Pf4 (platelet factor 4) - Rat Genome Database

Name: Pf4
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

Advanced Search (OLGA)

Gene: Pf4 (platelet factor 4) Mus musculus

Analyze

Symbol:

Pf4

Name:

platelet factor 4

RGD ID:

735658

MGI Page

MGI

Description:

Predicted to enable CXCR3 chemokine receptor binding activity; chemokine activity; and heparin binding activity. Involved in antimicrobial humoral immune response mediated by antimicrobial peptide and defense response to protozoan. Located in collagen-containing extracellular matrix. Is expressed in several structures, including blood vessel; bone marrow; central nervous system; liver; and yolk sac. Human ortholog(s) of this gene implicated in multiple myeloma. Orthologous to human PF4 (platelet factor 4) and PF4V1 (platelet factor 4 variant 1).

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

C-X-C motif chemokine 4; chemokine (C-X-C motif) ligand 4; Cxcl; Cxcl4; Pf; PF-4; Scyb; Scyb4

RGD Orthologs

Human

Rat

Bonobo

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	PF4 (platelet factor 4)	HGNC	Ensembl, HGNC, HomoloGene, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):	Pf4 (platelet factor 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	PF4 (platelet factor 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	PF4V1 (platelet factor 4 variant 1)	HGNC	HGNC, Inparanoid, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Alliance orthologs ³
Rattus norvegicus (Norway rat):	Pf4 (platelet factor 4)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	PF4 (platelet factor 4)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	PF4V1 (platelet factor 4 variant 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	cxcl8b.3 (chemokine (C-X-C motif) ligand 8b, duplicate 3)	Alliance	DIOPT (InParanoid\|PANTHER)

Latest Assembly:

GRCm39 - Mouse Genome Assembly GRCm39

Position:

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	5	90,920,362 - 90,921,242 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	5	90,920,294 - 90,921,242 (+)	Ensembl		GRCm39 Ensembl
GRCm38	5	90,772,435 - 90,773,383 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	5	90,772,435 - 90,773,383 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	5	91,201,461 - 91,202,409 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	5	91,847,713 - 91,848,583 (+)	NCBI		MGSCv36	mm8
Celera	5	88,924,056 - 88,925,004 (+)	NCBI		Celera
Cytogenetic Map	5	E1	NCBI
cM Map	5	44.78	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

acute myocardial infarction (ISO)

allergic disease (ISO)

anti-basement membrane glomerulonephritis (ISO)

antiphospholipid syndrome (ISO)

atherosclerosis (IMP)

autoimmune disease (ISO)

diabetic retinopathy (ISO)

Drug-Induced Immune Thrombocytopenia (ISO)

Electric Burns (ISO)

Endotoxemia (ISO)

Hypothermia (IEP)

Liver Reperfusion Injury (IMP)

Mesenteric Ischemia (IMP)

multiple myeloma (ISO)

Plaque, Atherosclerotic (ISO)

pneumonia (ISO)

Postoperative Complications (ISO)

Primary Graft Dysfunction (ISO)

retinal degeneration (ISO)

RETINAL DYSTROPHY WITH INNER RETINAL DYSFUNCTION AND GANGLION CELL ABNORMALITIES (ISO)

systemic scleroderma (ISO)

thrombocytopenia (ISO)

thrombosis (ISO)

Vascular System Injuries (IMP)

Venous Thrombosis (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

1-chloro-2,4-dinitrobenzene (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (EXP)

2,6-dinitrotoluene (ISO)

2-(3,4-dimethoxyphenyl)-5-\{[2-(3,4-dimethoxyphenyl)ethyl](methyl)amino\}-2-(propan-2-yl)pentanenitrile (ISO)

2-hydroxypropanoic acid (ISO)

3,3',4,4',5-pentachlorobiphenyl (ISO)

3-isobutyl-1-methyl-7H-xanthine (EXP)

3-methylcholanthrene (EXP)

4,4'-diaminodiphenylmethane (EXP)

4,4'-sulfonyldiphenol (EXP)

4-(ethoxymethylene)-2-phenyloxazol-5-one (EXP)

4-hydroxyphenyl retinamide (EXP)

acetylsalicylic acid (ISO)

acrolein (EXP)

acrylamide (ISO)

ADP (ISO)

aflatoxin B1 (EXP,ISO)

aldehydo-D-glucose (ISO)

all-trans-retinoic acid (EXP)

ammonium chloride (ISO)

antirheumatic drug (ISO)

Aroclor 1254 (EXP)

arsane (ISO)

arsenic atom (ISO)

barium sulfate (ISO)

benzene (ISO)

benzo[a]pyrene (EXP,ISO)

benzoic acid (ISO)

beta-naphthoflavone (ISO)

bexarotene (ISO)

bisphenol A (EXP,ISO)

bisphenol F (EXP)

Brevianamide A (EXP)

bucladesine (EXP)

C60 fullerene (ISO)

cadmium dichloride (ISO)

cangrelor (ISO)

cantharidin (EXP)

carbon nanotube (EXP)

carbonyl sulfide (ISO)

ceric oxide (ISO)

CGP 52608 (ISO)

choline (EXP)

cisplatin (ISO)

cobalt atom (EXP)

cocaine (ISO)

D-glucose (ISO)

dexamethasone (EXP)

dextran sulfate (EXP)

dichloromethane (ISO)

diethyl malate (EXP)

diethylstilbestrol (EXP)

doxorubicin (EXP,ISO)

entinostat (ISO)

ethylbenzene (ISO)

fentanyl (ISO)

flutamide (ISO)

folic acid (EXP)

fructose (ISO)

furan (ISO)

furosemide (ISO)

genistein (EXP)

glucose (ISO)

griseofulvin (EXP)

heparin (ISO)

hydrogen cyanide (EXP)

hydroquinone O-beta-D-glucopyranoside (ISO)

icariin (EXP)

isobutyl nitrite (EXP)

ketoconazole (ISO)

L-methionine (EXP)

lidocaine (ISO)

lipopolysaccharide (EXP,ISO)

melatonin (EXP)

methotrexate (ISO)

microcystin-LR (EXP)

mifepristone (ISO)

mono(2-ethylhexyl) phthalate (EXP)

N-nitrosodiethylamine (ISO)

naphthalene (EXP)

neoechinulin A (EXP)

nickel atom (EXP)

nortriptyline (ISO)

ozone (EXP)

paracetamol (EXP)

paroxetine (ISO)

perfluorohexanesulfonic acid (EXP)

phenformin (ISO)

poly(styrene) (ISO)

potassium cyanide (EXP)

pravastatin (EXP,ISO)

pregnenolone 16alpha-carbonitrile (EXP)

rac-lactic acid (ISO)

rebaudioside A (ISO)

resveratrol (ISO)

sertraline (ISO)

silibinin (ISO)

silicon dioxide (ISO)

Silidianin (ISO)

silychristin (ISO)

sodium arsenate (EXP)

sodium arsenite (EXP)

Soman (ISO)

sterigmatocystin (EXP)

steviol (ISO)

stevioside (ISO)

succimer (EXP)

testosterone (EXP)

tetrachloromethane (EXP,ISO)

titanium dioxide (EXP)

toluene 2,4-diisocyanate (EXP)

trichloroethene (ISO)

triphenyl phosphate (ISO)

troglitazone (EXP)

valproic acid (ISO)

verapamil (ISO)

vinclozolin (ISO)

zidovudine (ISO)

zinc atom (EXP)

zinc(0) (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

adenylate cyclase-activating G protein-coupled receptor signaling pathway (ISS)

antimicrobial humoral immune response mediated by antimicrobial peptide (IBA,IMP)

cellular response to lipopolysaccharide (IBA)

chemokine-mediated signaling pathway (IBA)

chemotaxis (IEA)

cytokine-mediated signaling pathway (ISS)

defense response (IEA)

defense response to protozoan (IMP)

immune response (ISO)

inflammatory response (IBA)

leukocyte chemotaxis (ISO)

monocyte chemotaxis (ISO)

negative regulation of angiogenesis (ISS)

negative regulation of blood coagulation (ISO)

negative regulation of extrinsic apoptotic signaling pathway in absence of ligand (ISO)

negative regulation of inflammatory response (IEA,ISO)

negative regulation of megakaryocyte differentiation (ISS)

negative regulation of MHC class II biosynthetic process (ISO)

negative regulation of T-helper 17 cell differentiation (IEA,ISO)

neutrophil chemotaxis (IBA)

osteoclast differentiation (ISO)

platelet activation (ISO)

positive regulation of gene expression (ISO)

positive regulation of macrophage derived foam cell differentiation (ISO)

positive regulation of macrophage differentiation (ISO)

positive regulation of transcription by RNA polymerase II (ISS)

positive regulation of tumor necrosis factor production (ISO)

protein-containing complex assembly (ISO)

regulation of cell population proliferation (ISO)

response to aldosterone (ISO)

Cellular Component

collagen-containing extracellular matrix (HDA)

cytoplasm (ISO)

extracellular region (IEA)

extracellular space (IBA)

platelet alpha granule (IEA,ISO)

protein-containing complex (IEA,ISO)

vesicle (ISO)

Molecular Function

chemokine activity (IBA,IEA,ISO)

CXCR chemokine receptor binding (IBA)

CXCR3 chemokine receptor binding (ISO,ISS)

cytokine activity (IEA)

heparin binding (ISO,ISS)

protein binding (ISO)

receptor ligand activity (ISO)

Phenotype Annotations Click to see Annotation Detail View

Mammalian Phenotype

decreased susceptibility to induced thrombosis (IAGP)

thrombocytosis (IAGP)

References

References - curated

#	Reference Title	Reference Citation
1.	Platelet factor 4 limits Th17 differentiation and ischaemia-reperfusion injury after liver transplantation in mice.	Guo H, etal., Scand J Immunol. 2015 Feb;81(2):129-34. doi: 10.1111/sji.12257.
2.	Hypothermia-induced activation of the splenic platelet pool as a risk factor for thrombotic disease in a mouse model.	Horioka K, etal., J Thromb Haemost. 2019 Oct;17(10):1762-1771. doi: 10.1111/jth.14555. Epub 2019 Jul 17.
3.	Contribution to the peripheral vasculopathy and endothelial cell dysfunction by CXCL4 in Systemic Sclerosis.	Jiang Z, etal., J Dermatol Sci. 2021 Oct;104(1):63-73. doi: 10.1016/j.jdermsci.2021.07.006. Epub 2021 Jul 14.
4.	Protective Effect of Royal Jelly against Cyclophosphamide-Induced Thrombocytopenia and Spleen and Bone Marrow Damages in Rats.	Khazaei F, etal., Cell J. 2020 Oct;22(3):302-309. doi: 10.22074/cellj.2020.6703. Epub 2019 Dec 15.
5.	Disrupting functional interactions between platelet chemokines inhibits atherosclerosis in hyperlipidemic mice.	Koenen RR, etal., Nat Med. 2009 Jan;15(1):97-103. doi: 10.1038/nm.1898. Epub 2009 Jan 4.
6.	Electronic Transfer of Homolog Data	MGD and Homologene mouse data transfer
7.	MGDs mouse GO annotations	MGD data from the GO Consortium
8.	MGD IEA	MGD IEA
9.	Autocrine CCL2, CXCL4, CXCL9 and CXCL10 signal in retinal endothelial cells and are enhanced in diabetic retinopathy.	Nawaz MI, etal., Exp Eye Res. 2013 Apr;109:67-76. doi: 10.1016/j.exer.2013.01.008. Epub 2013 Jan 22.
10.	Gene expression changes in the retina after systemic administration of aldosterone.	Ono A, etal., Jpn J Ophthalmol. 2018 Jul;62(4):499-507. doi: 10.1007/s10384-018-0595-4. Epub 2018 Apr 30.
11.	Elevated expression of platelet-derived chemokines in patients with antiphospholipid syndrome.	Patsouras MD, etal., J Autoimmun. 2015 Dec;65:30-7. doi: 10.1016/j.jaut.2015.08.001. Epub 2015 Aug 15.
12.	Platelet factor 4 localization in carotid atherosclerotic plaques: correlation with clinical parameters.	Pitsilos S, etal., Thromb Haemost. 2003 Dec;90(6):1112-20. doi: 10.1160/TH03-02-0069.
13.	Mouse MP Annotation Import Pipeline	RGD automated import pipeline
14.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
15.	Incidence and clinical relevance of anti-platelet factor 4/heparin antibodies before cardiac surgery.	Selleng S, etal., Am Heart J. 2010 Aug;160(2):362-9. doi: 10.1016/j.ahj.2010.05.026.
16.	Platelet factor 4 mediates vascular smooth muscle cell injury responses.	Shi G, etal., Blood. 2013 May 23;121(21):4417-27. doi: 10.1182/blood-2012-09-454710. Epub 2013 Apr 8.
17.	Cloning and genomic localization of the murine LPS-induced CXC chemokine (LIX) gene, Scyb5.	Smith JB, etal., Immunogenetics 2002 Nov;54(8):599-603. Epub 2002 Oct 1.
18.	Platelet factor 4 and β-thromboglobulin mRNAs in circulating microparticles of trauma patients as diagnostic markers for deep vein thrombosis.	Su Y, etal., J Thromb Thrombolysis. 2020 Oct;50(3):525-532. doi: 10.1007/s11239-020-02124-5.
19.	Propofol lowers serum PF4 level and partially corrects hypercoagulopathy in endotoxemic rats.	Tang J, etal., Biochim Biophys Acta. 2010 Sep;1804(9):1895-901. doi: 10.1016/j.bbapap.2010.06.018. Epub 2010 Jun 28.
20.	Chemokine gene expression in anti-glomerular basement membrane antibody glomerulonephritis.	Tang WW, etal., Am J Physiol. 1995 Sep;269(3 Pt 2):F323-30. doi: 10.1152/ajprenal.1995.269.3.F323.
21.	rLj-RGD3, a novel recombinant toxin protein from Lampetra japonica, prevents coronary thrombosis-induced acute myocardial infarction by inhibiting platelet functions in rats.	Wang S, etal., Biochem Biophys Res Commun. 2018 Mar 25;498(1):240-245. doi: 10.1016/j.bbrc.2018.02.021. Epub 2018 Feb 3.
22.	Platelet factor-4 and its p17-70 peptide inhibit myeloma proliferation and angiogenesis in vivo.	Yang L, etal., BMC Cancer. 2011 Jun 21;11:261. doi: 10.1186/1471-2407-11-261.
23.	Platelet factor 4 protects kidney allograft in a rat kidney transplantation model.	Zhang L, etal., Inflammation. 2015 Apr;38(2):520-6. doi: 10.1007/s10753-014-9958-2.
24.	[Changes of platelet rheological behavior and the interventional effects of ulinastatin in rats with high-voltage electrical burns].	Zhang QF, etal., Zhonghua Shao Shang Za Zhi. 2017 Dec 20;33(12):744-749. doi: 10.3760/cma.j.issn.1009-2587.2017.12.005.

Additional References at PubMed

PMID:9708806	PMID:10319581	PMID:10349636	PMID:11042159	PMID:11076861	PMID:11217851	PMID:11301191	PMID:11369593	PMID:11468158	PMID:11588041	PMID:12080938	PMID:12466851
PMID:12477932	PMID:12755332	PMID:12819125	PMID:14764524	PMID:15531763	PMID:15613031	PMID:15964840	PMID:16141072	PMID:16141073	PMID:16602821	PMID:16757682	PMID:16961586
PMID:17495129	PMID:17540840	PMID:17673674	PMID:17848616	PMID:17914028	PMID:18000617	PMID:18174362	PMID:18213587	PMID:18248618	PMID:18554416	PMID:18692777	PMID:19210546
PMID:19372458	PMID:19605848	PMID:20162727	PMID:20203303	PMID:20454664	PMID:20525356	PMID:20688960	PMID:20724543	PMID:20959601	PMID:21267068	PMID:21308776	PMID:21509788
PMID:21772054	PMID:21873635	PMID:22159717	PMID:22706078	PMID:22792197	PMID:23245326	PMID:23288157	PMID:24177324	PMID:24463452	PMID:25326802	PMID:25960020	PMID:26256688
PMID:26478565	PMID:26518435	PMID:26527618	PMID:27183218	PMID:27222476	PMID:27223426	PMID:27721240	PMID:27755915	PMID:27888192	PMID:28120850	PMID:28218620	PMID:28319310
PMID:28381538	PMID:28914425	PMID:29914979	PMID:30296305	PMID:30481563	PMID:30898878	PMID:30917957	PMID:30971954	PMID:31712428	PMID:31722003	PMID:32077913	PMID:32187355
PMID:32525843	PMID:32538218	PMID:34099640	PMID:34321999	PMID:34421345	PMID:34986347	PMID:35579435	PMID:36329090	PMID:37565509	PMID:37587343	PMID:37774709	PMID:37991024
PMID:38029855	PMID:38547695	PMID:38577984	PMID:38657496

Genomics

Comparative Map Data

Pf4
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	5	90,920,362 - 90,921,242 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	5	90,920,294 - 90,921,242 (+)	Ensembl		GRCm39 Ensembl
GRCm38	5	90,772,435 - 90,773,383 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	5	90,772,435 - 90,773,383 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	5	91,201,461 - 91,202,409 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	5	91,847,713 - 91,848,583 (+)	NCBI		MGSCv36	mm8
Celera	5	88,924,056 - 88,925,004 (+)	NCBI		Celera
Cytogenetic Map	5	E1	NCBI
cM Map	5	44.78	NCBI

PF4
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	4	73,980,811 - 73,982,124 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	4	73,980,811 - 73,982,027 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	4	74,846,528 - 74,847,841 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	4	75,065,660 - 75,066,541 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	4	75,211,830 - 75,212,712	NCBI
Celera	4	72,206,939 - 72,207,858 (-)	NCBI		Celera
Cytogenetic Map	4	q13.3	NCBI
HuRef	4	70,657,501 - 70,658,800 (-)	NCBI		HuRef
CHM1_1	4	74,882,437 - 74,883,736 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	4	77,324,459 - 77,325,772 (-)	NCBI		T2T-CHM13v2.0

Pf4
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	14	17,582,477 - 17,583,392 (-)	NCBI		GRCr8
mRatBN7.2	14	17,298,304 - 17,299,220 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	14	17,298,308 - 17,299,365 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	14	17,298,559 - 17,299,267 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	14	18,617,480 - 18,618,188 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	14	17,309,831 - 17,310,539 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	14	18,848,549 - 18,849,258 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	14	18,848,549 - 18,849,258 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	14	18,758,191 - 18,758,900 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	14	18,812,550 - 18,813,259 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	14	18,813,312 - 18,815,140 (-)	NCBI
Celera	14	16,674,419 - 16,675,127 (-)	NCBI		Celera
Cytogenetic Map	14	p22	NCBI

PF4
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	3	56,076,726 - 56,078,720 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	4	56,265,831 - 56,267,844 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	4	50,208,806 - 50,210,570 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	4	56,041,833 - 56,043,133 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	4	56,041,833 - 56,043,750 (+)	Ensembl	panpan1.1		panPan2

Variants

Variants in Pf4
50 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	68
Count of miRNA genes:	67
Interacting mature miRNAs:	68
Transcripts:	ENSMUST00000031320
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCm39)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
4140990	Lgq6_m	late growth QTL 6 (mouse)			Not determined			32133234	100777931	Mouse
1301010	ahl2_m	age related hearing loss 2 (mouse)			Not determined		5	62650568	96650688	Mouse
1301399	Cpfd3_m	cerebellum pattern fissures (mouse)			Not determined		5	87386871	121387065	Mouse
12910784	Pwgrq15_m	post-weaning growth rate QTL 15 (mouse)					5	77175823	97658215	Mouse
1301524	Lmb2_m	lupus in MRL and B6 F2 cross (mouse)			Not determined		5	37581488	112465722	Mouse
25314315	Mlh1fc4_m	MLH1 foci count 4 (mouse)					5	74460661	132528839	Mouse
1357725	Eae39_m	experimental allergic encephalomyelitis 39 (mouse)			Not determined		5	89418876	118864028	Mouse
10045972	Tir5_m	trypanosome infection response 5 (mouse)			Not determined		5	63705442	104387065	Mouse
1300993	Hycdc_m	hypercapnic duty cycle (mouse)			Not determined		5	90561006	124561151	Mouse
1301126	Bwem1_m	body weight day 30 males 1 (mouse)			Not determined		5	87386871	121387065	Mouse
4141219	W10q16_m	weight 10 weeks QTL 16 (mouse)			Not determined			32133234	100777931	Mouse
12910816	Ogrq2_m	overall growth rate QTL 2 (mouse)					5	77175823	97658215	Mouse
1301691	Cdcs10_m	cytokine deficiency colitis susceptibility 10 (mouse)			Not determined		5	76280786	110280917	Mouse
11041665	Lmr24_m	leishmaniasis resistance 24 (mouse)					5	52694462	107321041	Mouse
10043958	Chldq12_m	cholesterol and HDL QTL 12 (mouse)			Not determined		5	87386871	121387065	Mouse
26884395	Humsd2_m	humerus midshaft diameter 2, 10 week (mouse)					5	70057343	132528839	Mouse
11252124	Modvl6_m	modifier of vacuolated lens 6 (mouse)					5	62650568	96650688	Mouse
1301419	Cypr3_m	cytokine production 3 (mouse)			Not determined		5	81019649	115019803	Mouse
11341716	Rvfs3_m	Rift Valley fever susceptibility 3 (mouse)					5	26441234	138455402	Mouse
13506928	Recrq8_m	recombination rate in male meiosis QTL 8 (mouse)					5	74460661	132528839	Mouse
1301843	Listr1_m	listeriosis resistance 1 (mouse)			Not determined		5	60246081	94246203	Mouse
10043993	Hbnr10_m	Heligmosomoides bakeri nematode resistance 10 (mouse)			Not determined		5	72418876	106419011	Mouse
27226719	Tibw6_m	tibia width 6, proximal, 16 week (mouse)					5	72857343	139985755	Mouse
10401246	Bglu13_m	blood glucose level 13 (mouse)			Not determined		5	79539640	113539786	Mouse
4141438	Skmw13_m	skeletal muscle weight 13 (mouse)			Not determined		5	76190263	110190479	Mouse
1301713	Dbsty2_m	diabesity 2 (mouse)			Not determined		5	76445064	110445225	Mouse
1301457	Cfsw2_m	cystic fibrosis survival to weaning 2 (mouse)			Not determined		5	90561006	124561151	Mouse
11041899	Lmr24a_m	leishmaniasis resistance 24a (mouse)					5	52694462	107321041	Mouse
10401245	Bglu18_m	blood glucose level 18 (mouse)			Not determined		5	82838468	116838597	Mouse
4142064	Tmc1m4_m	Tmc1 modifier 4 (mouse)			Not determined		5	54500177	127001072	Mouse
1300931	Cocrb6_m	cocaine related behavior 6 (mouse)			Not determined		5	76445064	110445225	Mouse
4142317	Rgcs1_m	retinal ganglion cell susceptible 1 (mouse)			Not determined			55388334	108762627	Mouse
1300801	Drb2_m	dopamine receptor binding 2 (mouse)			Not determined		5	87386871	121387065	Mouse
1301829	Thyls2_m	thymic lymphoma susceptibility 2 (mouse)			Not determined		5	76445064	110445225	Mouse
12904740	M1fscn2_m	modifier 1 of Fscn2 (mouse)					5	66529661	100529661	Mouse
10755524	Mono1_m	monocyte differential 1 (mouse)					5	80849259	114849259	Mouse
1301362	Prnr1_m	prion resistance 1 (mouse)			Not determined		5	89418876	146787935	Mouse
4142428	Modvl1_m	modifier of vacuolated lens 1 (mouse)			Not determined			62650568	96650688	Mouse
1357431	Cia27_m	collagen induced arthritis 27 (mouse)			Not determined		5	75315348	120018629	Mouse
11040589	Lmr3a_m	leishmaniasis resistance 3a (mouse)					5	59602801	93602980	Mouse
11040590	Lmr3b_m	leishmaniasis resistance 3b (mouse)					5	59602801	93602980	Mouse
11040591	Lmr3c_m	leishmaniasis resistance 3c (mouse)					5	59602801	93602980	Mouse
12904739	M2fscn2_m	modifier 2 of FSCN2 (mouse)					5	66529661	100529661	Mouse
1301243	Bmd2_m	bone mineral density 2 (mouse)			Not determined		5	55388334	100455525	Mouse
1300986	Hdlq2_m	HDL QTL 2 (mouse)			Not determined		5	76280786	110280917	Mouse
11049560	Lmr24d_m	leishmaniasis resistance 24d (mouse)					5	64374877	98374996	Mouse
11049562	Lmr24f_m	leishmaniasis resistance 24f (mouse)					5	90320962	124321041	Mouse
13464249	Ahl16_m	age related hearing loss, early onset 16 (mouse)					5	76445064	110445225	Mouse
13464250	Ahl15_m	age related hearing loss, early onset 15 (mouse)					5	62650568	96650688	Mouse
11040592	Lmr3d_m	leishmaniasis resistance 3d (mouse)					5	59602801	93602980	Mouse
13464247	Ahl14_m	age related hearing loss, early onset 14 (mouse)					5	60403062	94403160	Mouse
4141124	Dshv2_m	dorsal hippocampal volume 2 (mouse)			Not determined		5	75315348	98019803	Mouse
1300968	Skts4_m	skin tumor susceptibility 4 (mouse)			Not determined		5	89418876	124238239	Mouse
10044005	Ahl7_m	age related hearing loss 7 (mouse)			Not determined		5	58330502	92330641	Mouse
13464241	Ahl18_m	age related hearing loss, early onset 18 (mouse)					5	87386871	121387065	Mouse
4141505	Chlq14_m	circulating hormone level QTL 14 (mouse)			Not determined		5	76280786	110280917	Mouse
13464242	Ahl17_m	age related hearing loss, early onset 17 (mouse)					5	82838468	116838597	Mouse

Markers in Region

RH129105

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	5	90,773,238 - 90,773,389	UniSTS	GRCm38
MGSCv37	5	91,202,264 - 91,202,415	UniSTS	GRCm37
Celera	5	88,924,859 - 88,925,010	UniSTS
Cytogenetic Map	5	E1	UniSTS

Cxcl4

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
Cytogenetic Map	5	E1	UniSTS
cM Map	5		UniSTS

AB017491

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	5	90,773,251 - 90,773,341	UniSTS	GRCm38
MGSCv37	5	91,202,277 - 91,202,367	UniSTS	GRCm37
Celera	5	88,924,872 - 88,924,962	UniSTS
Cytogenetic Map	5	E1	UniSTS
Whitehead/MRC_RH	5	1116.38	UniSTS

Pf4

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	5	90,772,993 - 90,773,204	UniSTS	GRCm38
MGSCv37	5	91,202,019 - 91,202,230	UniSTS	GRCm37
Celera	5	88,924,614 - 88,924,825	UniSTS
Cytogenetic Map	5	E1	UniSTS

PMC303331P1

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	5	90,772,284 - 90,772,489	UniSTS	GRCm38
MGSCv37	5	91,201,310 - 91,201,515	UniSTS	GRCm37
Celera	5	88,923,905 - 88,924,110	UniSTS
Cytogenetic Map	5	E1	UniSTS

PMC303331P3

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	5	90,772,923 - 90,773,280	UniSTS	GRCm38
MGSCv37	5	91,201,949 - 91,202,306	UniSTS	GRCm37
Celera	5	88,924,544 - 88,924,901	UniSTS
Cytogenetic Map	5	E1	UniSTS

Pf4

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	5	90,772,590 - 90,773,007	UniSTS	GRCm38
MGSCv37	5	91,201,616 - 91,202,033	UniSTS	GRCm37
Celera	5	88,924,211 - 88,924,628	UniSTS
Cytogenetic Map	5	E1	UniSTS

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_019932	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AB017491	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AC105995	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AC113262	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF349465	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK159278	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK160040	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC061111	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BY794492	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH466617	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSMUST00000031320 ⟹ ENSMUSP00000031320

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	5	90,920,294 - 90,921,242 (+)	Ensembl
GRCm38.p6 Ensembl	5	90,772,435 - 90,773,383 (+)	Ensembl

Ensembl Acc Id:

ENSMUST00000201990

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	5	90,920,750 - 90,921,237 (+)	Ensembl
GRCm38.p6 Ensembl	5	90,772,891 - 90,773,378 (+)	Ensembl

Ensembl Acc Id:

ENSMUST00000202625 ⟹ ENSMUSP00000143818

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	5	90,920,372 - 90,921,015 (+)	Ensembl
GRCm38.p6 Ensembl	5	90,772,513 - 90,773,156 (+)	Ensembl

RefSeq Acc Id:

NM_019932 ⟹ NP_064316

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39	5	90,920,362 - 90,921,242 (+)	NCBI
GRCm38	5	90,772,435 - 90,773,383 (+)	ENTREZGENE
MGSCv37	5	91,201,461 - 91,202,409 (+)	RGD
Celera	5	88,924,056 - 88,925,004 (+)	RGD
cM Map	5		ENTREZGENE

Sequence:

show sequence

CCTGTATCCTGGGTTTCCGGACTGGGCAGGCAGTGAAGATAAAACGTGCTTGGGAAGTCCCAGG
AGCTGCTGGCCTGCACTTAAGAGCCCTAGACCCATTTCCTCAAGGTAGAACTTTATCTTTGGGT
CCAGTGGCACCCTCTTGACATGAGCGTCGCTGCGGTGTTTCGAGGCCTCCGGCCCAGTCCTGAG
CTGCTGCTTCTGGGCCTGTTGTTTCTGCCAGCGGTGGTTGCTGTCACCAGCGCTGGTCCCGAAG
AAAGCGATGGAGATCTTAGCTGTGTGTGTGTGAAGACCATCTCCTCTGGGATCCATCTTAAGCA
CATCACCAGCCTGGAGGTGATCAAGGCAGGACGCCACTGTGCGGTTCCCCAGCTCATAGCCACC
CTGAAGAATGGGAGGAAAATTTGCCTGGACCGGCAAGCACCCCTATATAAGAAAGTAATCAAGA
AAATCCTGGAGAGTTAGGTATCAGCTGCCTAAATGTCAATTGTGTTACAAGACTCCTGGAATCT
TGTCTACTTTTAATGTAACTGCAATCTTCCGATGTTTATATTATCCTTCAAGATTTAAATAAAT
GCATTGAACCAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_064316	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH61111	(Get FASTA)	NCBI Sequence Viewer
	AAK30163	(Get FASTA)	NCBI Sequence Viewer
	BAA75660	(Get FASTA)	NCBI Sequence Viewer
	BAE34956	(Get FASTA)	NCBI Sequence Viewer
	BAE35582	(Get FASTA)	NCBI Sequence Viewer
	EDL05304	(Get FASTA)	NCBI Sequence Viewer
	EDL05305	(Get FASTA)	NCBI Sequence Viewer
	EDL05306	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSMUSP00000031320
	ENSMUSP00000031320.7
	ENSMUSP00000143818.2
GenBank Protein	Q9Z126	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_064316 ⟸ NM_019932
- Peptide Label:	precursor
- UniProtKB:	Q9Z126 (UniProtKB/Swiss-Prot), Q3TVN6 (UniProtKB/TrEMBL), Q6P8R3 (UniProtKB/TrEMBL)
- Sequence:	show sequence MSVAAVFRGLRPSPELLLLGLLFLPAVVAVTSAGPEESDGDLSCVCVKTISSGIHLKHITSLEV IKAGRHCAVPQLIATLKNGRKICLDRQAPLYKKVIKKILES hide sequence

Ensembl Acc Id:

ENSMUSP00000143818 ⟸ ENSMUST00000202625

Ensembl Acc Id:

ENSMUSP00000031320 ⟸ ENSMUST00000031320

Protein Domains

Chemokine interleukin-8-like

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q9Z126-F1-model_v2	AlphaFold	Q9Z126	1-105	view protein structure

Promoters

RGD ID:

6887122

Promoter ID:

EPDNEW_M7012

Type:

initiation region

Name:

Pf4_1

Description:

Mus musculus platelet factor 4 , mRNA.

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm38	5	90,772,503 - 90,772,563	EPDNEW

RGD ID:

6838028

Promoter ID:

MM_KWN:42846

Type:

Non-CpG

SO ACC ID:

SO:0000170

Source:

MPROMDB

Tissues & Cell Lines:

BoneMarrow_0Hour, Spleen

Transcripts:

NM_019932

Position:

Mouse Assembly	Chr	Position (strand)	Source
MGSCv36	5	91,201,579 - 91,202,079 (+)	MPROMDB

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	MGI:1888711	AgrOrtholog
Ensembl Genes	ENSMUSG00000029373	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Ensembl Transcript	ENSMUST00000031320	ENTREZGENE
	ENSMUST00000031320.8	UniProtKB/Swiss-Prot
	ENSMUST00000202625.2	UniProtKB/TrEMBL
Gene3D-CATH	2.40.50.40	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	Chemokine_b/g/d	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Chemokine_CXC	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Chemokine_CXC_CS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Chemokine_IL8-like_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	CXC_Chemokine_domain	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Interleukin_8-like_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	mmu:56744	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGD	MGI:1888711	ENTREZGENE
NCBI Gene	56744	ENTREZGENE
PANTHER	PLATELET FACTOR 4	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SMALL INDUCIBLE CYTOKINE A	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	IL8	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Pf4	PhenoGen
PRINTS	INTERLEUKIN8	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SMALLCYTKCXC	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	SMALL_CYTOKINES_CXC	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
SMART	SCY	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF54117	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A0J9YTR7_MOUSE	UniProtKB/TrEMBL
	PLF4_MOUSE	UniProtKB/Swiss-Prot
	Q3TVN6	ENTREZGENE, UniProtKB/TrEMBL
	Q6P8R3	ENTREZGENE, UniProtKB/TrEMBL
	Q9Z126	ENTREZGENE

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - CTD

Mammalian Phenotype