704890	PMID:10773660	PMID:10919290	PMID:10951505
PMID:11071752	PMID:11085593	PMID:11105052	PMID:11145610	PMID:11212323	PMID:11353512	PMID:11376487	PMID:11404013	PMID:11509181	PMID:11514455	PMID:11535586	PMID:11550179
PMID:11641389	PMID:11748612	PMID:11784049	PMID:11818535	PMID:11869290	PMID:11944948	PMID:11980735	PMID:12023983	PMID:12223418	PMID:12244322	PMID:12388607	PMID:12420137
PMID:12466851	PMID:12477932	PMID:12750339	PMID:12798287	PMID:12815626	PMID:12904311	PMID:14517996	PMID:14628051	PMID:14645115	PMID:14670983	PMID:14978045	PMID:15020475
PMID:15051956	PMID:15056615	PMID:15170344	PMID:15297880	PMID:15385158	PMID:15469996	PMID:15533830	PMID:15581876	PMID:15618518	PMID:15680364	PMID:15680367	PMID:15789443
PMID:15879091	PMID:15944188	PMID:16166090	PMID:16182245	PMID:16185683	PMID:16207837	PMID:16293944	PMID:16354792	PMID:16356265	PMID:16414182	PMID:16466392	PMID:16488877
PMID:16495461	PMID:16540514	PMID:16571910	PMID:16700629	PMID:16847261	PMID:16904257	PMID:16996051	PMID:17021344	PMID:17277314	PMID:17848526	PMID:17936260	PMID:17956759
PMID:18155190	PMID:18244926	PMID:18287559	PMID:18363850	PMID:18391535	PMID:18391542	PMID:18454134	PMID:18588511	PMID:18675318	PMID:18851760	PMID:19028515	PMID:19036799
PMID:19177742	PMID:19207816	PMID:19211811	PMID:19250439	PMID:19269320	PMID:19376480	PMID:19457926	PMID:19549635	PMID:19618468	PMID:19696014	PMID:19753101	PMID:19850934
PMID:19864314	PMID:19884258	PMID:19918361	PMID:20543856	PMID:20573212	PMID:20610747	PMID:21062860	PMID:21208466	PMID:21267068	PMID:21414140	PMID:21530259	PMID:21558314
PMID:21559298	PMID:21592645	PMID:21636956	PMID:21654156	PMID:21806829	PMID:21873635	PMID:21919034	PMID:22186409	PMID:22294746	PMID:22344693	PMID:22349083	PMID:22496664
PMID:22514746	PMID:22539273	PMID:22589744	PMID:22613723	PMID:22797524	PMID:22827036	PMID:22869781	PMID:23095882	PMID:23102580	PMID:23102581	PMID:23235156	PMID:23300469
PMID:23300479	PMID:23397033	PMID:23516551	PMID:23658713	PMID:23666012	PMID:23874228	PMID:23901118	PMID:23987514	PMID:24009392	PMID:24009762	PMID:24062698	PMID:24190364
PMID:24199867	PMID:24259464	PMID:24263135	PMID:24452333	PMID:24496622	PMID:24509348	PMID:24654234	PMID:24743337	PMID:24784881	PMID:24861924	PMID:24912173	PMID:24952961
PMID:24956260	PMID:24967676	PMID:25071448	PMID:25074915	PMID:25088423	PMID:25139092	PMID:25267720	PMID:25716571	PMID:25783200	PMID:25870930	PMID:25987976	PMID:26108792
PMID:26112012	PMID:26194606	PMID:26226656	PMID:26231585	PMID:26536904	PMID:26719889	PMID:26823431	PMID:27009039	PMID:27660699	PMID:28045957	PMID:28095800	PMID:28118982
PMID:28254489	PMID:28339606	PMID:28938467	PMID:28942012	PMID:28949961	PMID:29042633	PMID:29385171	PMID:29501873	PMID:29526868	PMID:29735715	PMID:29903884	PMID:29928692
PMID:30040984	PMID:30212841	PMID:30285093	PMID:30289439	PMID:30700819	PMID:30871468	PMID:31116734	PMID:31201301	PMID:31403472	PMID:31530896	PMID:31754036	PMID:31822606
PMID:31836612	PMID:31910233	PMID:32365547	PMID:32452519	PMID:32461690	PMID:32886743	PMID:33004521	PMID:33086308	PMID:33691111	PMID:33912929	PMID:34655525	PMID:34662386
PMID:34918413	PMID:35075134	PMID:35129866	PMID:35315790	PMID:35704566	PMID:35921234	PMID:36414375	PMID:36797258	PMID:36858585	PMID:36912416	PMID:36928413	PMID:37155872
PMID:37917714	PMID:38047309	PMID:38336346	PMID:38486287	PMID:38714644	PMID:38742935	PMID:38750146	PMID:38956041	PMID:39856696

Genomics

Comparative Map Data

Sry
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	Y	2,662,471 - 2,663,658 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	Y	2,662,471 - 2,663,658 (-)	Ensembl		GRCm39 Ensembl
GRCm38	Y	2,662,471 - 2,663,658 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	Y	2,662,471 - 2,663,658 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	Y	1,918,381 - 1,919,568 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	Y	1,947,341 - 1,948,528 (-)	NCBI		MGSCv36	mm8
Celera	Y	5,570,827 - 5,572,014 (+)	NCBI		Celera
Cytogenetic Map	Y	pter	NCBI

SRY
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	Y	2,786,855 - 2,787,682 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	Y	2,786,855 - 2,787,682 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	Y	2,654,896 - 2,655,723 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	Y	2,714,896 - 2,715,792 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	Y	2,698,256 - 2,699,153	NCBI
Celera	X	88,844,082 - 88,844,978 (-)	NCBI		Celera
Cytogenetic Map	Y	p11.2	NCBI
HuRef	Y	7,900 - 8,786 (-)	NCBI		HuRef
T2T-CHM13v2.0	Y	2,463,695 - 2,464,522 (-)	NCBI		T2T-CHM13v2.0

Sry
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	Y	465,260 - 465,772 (+)	NCBI		GRCr8
mRatBN7.2	Y	441,525 - 442,037 (+)	NCBI	mRatBN7.2	mRatBN7.2
UTH_Rnor_SHR_Utx	Y	1,408,967 - 1,409,476 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	Y	1,568,514 - 1,569,023 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	Y	780,432 - 780,941 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	Y	327,176 - 327,685 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	Y	327,166 - 329,299 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Cytogenetic Map	Y	q11	NCBI

SRY
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	Y	44,391,717 - 44,406,267 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	Y	2,531,737 - 2,532,564 (-)	NCBI		NHGRI_mPanPan1

SRY
(Canis lupus familiaris - dog)

No map positions available.

SRY
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	Y	40,484,990 - 40,485,700 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	Y	40,484,990 - 40,485,700 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	Y	279,587 - 280,297 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3
Pig Cytomap	Y	p12-p13	NCBI

SRY
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	X	927,143 - 928,924 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	X	927,692 - 928,303 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	122
Count of miRNA genes:	118
Interacting mature miRNAs:	120
Transcripts:	ENSMUST00000091178
Prediction methods:	Miranda, Pita, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

Markers in Region

PMC129753P1

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	Y	2,663,291 - 2,663,385	UniSTS	GRCm38
MGSCv37	Y	1,919,201 - 1,919,295	UniSTS	GRCm37
Celera	Y	5,571,100 - 5,571,194	UniSTS
Cytogenetic Map	Y	A1	UniSTS

PMC150978P1

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	Y	2,663,399 - 2,663,739	UniSTS	GRCm38
MGSCv37	Y	1,919,309 - 1,919,649	UniSTS	GRCm37
Celera	Y	5,570,746 - 5,571,086	UniSTS
Cytogenetic Map	Y	A1	UniSTS

PMC303372P2

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	Y	2,663,426 - 2,663,643	UniSTS	GRCm38
MGSCv37	Y	1,919,336 - 1,919,553	UniSTS	GRCm37
Celera	Y	5,570,842 - 5,571,059	UniSTS
Cytogenetic Map	Y	A1	UniSTS

Sry

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
MGSCv37	Y	1,919,411 - 1,919,534	UniSTS	GRCm37
MGSCv37	Y	1,919,322 - 1,919,553	UniSTS	GRCm37
MGSCv37	Y	1,919,203 - 1,919,574	UniSTS	GRCm37
MGSCv37	Y	1,919,207 - 1,919,818	UniSTS	GRCm37
MGSCv37	Y	1,919,303 - 1,919,581	UniSTS	GRCm37
MGSCv37	Y	1,918,056 - 1,919,660	UniSTS	GRCm37
MGSCv37	Y	1,919,309 - 1,919,574	UniSTS	GRCm37
MGSCv37	Y	1,920,916 - 1,921,379	UniSTS	GRCm37
MGSCv37	Y	1,919,293 - 1,919,610	UniSTS	GRCm37
MGSCv37	Y	1,919,372 - 1,919,519	UniSTS	GRCm37
MGSCv37	Y	1,919,192 - 1,919,398	UniSTS	GRCm37
MGSCv37	Y	1,919,221 - 1,919,624	UniSTS	GRCm37
MGSCv37	Y	1,919,293 - 1,919,625	UniSTS	GRCm37
MGSCv37	Y	1,919,203 - 1,919,537	UniSTS	GRCm37
MGSCv37	Y	1,919,253 - 1,919,652	UniSTS	GRCm37
MGSCv37	Y	1,916,685 - 1,917,148	UniSTS	GRCm37
MGSCv37	Y	1,919,243 - 1,919,591	UniSTS	GRCm37
Celera	Y	5,570,842 - 5,571,073	UniSTS
Celera	Y	5,570,804 - 5,571,152	UniSTS
Celera	Y	5,570,821 - 5,571,192	UniSTS
Celera	Y	5,570,814 - 5,571,092	UniSTS
Celera	Y	5,570,735 - 5,572,339	UniSTS
Celera	Y	5,569,036 - 5,569,499	UniSTS
Celera	Y	5,573,327 - 5,573,790	UniSTS
Celera	Y	5,570,771 - 5,571,174	UniSTS
Celera	Y	5,570,577 - 5,571,188	UniSTS
Celera	Y	5,570,876 - 5,571,023	UniSTS
Celera	Y	5,570,858 - 5,571,192	UniSTS
Celera	Y	5,570,861 - 5,570,984	UniSTS
Celera	Y	5,570,821 - 5,571,086	UniSTS
Celera	Y	5,570,785 - 5,571,102	UniSTS
Celera	Y	5,570,997 - 5,571,203	UniSTS
Celera	Y	5,570,770 - 5,571,102	UniSTS
Celera	Y	5,570,743 - 5,571,142	UniSTS
cM Map	Y	3.0	UniSTS
cM Map	Y	3.0	UniSTS
cM Map	Y	3.0	UniSTS
cM Map	Y	3.0	UniSTS

PMC303371P2

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	Y	2,663,332 - 2,663,737	UniSTS	GRCm38
MGSCv37	Y	1,919,242 - 1,919,647	UniSTS	GRCm37
Celera	Y	5,570,748 - 5,571,153	UniSTS
Cytogenetic Map	X	D	UniSTS
Cytogenetic Map	Y	A1	UniSTS
cM Map	X	42.0	UniSTS

UniSTS:485004

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	Y	2,662,471 - 2,663,658	UniSTS	GRCm38
MGSCv37	Y	1,918,381 - 1,919,568	UniSTS	GRCm37
Celera	Y	5,570,827 - 5,572,014	UniSTS
Cytogenetic Map	Y	A1	UniSTS

Sry

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	Y	2,663,383 - 2,663,700	UniSTS	GRCm38
MGSCv37	Y	1,919,293 - 1,919,610	UniSTS	GRCm37
Celera	Y	5,570,785 - 5,571,102	UniSTS
Cytogenetic Map	Y	A1	UniSTS
cM Map	Y	3.0	UniSTS

Sry

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
Cytogenetic Map	Y	A1	UniSTS
cM Map	Y	3.0	UniSTS

Sry

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	Y	2,663,293 - 2,663,664	UniSTS	GRCm38
MGSCv37	Y	1,919,203 - 1,919,574	UniSTS	GRCm37
Celera	Y	5,570,821 - 5,571,192	UniSTS
Cytogenetic Map	Y	A1	UniSTS
cM Map	Y	3.0	UniSTS

Sry

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
Cytogenetic Map	Y	A1	UniSTS
cM Map	Y	3.0	UniSTS

Sry

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	Y	2,663,282 - 2,663,488	UniSTS	GRCm38
MGSCv37	Y	1,919,192 - 1,919,398	UniSTS	GRCm37
Celera	Y	5,570,997 - 5,571,203	UniSTS
Cytogenetic Map	Y	A1	UniSTS

Sry

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	Y	2,663,462 - 2,663,609	UniSTS	GRCm38
MGSCv37	Y	1,919,372 - 1,919,519	UniSTS	GRCm37
Celera	Y	5,570,876 - 5,571,023	UniSTS
Cytogenetic Map	Y	A1	UniSTS
cM Map	Y	3.0	UniSTS

Sry

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	Y	2,663,399 - 2,663,664	UniSTS	GRCm38
MGSCv37	Y	1,919,309 - 1,919,574	UniSTS	GRCm37
Celera	Y	5,570,821 - 5,571,086	UniSTS
Cytogenetic Map	Y	A1	UniSTS
cM Map	Y	3.0	UniSTS

Sry

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	Y	2,665,006 - 2,665,469	UniSTS	GRCm38
GRCm38	Y	2,660,775 - 2,661,238	UniSTS	GRCm38
MGSCv37	Y	1,916,685 - 1,917,148	UniSTS	GRCm37
MGSCv37	Y	1,920,916 - 1,921,379	UniSTS	GRCm37
Celera	Y	5,573,327 - 5,573,790	UniSTS
Celera	Y	5,569,036 - 5,569,499	UniSTS
Cytogenetic Map	Y	A1	UniSTS

Sry

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
Cytogenetic Map	Y	A1	UniSTS

Sry

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	Y	2,663,293 - 2,663,627	UniSTS	GRCm38
MGSCv37	Y	1,919,203 - 1,919,537	UniSTS	GRCm37
Celera	Y	5,570,858 - 5,571,192	UniSTS
Cytogenetic Map	Y	A1	UniSTS
cM Map	Y	3.0	UniSTS

Sry

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	Y	2,663,501 - 2,663,624	UniSTS	GRCm38
MGSCv37	Y	1,919,411 - 1,919,534	UniSTS	GRCm37
Celera	Y	5,570,861 - 5,570,984	UniSTS
Cytogenetic Map	Y	A1	UniSTS

Sry

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	Y	2,663,311 - 2,663,714	UniSTS	GRCm38
MGSCv37	Y	1,919,221 - 1,919,624	UniSTS	GRCm37
Celera	Y	5,570,771 - 5,571,174	UniSTS
Cytogenetic Map	Y	A1	UniSTS
cM Map	Y	3.0	UniSTS

Sry

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	Y	2,663,297 - 2,663,908	UniSTS	GRCm38
MGSCv37	Y	1,919,207 - 1,919,818	UniSTS	GRCm37
Celera	Y	5,570,577 - 5,571,188	UniSTS
Cytogenetic Map	Y	A1	UniSTS
cM Map	Y	3.0	UniSTS

Sry

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
Cytogenetic Map	Y	A1	UniSTS

Sry

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	Y	2,663,412 - 2,663,643	UniSTS	GRCm38
MGSCv37	Y	1,919,322 - 1,919,553	UniSTS	GRCm37
Celera	Y	5,570,842 - 5,571,073	UniSTS
Cytogenetic Map	Y	A1	UniSTS

Sry

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	Y	2,663,399 - 2,663,664	UniSTS	GRCm38
MGSCv37	Y	1,919,309 - 1,919,574	UniSTS	GRCm37
Celera	Y	5,570,821 - 5,571,086	UniSTS
Cytogenetic Map	Y	A1	UniSTS

Sry

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	Y	2,662,146 - 2,663,750	UniSTS	GRCm38
MGSCv37	Y	1,918,056 - 1,919,660	UniSTS	GRCm37
Celera	Y	5,570,735 - 5,572,339	UniSTS
Cytogenetic Map	Y	A1	UniSTS
cM Map	Y	3.0	UniSTS

Sry

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	Y	2,663,343 - 2,663,742	UniSTS	GRCm38
MGSCv37	Y	1,919,253 - 1,919,652	UniSTS	GRCm37
Celera	Y	5,570,743 - 5,571,142	UniSTS
Cytogenetic Map	Y	A1	UniSTS

Sry

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	Y	2,663,333 - 2,663,681	UniSTS	GRCm38
MGSCv37	Y	1,919,243 - 1,919,591	UniSTS	GRCm37
Celera	Y	5,570,804 - 5,571,152	UniSTS
Cytogenetic Map	Y	A1	UniSTS

Sry

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	Y	2,663,383 - 2,663,715	UniSTS	GRCm38
MGSCv37	Y	1,919,293 - 1,919,625	UniSTS	GRCm37
Celera	Y	5,570,770 - 5,571,102	UniSTS
Cytogenetic Map	Y	A1	UniSTS

Sry

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	Y	2,663,393 - 2,663,671	UniSTS	GRCm38
Celera	Y	5,570,814 - 5,571,092	UniSTS
Cytogenetic Map	Y	A1	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_011564	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC140408	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF009519	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF068053	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF068054	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF070933	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF337043	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF337044	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF337045	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF337046	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF337047	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF337048	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF337049	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF337050	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC111528	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH466694	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JN631103	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JN631104	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JN631105	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JN631106	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JN631107	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JN631108	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JN631109	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JN631112	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JN631113	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JN631114	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JN631116	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JN631117	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JN631118	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JN631119	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JN631120	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JN631121	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JN631122	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JN631123	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JN631124	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JN631125	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JN631126	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JN631127	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JN631128	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JN631129	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JN631130	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JN631131	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JN631132	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JN631133	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JN631134	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JN631135	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JN631136	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JN631137	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JN631138	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JN631139	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JN631140	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JN631141	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JN631142	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JN631143	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JN631144	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JN631145	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JN631146	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JN631147	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JN631148	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	L29551	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	LC532173	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U03645	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U70641	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U70642	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U70643	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U70644	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U70645	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U70646	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U70647	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U70648	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U70649	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U70650	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U70651	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U70652	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U70653	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U70654	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U70655	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U70656	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U70657	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X55491	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X67204	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSMUST00000091178 ⟹ ENSMUSP00000088717

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	Y	2,662,471 - 2,663,658 (-)	Ensembl
GRCm38.p6 Ensembl	Y	2,662,471 - 2,663,658 (-)	Ensembl

RefSeq Acc Id:

NM_011564 ⟹ NP_035694

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39	Y	2,662,471 - 2,663,658 (-)	NCBI
GRCm38	Y	2,662,471 - 2,663,658 (-)	ENTREZGENE
MGSCv37	Y	1,918,381 - 1,919,568 (-)	RGD
Celera	Y	5,570,827 - 5,572,014 (+)	RGD
cM Map	Y		ENTREZGENE

Sequence:

show sequence

ATGGAGGGCCATGTCAAGCGCCCCATGAATGCATTTATGGTGTGGTCCCGTGGTGAGAGGCACA
AGTTGGCCCAGCAGAATCCCAGCATGCAAAATACAGAGATCAGCAAGCAGCTGGGATGCAGGTG
GAAAAGCCTTACAGAAGCCGAAAAAAGGCCCTTTTTCCAGGAGGCACAGAGATTGAAGATCCTA
CACAGAGAGAAATACCCAAACTATAAATATCAGCCTCATCGGAGGGCTAAAGTGTCACAGAGGA
GTGGCATTTTACAGCCTGCAGTTGCCTCAACAAAACTGTACAACCTTCTGCAGTGGGACAGGAA
CCCACATGCCATCACATACAGGCAAGACTGGAGTAGAGCTGCACACCTGTACTCCAAAAACCAG
CAAAGCTTTTATTGGCAGCCTGTTGATATCCCCACTGGGCACCTGCAGCAGCAGCAGCAGCAGC
AGCAGCAGCAGCAGTTCCATAACCACCACCAGCAGCAACAGCAGTTCTATGACCACCACCAGCA
GCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGTTCCATGACCACCACCAGCAGAAGCAGCAGTTT
CATGACCACCACCAGCAGCAACAGCAGTTCCATGACCACCACCACCACCACCAGGAGCAGCAGT
TCCATGACCACCACCAGCAGCAACAGCAGTTCCATGACCACCAGCAGCAGCAGCAGCAGCAGCA
GCAGCAGCAGTTCCATGACCACCACCAGCAGAAGCAGCAGTTCCATGACCACCACCACCACCAA
CAGCAGCAGCAGTTCCATGACCACCAGCAGCAGCAGCAGCAGTTCCATGACCACCAGCAGCAGC
AGCATCAGTTCCATGACCACCCCCAGCAGAAGCAGCAGTTCCATGACCACCCCCAGCAGCAACA
GCAGTTCCATGACCACCACCACCAGCAGCAGCAGAAGCAGCAGTTCCATGACCACCACCAGCAG
AAGCAGCAGTTCCATGACCACCACCAGCAGAAGCAGCAGTTCCATGACCACCACCAGCAGCAAC
AGCAGTTCCATGACCACCACCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGTTCCA
CGACCAGCAGCTTACCTACTTACTAACAGCTGACATCACTGGTGAGCATACACCATACCAGGAG
CACCTCAGCACAGCCCTGTGGTTGGCAGTCTCATGA

hide sequence

Protein Sequences


Protein RefSeqs	NP_035694	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA40142	(Get FASTA)	NCBI Sequence Viewer
	AAB60446	(Get FASTA)	NCBI Sequence Viewer
	AAC18865	(Get FASTA)	NCBI Sequence Viewer
	AAC18866	(Get FASTA)	NCBI Sequence Viewer
	AAC23599	(Get FASTA)	NCBI Sequence Viewer
	AAC53431	(Get FASTA)	NCBI Sequence Viewer
	AAC53432	(Get FASTA)	NCBI Sequence Viewer
	AAC53433	(Get FASTA)	NCBI Sequence Viewer
	AAC53434	(Get FASTA)	NCBI Sequence Viewer
	AAC53435	(Get FASTA)	NCBI Sequence Viewer
	AAC53436	(Get FASTA)	NCBI Sequence Viewer
	AAC53437	(Get FASTA)	NCBI Sequence Viewer
	AAC53438	(Get FASTA)	NCBI Sequence Viewer
	AAC53439	(Get FASTA)	NCBI Sequence Viewer
	AAC53440	(Get FASTA)	NCBI Sequence Viewer
	AAC53441	(Get FASTA)	NCBI Sequence Viewer
	AAC53442	(Get FASTA)	NCBI Sequence Viewer
	AAC53443	(Get FASTA)	NCBI Sequence Viewer
	AAC53444	(Get FASTA)	NCBI Sequence Viewer
	AAC53445	(Get FASTA)	NCBI Sequence Viewer
	AAC53446	(Get FASTA)	NCBI Sequence Viewer
	AAC53447	(Get FASTA)	NCBI Sequence Viewer
	AAC53450	(Get FASTA)	NCBI Sequence Viewer
	AAI11529	(Get FASTA)	NCBI Sequence Viewer
	AAK21911	(Get FASTA)	NCBI Sequence Viewer
	AAK21912	(Get FASTA)	NCBI Sequence Viewer
	AAK21913	(Get FASTA)	NCBI Sequence Viewer
	AAK21914	(Get FASTA)	NCBI Sequence Viewer
	AAK21915	(Get FASTA)	NCBI Sequence Viewer
	AAK21916	(Get FASTA)	NCBI Sequence Viewer
	AAK21917	(Get FASTA)	NCBI Sequence Viewer
	AAK21918	(Get FASTA)	NCBI Sequence Viewer
	AFD96487	(Get FASTA)	NCBI Sequence Viewer
	AFD96488	(Get FASTA)	NCBI Sequence Viewer
	AFD96489	(Get FASTA)	NCBI Sequence Viewer
	AFD96490	(Get FASTA)	NCBI Sequence Viewer
	AFD96491	(Get FASTA)	NCBI Sequence Viewer
	AFD96492	(Get FASTA)	NCBI Sequence Viewer
	AFD96493	(Get FASTA)	NCBI Sequence Viewer
	AFD96494	(Get FASTA)	NCBI Sequence Viewer
	AFD96495	(Get FASTA)	NCBI Sequence Viewer
	AFD96496	(Get FASTA)	NCBI Sequence Viewer
	AFD96499	(Get FASTA)	NCBI Sequence Viewer
	AFD96500	(Get FASTA)	NCBI Sequence Viewer
	AFD96502	(Get FASTA)	NCBI Sequence Viewer
	AFD96503	(Get FASTA)	NCBI Sequence Viewer
	AFD96504	(Get FASTA)	NCBI Sequence Viewer
	AFD96505	(Get FASTA)	NCBI Sequence Viewer
	AFD96506	(Get FASTA)	NCBI Sequence Viewer
	AFD96507	(Get FASTA)	NCBI Sequence Viewer
	AFD96508	(Get FASTA)	NCBI Sequence Viewer
	AFD96509	(Get FASTA)	NCBI Sequence Viewer
	AFD96510	(Get FASTA)	NCBI Sequence Viewer
	AFD96511	(Get FASTA)	NCBI Sequence Viewer
	AFD96512	(Get FASTA)	NCBI Sequence Viewer
	AFD96513	(Get FASTA)	NCBI Sequence Viewer
	AFD96514	(Get FASTA)	NCBI Sequence Viewer
	AFD96515	(Get FASTA)	NCBI Sequence Viewer
	AFD96516	(Get FASTA)	NCBI Sequence Viewer
	AFD96517	(Get FASTA)	NCBI Sequence Viewer
	AFD96518	(Get FASTA)	NCBI Sequence Viewer
	AFD96519	(Get FASTA)	NCBI Sequence Viewer
	AFD96520	(Get FASTA)	NCBI Sequence Viewer
	AFD96521	(Get FASTA)	NCBI Sequence Viewer
	AFD96522	(Get FASTA)	NCBI Sequence Viewer
	AFD96523	(Get FASTA)	NCBI Sequence Viewer
	AFD96524	(Get FASTA)	NCBI Sequence Viewer
	AFD96525	(Get FASTA)	NCBI Sequence Viewer
	AFD96526	(Get FASTA)	NCBI Sequence Viewer
	AFD96527	(Get FASTA)	NCBI Sequence Viewer
	AFD96528	(Get FASTA)	NCBI Sequence Viewer
	AFD96529	(Get FASTA)	NCBI Sequence Viewer
	AFD96530	(Get FASTA)	NCBI Sequence Viewer
	AFD96531	(Get FASTA)	NCBI Sequence Viewer
	AFD96532	(Get FASTA)	NCBI Sequence Viewer
	BCB24294	(Get FASTA)	NCBI Sequence Viewer
	CAA39111	(Get FASTA)	NCBI Sequence Viewer
	CAB56798	(Get FASTA)	NCBI Sequence Viewer
	EDL09053	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSMUSP00000088717
	ENSMUSP00000088717.2
GenBank Protein	Q05738	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_035694 ⟸ NM_011564

- UniProtKB:

Q53WV7 (UniProtKB/TrEMBL), Q2T9H0 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MEGHVKRPMNAFMVWSRGERHKLAQQNPSMQNTEISKQLGCRWKSLTEAEKRPFFQEAQRLKIL
HREKYPNYKYQPHRRAKVSQRSGILQPAVASTKLYNLLQWDRNPHAITYRQDWSRAAHLYSKNQ
QSFYWQPVDIPTGHLQQQQQQQQQQQFHNHHQQQQQFYDHHQQQQQQQQQQQQFHDHHQQKQQF
HDHHQQQQQFHDHHHHHQEQQFHDHHQQQQQFHDHQQQQQQQQQQQFHDHHQQKQQFHDHHHHQ
QQQQFHDHQQQQQQFHDHQQQQHQFHDHPQQKQQFHDHPQQQQQFHDHHHQQQQKQQFHDHHQQ
KQQFHDHHQQKQQFHDHHQQQQQFHDHHQQQQQQQQQQQQQFHDQQLTYLLTADITGEHTPYQE
HLSTALWLAVS

hide sequence

Ensembl Acc Id:

ENSMUSP00000088717 ⟸ ENSMUST00000091178

Protein Domains

HMG box

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q05738-F1-model_v2	AlphaFold	Q05738	1-392	view protein structure

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	MGI:98660	AgrOrtholog
Ensembl Genes	ENSMUSG00000069036	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSMUST00000091178	ENTREZGENE
	ENSMUST00000091178.2	UniProtKB/Swiss-Prot
Gene3D-CATH	1.10.30.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	HMG_box_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	HMG_box_dom_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SRY-related_HMG-box_TFs	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	mmu:21674	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGD	MGI:98660	ENTREZGENE
NCBI Gene	21674	ENTREZGENE
PANTHER	SEX-DETERMINING REGION Y PROTEIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SOX TRANSCRIPTION FACTOR	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	HMG_box	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Sry	PhenoGen
PROSITE	HMG_BOX_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
SMART	HMG	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF47095	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	H8ZX57_MOUSE	UniProtKB/TrEMBL
	H8ZX58_MOUSE	UniProtKB/TrEMBL
	H8ZX59_MOUSE	UniProtKB/TrEMBL
	H8ZX60_MOUSE	UniProtKB/TrEMBL
	H8ZX61_MOUSE	UniProtKB/TrEMBL
	H8ZX62_MOUSE	UniProtKB/TrEMBL
	H8ZX63_MOUSE	UniProtKB/TrEMBL
	H8ZX66_MOUSE	UniProtKB/TrEMBL
	H8ZX67_MOUSE	UniProtKB/TrEMBL
	H8ZX68_MOUSE	UniProtKB/TrEMBL
	H8ZX69_MOUSE	UniProtKB/TrEMBL
	H8ZX70_MOUSE	UniProtKB/TrEMBL
	H8ZX72_MOUSE	UniProtKB/TrEMBL
	H8ZX76_MOUSE	UniProtKB/TrEMBL
	H8ZX77_MOUSE	UniProtKB/TrEMBL
	H8ZX78_MOUSE	UniProtKB/TrEMBL
	H8ZX79_MOUSE	UniProtKB/TrEMBL
	H8ZX80_MOUSE	UniProtKB/TrEMBL
	H8ZX82_MOUSE	UniProtKB/TrEMBL
	H8ZX83_MOUSE	UniProtKB/TrEMBL
	H8ZX84_MOUSE	UniProtKB/TrEMBL
	H8ZX87_MOUSE	UniProtKB/TrEMBL
	H8ZX88_MOUSE	UniProtKB/TrEMBL
	H8ZX91_MOUSE	UniProtKB/TrEMBL
	H8ZX96_MOUSE	UniProtKB/TrEMBL
	H8ZX97_MOUSE	UniProtKB/TrEMBL
	H8ZX98_MOUSE	UniProtKB/TrEMBL
	H8ZX99_MOUSE	UniProtKB/TrEMBL
	H8ZXA2_MOUSE	UniProtKB/TrEMBL
	H8ZXA3_MOUSE	UniProtKB/TrEMBL
	Q05738	ENTREZGENE
	Q2T9H0	ENTREZGENE, UniProtKB/TrEMBL
	Q53WV7	ENTREZGENE, UniProtKB/TrEMBL
	Q62272_MOUSE	UniProtKB/TrEMBL
	SRY_MOUSE	UniProtKB/Swiss-Prot

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Mammalian Phenotype

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Mammalian Phenotype