Advanced Search (OLGA)

Gene: APOC1 (apolipoprotein C1) Homo sapiens

Analyze

Symbol:

APOC1

Name:

apolipoprotein C1

RGD ID:

735472

HGNC Page

HGNC:607

Description:

Enables fatty acid binding activity and phospholipase inhibitor activity. Involved in several processes, including cholesterol efflux; negative regulation of lipid metabolic process; and negative regulation of transport. Located in endoplasmic reticulum. Part of high-density lipoprotein particle and very-low-density lipoprotein particle. Implicated in Alzheimer's disease and obesity. Biomarker of gastric adenocarcinoma; hepatocellular carcinoma; pancreatic ductal carcinoma; and type 2 diabetes mellitus.

Type:

protein-coding

RefSeq Status:

REVIEWED

Previously known as:

Apo-CI; apo-CIB; ApoC-I; apoC-IB; APOC1B; apolipoprotein C-I; apolipoprotein C-I variant I; apolipoprotein C-I variant II

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Mus musculus (house mouse):	Apoc1 (apolipoprotein C-I)	HGNC	Ensembl, HGNC, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):	Apoc1 (apolipoprotein C1)	HGNC	Ensembl, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Chinchilla lanigera (long-tailed chinchilla):	Apoc1 (apolipoprotein C1)	NCBI	Ortholog
Pan paniscus (bonobo/pygmy chimpanzee):	APOC1 (apolipoprotein C1)	NCBI	Ortholog
Canis lupus familiaris (dog):	APOC1 (apolipoprotein C1)	HGNC	Ensembl, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Apoc1 (apolipoprotein C1)	NCBI	Ortholog
Heterocephalus glaber (naked mole-rat):	Apoc1 (apolipoprotein C1)	NCBI	Ortholog
Alliance orthologs ³
Rattus norvegicus (Norway rat):	Apoc1 (apolipoprotein C1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Apoc1 (apolipoprotein C-I)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	apoc1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|PANTHER\|PhylomeDB\|ZFIN)
Xenopus laevis (African clawed frog):	apoc1.L	Alliance	DIOPT (Xenbase)

Related Pseudogenes:

APOC1P1

Allele / Splice:

See ClinVar data

Candidate Gene For:

BW139_H

Latest Assembly:

GRCh38 - Human Genome Assembly GRCh38

Position:

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	19	44,914,325 - 44,919,346 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	19	44,914,247 - 44,919,349 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	19	45,417,582 - 45,422,603 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	19	50,109,761 - 50,114,446 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	19	50,109,760 - 50,114,446	NCBI
Celera	19	42,222,238 - 42,226,929 (+)	NCBI		Celera
Cytogenetic Map	19	q13.32	NCBI
HuRef	19	41,848,690 - 41,853,227 (+)	NCBI		HuRef
CHM1_1	19	45,420,643 - 45,425,333 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	19	47,739,017 - 47,744,046 (+)	NCBI		T2T-CHM13v2.0

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Alzheimer's disease (EXP,IAGP)

congestive heart failure (EXP)

Diabetic Nephropathies (IEP)

gastric adenocarcinoma (IEP)

hepatocellular carcinoma (IEP)

Hypertriglyceridemia (IEP)

Insulin Resistance (IMP)

Memory Disorders (IAGP)

obesity (IMP)

pancreatic ductal carcinoma (IEP)

type 2 diabetes mellitus (IEP)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-ephedrine (EXP)

1,1-dichloroethene (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

3,4-methylenedioxymethamphetamine (ISO)

3-isobutyl-1-methyl-7H-xanthine (EXP)

3-methylcholanthrene (ISO)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

5-aza-2'-deoxycytidine (EXP)

5-fluorouracil (EXP)

6-propyl-2-thiouracil (ISO)

7,12-dimethyltetraphene (ISO)

acetamide (ISO)

acetylsalicylic acid (ISO)

aflatoxin B1 (EXP,ISO)

alpha-hexachlorocyclohexane (ISO)

ammonium chloride (ISO)

arachidonic acid (ISO)

belinostat (EXP)

Benoxacor (ISO)

benzalkonium chloride (ISO)

benzo[a]pyrene (EXP,ISO)

bexarotene (ISO)

bisphenol A (EXP,ISO)

bisphenol AF (EXP)

Bisphenol B (EXP)

bisphenol F (EXP,ISO)

butanal (EXP)

cadmium dichloride (EXP)

caffeine (EXP,ISO)

capsaicin (EXP)

chlordecone (ISO)

cisplatin (EXP)

clofibrate (ISO)

cobalt dichloride (ISO)

copper atom (EXP)

copper(0) (EXP)

copper(II) sulfate (EXP)

Cuprizon (ISO)

cyclosporin A (EXP)

DDE (EXP)

dexamethasone (EXP)

dicyclanil (ISO)

dioxygen (ISO)

diuron (EXP)

doxorubicin (EXP)

flutamide (ISO)

furan (ISO)

genistein (ISO)

gentamycin (ISO)

hydrazine (ISO)

indometacin (EXP,ISO)

isotretinoin (EXP)

lithocholic acid (ISO)

methapyrilene (ISO)

methimazole (ISO)

methylisothiazolinone (EXP)

methylmercury chloride (EXP)

mifepristone (EXP,ISO)

nickel atom (EXP)

nitrofen (ISO)

ochratoxin A (ISO)

paracetamol (EXP,ISO)

perfluorononanoic acid (EXP)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (EXP)

pioglitazone (EXP)

pirinixic acid (ISO)

quercetin (EXP)

resveratrol (EXP)

senecionine (ISO)

serpentine asbestos (EXP)

silicon dioxide (EXP)

simvastatin (ISO)

sodium arsenite (EXP,ISO)

sodium fluoride (ISO)

sulfadimethoxine (ISO)

sunitinib (EXP)

tamoxifen (ISO)

Tanshinone I (EXP)

tetrachloroethene (ISO)

tetrachloromethane (ISO)

tetracycline (ISO)

thioacetamide (ISO)

titanium dioxide (ISO)

toluene (ISO)

tributylstannane (ISO)

urethane (EXP)

valproic acid (EXP)

vorinostat (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cholesterol efflux (IDA)

cholesterol metabolic process (IEA)

chylomicron remnant clearance (IDA)

high-density lipoprotein particle remodeling (TAS)

lipid metabolic process (TAS)

lipid transport (IEA)

lipoprotein metabolic process (IEA)

negative regulation of cholesterol transport (IBA,IDA)

negative regulation of fatty acid biosynthetic process (IDA)

negative regulation of lipid catabolic process (IBA,IDA)

negative regulation of lipid metabolic process (IDA)

negative regulation of phosphatidylcholine catabolic process (IDA)

negative regulation of receptor-mediated endocytosis (IDA)

negative regulation of triglyceride catabolic process (IDA)

negative regulation of very-low-density lipoprotein particle clearance (IBA,IDA)

phospholipid efflux (IDA)

plasma lipoprotein particle remodeling (IDA)

regulation of cholesterol transport (IDA)

regulation of lipid transport (ISO)

triglyceride homeostasis (IDA)

triglyceride metabolic process (IBA,IEA)

very-low-density lipoprotein particle assembly (TAS)

very-low-density lipoprotein particle clearance (IBA,IDA)

Cellular Component

chylomicron (TAS)

endoplasmic reticulum (IDA)

extracellular region (IEA,TAS)

high-density lipoprotein particle (IBA,IDA,ISO)

very-low-density lipoprotein particle (IBA,IDA,IEA,ISO)

Molecular Function

fatty acid binding (IBA,IDA)

lipase inhibitor activity (IDA)

phosphatidylcholine binding (TAS)

phosphatidylcholine-sterol O-acyltransferase activator activity (TAS)

phospholipase inhibitor activity (IBA,IDA)

protein binding (IPI)

Molecular Pathway Annotations Click to see Annotation Detail View

altered lipoprotein metabolic pathway (TAS)

lipoprotein metabolic pathway (TAS)

Phenotype Annotations Click to see Annotation Detail View

Human Phenotype

Increased body mass index (IAGP)

References

References - curated

#	Reference Title	Reference Citation
1.	APOE and APOC1 genetic polymorphisms in age-associated memory impairment.	Bartres-Faz D, etal., Neurogenetics. 2001 Oct;3(4):215-9.
2.	Serum apolipoproteins C-I and C-III are reduced in stomach cancer patients: results from MALDI-based peptidome and immuno-based clinical assays.	Cohen M, etal., PLoS One. 2011 Jan 18;6(1):e14540. doi: 10.1371/journal.pone.0014540.
3.	GOAs Human GO annotations	GOA_HUMAN data from the GO Consortium
4.	Very low-density lipoprotein-apoprotein CI is increased in diabetic nephropathy: comparison with apoprotein CIII.	Hirano T, etal., Kidney Int. 2003 Jun;63(6):2171-7.
5.	Role of ApoCs in lipoprotein metabolism: functional differences between ApoC1, ApoC2, and ApoC3.	Jong MC, etal., Arterioscler Thromb Vasc Biol. 1999 Mar;19(3):472-84.
6.	Protection from obesity and insulin resistance in mice overexpressing human apolipoprotein C1.	Jong MC, etal., Diabetes. 2001 Dec;50(12):2779-85.
7.	Correlation of a T45S variant of apolipoprotein C1 with elevated BMI in persons of American Indian and Mexican ancestries.	Kasthuri RS, etal., Int J Obes (Lond). 2007 Aug;31(8):1334-6. Epub 2007 Feb 20.
8.	Genetic association of an apolipoprotein C-I (APOC1) gene polymorphism with late-onset Alzheimer's disease.	Ki CS, etal., Neurosci Lett. 2002 Feb 15;319(2):75-8.
9.	Abnormal composition of apoproteins C-I, C-II, and C-III in plasma and very-low-density lipoproteins of non-insulin-dependent diabetic Chinese.	Pan XR, etal., Clin Chem. 1986 Oct;32(10):1914-20.
10.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
11.	Stromal responses to carcinomas of the pancreas: juxtatumoral gene expression conforms to the infiltrating pattern and not the biologic subtype.	Ricci F, etal., Cancer Biol Ther. 2005 Mar;4(3):302-7. Epub 2005 Mar 23.
12.	Diagnostic and prognostic significance of mRNA expressions of apolipoprotein A and C family genes in hepatitis B virus-related hepatocellular carcinoma.	Wang X, etal., J Cell Biochem. 2019 Oct;120(10):18246-18265. doi: 10.1002/jcb.29131. Epub 2019 Jun 18.

Additional References at PubMed

PMID:166984	PMID:182536	PMID:1917954	PMID:2302419	PMID:2835369	PMID:2897845	PMID:2985493	PMID:3013172	PMID:3017837	PMID:3459164	PMID:4020294	PMID:4369340
PMID:6328444	PMID:6789904	PMID:7471419	PMID:7779782	PMID:8125298	PMID:8432525	PMID:8804993	PMID:9300485	PMID:10391210	PMID:10520737	PMID:10978346	PMID:11054415
PMID:11076863	PMID:11162594	PMID:11256614	PMID:11702052	PMID:11991719	PMID:12032151	PMID:12044170	PMID:12113906	PMID:12220441	PMID:12429068	PMID:12477932	PMID:12678662
PMID:12705839	PMID:12736801	PMID:12805445	PMID:12860251	PMID:12962909	PMID:14523051	PMID:14705977	PMID:14746139	PMID:15077570	PMID:15174051	PMID:15339254	PMID:15364690
PMID:15489334	PMID:15489336	PMID:15576844	PMID:15767578	PMID:15769335	PMID:15777558	PMID:15793777	PMID:15840864	PMID:15900219	PMID:16159884	PMID:16344560	PMID:16381901
PMID:16459141	PMID:16478678	PMID:16544732	PMID:16608402	PMID:16631424	PMID:16763159	PMID:16935938	PMID:16981907	PMID:17053273	PMID:17254710	PMID:17339654	PMID:17341095
PMID:17463246	PMID:17474819	PMID:17667986	PMID:17761674	PMID:17936795	PMID:17975299	PMID:17998437	PMID:18037960	PMID:18049452	PMID:18160739	PMID:18193043	PMID:18193044
PMID:18262040	PMID:18667498	PMID:18802019	PMID:18835943	PMID:18976728	PMID:18984910	PMID:18992221	PMID:19014618	PMID:19060906	PMID:19062221	PMID:19197348	PMID:19252179
PMID:19336475	PMID:19336575	PMID:19368908	PMID:19417222	PMID:19494537	PMID:19567438	PMID:19761869	PMID:19785722	PMID:19808960	PMID:19812053	PMID:19913121	PMID:19936222
PMID:20145290	PMID:20209111	PMID:20308432	PMID:20331378	PMID:20339536	PMID:20430392	PMID:20442857	PMID:20498921	PMID:20571754	PMID:20580041	PMID:20628086	PMID:20686565
PMID:20691829	PMID:20714348	PMID:20838585	PMID:20864672	PMID:20880607	PMID:20972250	PMID:21103663	PMID:21187063	PMID:21196492	PMID:21300955	PMID:21533863	PMID:21740922
PMID:21873635	PMID:21900206	PMID:21909108	PMID:21943158	PMID:22003152	PMID:22005931	PMID:22022282	PMID:22054870	PMID:22264166	PMID:22286219	PMID:22404376	PMID:22474067
PMID:22710912	PMID:22832961	PMID:22916037	PMID:22995522	PMID:23031429	PMID:23118302	PMID:23376485	PMID:23383108	PMID:23419831	PMID:23455636	PMID:23555584	PMID:23620136
PMID:23670531	PMID:23726366	PMID:24023261	PMID:24097068	PMID:24121499	PMID:24498013	PMID:24574346	PMID:24582705	PMID:24688116	PMID:24755620	PMID:24816252	PMID:25350695
PMID:25785516	PMID:26576771	PMID:26639962	PMID:26657933	PMID:27040450	PMID:27052600	PMID:27179730	PMID:27707806	PMID:27805002	PMID:27806189	PMID:27976371	PMID:28065845
PMID:28486432	PMID:29636060	PMID:30130702	PMID:30559175	PMID:30684189	PMID:31006040	PMID:31615875	PMID:31779116	PMID:32296183	PMID:32619263	PMID:32826950	PMID:32961112
PMID:33305507	PMID:33591959	PMID:33935285	PMID:33961781	PMID:34596727	PMID:34625307	PMID:35581292	PMID:35695660	PMID:35914680	PMID:36108528	PMID:36302088	PMID:36399096
PMID:36563923	PMID:36891052	PMID:37328602	PMID:37343697	PMID:37981873	PMID:38515073

Genomics

Comparative Map Data

APOC1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	19	44,914,325 - 44,919,346 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	19	44,914,247 - 44,919,349 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	19	45,417,582 - 45,422,603 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	19	50,109,761 - 50,114,446 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	19	50,109,760 - 50,114,446	NCBI
Celera	19	42,222,238 - 42,226,929 (+)	NCBI		Celera
Cytogenetic Map	19	q13.32	NCBI
HuRef	19	41,848,690 - 41,853,227 (+)	NCBI		HuRef
CHM1_1	19	45,420,643 - 45,425,333 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	19	47,739,017 - 47,744,046 (+)	NCBI		T2T-CHM13v2.0

Apoc1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	7	19,423,405 - 19,426,584 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	7	19,423,406 - 19,426,585 (-)	Ensembl		GRCm39 Ensembl
GRCm38	7	19,689,480 - 19,692,659 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	7	19,689,481 - 19,692,660 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	7	20,274,830 - 20,278,007 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	7	18,848,007 - 18,851,095 (-)	NCBI		MGSCv36	mm8
Celera	7	17,095,563 - 17,098,741 (-)	NCBI		Celera
Cytogenetic Map	7	A3	NCBI
cM Map	7	9.94	NCBI

Apoc1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	88,475,018 - 88,479,052 (-)	NCBI		GRCr8
mRatBN7.2	1	79,347,057 - 79,350,340 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	79,346,136 - 79,350,375 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	84,741,974 - 84,745,241 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	93,293,309 - 93,296,592 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	86,497,080 - 86,500,347 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	80,606,638 - 80,609,921 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	80,606,638 - 80,609,921 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	81,872,116 - 81,875,399 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	78,996,677 - 78,999,960 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	79,074,789 - 79,077,986 (-)	NCBI
Celera	1	73,806,255 - 73,809,538 (-)	NCBI		Celera
Cytogenetic Map	1	q21	NCBI

Apoc1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955555	2,005,962 - 2,007,239 (+)	NCBI	ChiLan1.0	ChiLan1.0

APOC1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	20	51,072,900 - 51,079,010 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	19	52,945,776 - 52,950,785 (+)	NCBI		NHGRI_mPanPan1

APOC1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	1	110,520,177 - 110,522,563 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	1	110,520,198 - 110,631,412 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	1	110,001,120 - 110,003,506 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	1	111,049,949 - 111,052,329 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	1	111,049,970 - 111,194,226 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	1	110,724,595 - 110,726,986 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	1	110,360,068 - 110,362,462 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	1	111,228,866 - 111,231,250 (-)	NCBI		UU_Cfam_GSD_1.0

Apoc1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409349	17,171,122 - 17,173,636 (+)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936706	1,519,248 - 1,520,102 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

Apoc1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624907	1,758,696 - 1,760,611 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624907	1,758,671 - 1,760,611 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in APOC1
17 total Variants

Clinical Variants

Name	Type	Condition(s)	Position(s)	Clinical significance
GRCh37/hg19 19q13.2-13.32(chr19:43013365-47241534)x1	copy number loss	See cases [RCV000240182]	Chr19:43013365..47241534 [GRCh37] Chr19:19q13.2-13.32	pathogenic
GRCh37/hg19 19q13.32(chr19:45284576-45978239)x3	copy number gain	See cases [RCV000239782]	Chr19:45284576..45978239 [GRCh37] Chr19:19q13.32	uncertain significance
GRCh37/hg19 19q13.31-13.32(chr19:44300416-45639540)x1	copy number loss	See cases [RCV000512107]	Chr19:44300416..45639540 [GRCh37] Chr19:19q13.31-13.32	uncertain significance
GRCh37/hg19 19p13.3-q13.43(chr19:260912-58956888)	copy number gain	See cases [RCV000512296]	Chr19:260912..58956888 [GRCh37] Chr19:19p13.3-q13.43	pathogenic
GRCh37/hg19 19p13.3-q13.43(chr19:260912-58956888)x3	copy number gain	See cases [RCV000511289]	Chr19:260912..58956888 [GRCh37] Chr19:19p13.3-q13.43	pathogenic\|uncertain significance
GRCh37/hg19 19q13.32(chr19:45338895-45618902)x3	copy number gain	not provided [RCV000752710]	Chr19:45338895..45618902 [GRCh37] Chr19:19q13.32	benign
GRCh37/hg19 19p13.3-q13.43(chr19:68029-59110290)x3	copy number gain	not provided [RCV000752439]	Chr19:68029..59110290 [GRCh37] Chr19:19p13.3-q13.43	pathogenic
GRCh37/hg19 19p13.3-q13.43(chr19:260912-59097160)x3	copy number gain	not provided [RCV000752444]	Chr19:260912..59097160 [GRCh37] Chr19:19p13.3-q13.43	pathogenic
GRCh37/hg19 19q11-13.33(chr19:28271106-49213832)x3	copy number gain	not provided [RCV000845733]	Chr19:28271106..49213832 [GRCh37] Chr19:19q11-13.33	pathogenic
GRCh37/hg19 19q13.31-13.42(chr19:44738088-53621561)x3	copy number gain	not provided [RCV001007050]	Chr19:44738088..53621561 [GRCh37] Chr19:19q13.31-13.42	pathogenic
GRCh37/hg19 19q13.31-13.32(chr19:45074342-46133841)	copy number gain	not specified [RCV002052686]	Chr19:45074342..46133841 [GRCh37] Chr19:19q13.31-13.32	uncertain significance
NM_001645.5(APOC1):c.7C>T (p.Leu3Phe)	single nucleotide variant	not specified [RCV004200023]	Chr19:44914898 [GRCh38] Chr19:45418155 [GRCh37] Chr19:19q13.32	uncertain significance
NM_001645.5(APOC1):c.88G>A (p.Val30Ile)	single nucleotide variant	not specified [RCV004214599]	Chr19:44916219 [GRCh38] Chr19:45419476 [GRCh37] Chr19:19q13.32	uncertain significance
NM_001645.5(APOC1):c.41T>C (p.Leu14Pro)	single nucleotide variant	not specified [RCV004272515]	Chr19:44914932 [GRCh38] Chr19:45418189 [GRCh37] Chr19:19q13.32	uncertain significance
NM_001645.5(APOC1):c.198G>T (p.Glu66Asp)	single nucleotide variant	not specified [RCV004417825]	Chr19:44919176 [GRCh38] Chr19:45422433 [GRCh37] Chr19:19q13.32	likely benign

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	3192
Count of miRNA genes:	567
Interacting mature miRNAs:	641
Transcripts:	ENST00000252491, ENST00000586638, ENST00000588750, ENST00000588802, ENST00000589078, ENST00000589781, ENST00000590334, ENST00000592176, ENST00000592535, ENST00000592885
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCh38)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
597154707	GWAS1250781_H	total cholesterol measurement, low density lipoprotein cholesterol measurement QTL GWAS1250781 (human)		8e-30	total cholesterol measurement, low density lipoprotein cholesterol measurement	blood low density lipoprotein cholesterol level (CMO:0000053)	19	44915229	44915230	Human
596987795	GWAS1107314_H	memory performance QTL GWAS1107314 (human)		2e-22	memory performance		19	44917947	44917948	Human
597531541	GWAS1627615_H	memory performance QTL GWAS1627615 (human)		3e-13	memory performance		19	44918903	44918904	Human
597101470	GWAS1197544_H	alkaline phosphatase measurement QTL GWAS1197544 (human)		3e-67	alkaline phosphatase measurement	blood alkaline phosphatase activity level (CMO:0000576)	19	44918620	44918621	Human
596981663	GWAS1101182_H	memory performance QTL GWAS1101182 (human)		1e-22	memory performance		19	44918393	44918394	Human
596981662	GWAS1101181_H	memory performance QTL GWAS1101181 (human)		7e-23	memory performance		19	44917947	44917948	Human
596987803	GWAS1107322_H	memory performance QTL GWAS1107322 (human)		2e-20	memory performance		19	44918903	44918904	Human
597169047	GWAS1265121_H	total cholesterol measurement QTL GWAS1265121 (human)		1e-16	total cholesterol measurement	blood total cholesterol level (CMO:0000051)	19	44917961	44917963	Human
596987802	GWAS1107321_H	memory performance QTL GWAS1107321 (human)		7e-21	memory performance		19	44918393	44918394	Human
597155718	GWAS1251792_H	lipid measurement, intermediate density lipoprotein measurement QTL GWAS1251792 (human)		2e-20	lipid measurement, intermediate density lipoprotein measurement	blood intermediate density lipoprotein cholesterol level (CMO:0001562)	19	44915229	44915230	Human
597180298	GWAS1276372_H	protein measurement QTL GWAS1276372 (human)		5e-230	protein measurement		19	44915533	44915534	Human
596983687	GWAS1103206_H	memory performance QTL GWAS1103206 (human)		2e-10	memory performance		19	44915704	44915705	Human
596982657	GWAS1102176_H	memory performance QTL GWAS1102176 (human)		3e-09	memory performance		19	44915533	44915534	Human
596980608	GWAS1100127_H	memory performance QTL GWAS1100127 (human)		3e-12	memory performance		19	44915533	44915534	Human
597296015	GWAS1392089_H	response to COVID-19 vaccine, COVID-19 QTL GWAS1392089 (human)		5e-09	response to COVID-19 vaccine, COVID-19		19	44915533	44915534	Human
597339023	GWAS1435097_H	total cholesterol measurement QTL GWAS1435097 (human)		6e-68	total cholesterol measurement	blood total cholesterol level (CMO:0000051)	19	44919330	44919331	Human
596980611	GWAS1100130_H	memory performance QTL GWAS1100130 (human)		7e-12	memory performance		19	44917947	44917948	Human
597182351	GWAS1278425_H	fatty acid measurement QTL GWAS1278425 (human)		3e-47	fatty acid measurement		19	44918620	44918621	Human
597194624	GWAS1290698_H	memory performance QTL GWAS1290698 (human)		2e-17	memory performance		19	44917997	44917998	Human
596980620	GWAS1100139_H	memory performance QTL GWAS1100139 (human)		1e-10	memory performance		19	44917997	44917998	Human
596980623	GWAS1100142_H	memory performance QTL GWAS1100142 (human)		2e-10	memory performance		19	44916825	44916826	Human
597161868	GWAS1257942_H	low density lipoprotein cholesterol measurement QTL GWAS1257942 (human)		3e-29	low density lipoprotein cholesterol measurement	blood low density lipoprotein cholesterol level (CMO:0000053)	19	44915229	44915230	Human
597194627	GWAS1290701_H	memory performance QTL GWAS1290701 (human)		7e-21	memory performance		19	44915704	44915705	Human
597123978	GWAS1220052_H	blood protein measurement QTL GWAS1220052 (human)		1e-24	blood protein amount (VT:0005416)	blood protein measurement (CMO:0000028)	19	44915533	44915534	Human
597530496	GWAS1626570_H	memory performance QTL GWAS1626570 (human)		1e-18	memory performance		19	44918903	44918904	Human
596982693	GWAS1102212_H	memory performance QTL GWAS1102212 (human)		3e-20	memory performance		19	44918393	44918394	Human
597195689	GWAS1291763_H	memory performance QTL GWAS1291763 (human)		7e-18	memory performance		19	44916825	44916826	Human
597245864	GWAS1341938_H	low density lipoprotein cholesterol measurement QTL GWAS1341938 (human)		1e-11	low density lipoprotein cholesterol measurement	blood low density lipoprotein cholesterol level (CMO:0000053)	19	44917086	44917087	Human
596981668	GWAS1101187_H	memory performance QTL GWAS1101187 (human)		3e-15	memory performance		19	44917843	44917844	Human
596980646	GWAS1100165_H	memory performance QTL GWAS1100165 (human)		0.000003	memory performance		19	44917947	44917948	Human
597304233	GWAS1400307_H	level of speriolin-like protein in blood serum QTL GWAS1400307 (human)		2e-20	level of speriolin-like protein in blood serum		19	44919330	44919331	Human
597150627	GWAS1246701_H	cholesteryl ester measurement, low density lipoprotein cholesterol measurement QTL GWAS1246701 (human)		8e-25	blood lipid amount (VT:0003949)	blood low density lipoprotein cholesterol level (CMO:0000053)	19	44915229	44915230	Human
596982689	GWAS1102208_H	memory performance QTL GWAS1102208 (human)		2e-20	memory performance		19	44917947	44917948	Human
597497769	GWAS1593843_H	memory performance QTL GWAS1593843 (human)		2e-25	memory performance		19	44918903	44918904	Human
597184430	GWAS1280504_H	triglycerides in small VLDL measurement QTL GWAS1280504 (human)		1e-36	triglycerides in small VLDL measurement	blood very low density lipoprotein triglyceride level (CMO:0002688)	19	44915533	44915534	Human
597453738	GWAS1549812_H	phospholipid measurement, high density lipoprotein cholesterol measurement QTL GWAS1549812 (human)		3e-09	phospholipid measurement, high density lipoprotein cholesterol measurement	blood high density lipoprotein cholesterol level (CMO:0000052)	19	44918903	44918904	Human
597168032	GWAS1264106_H	esterified cholesterol measurement QTL GWAS1264106 (human)		5e-14	esterified cholesterol measurement		19	44915229	44915230	Human
597168033	GWAS1264107_H	esterified cholesterol measurement QTL GWAS1264107 (human)		1e-15	esterified cholesterol measurement		19	44917961	44917963	Human
597195683	GWAS1291757_H	memory performance QTL GWAS1291757 (human)		1e-27	memory performance		19	44917843	44917844	Human
597195684	GWAS1291758_H	memory performance QTL GWAS1291758 (human)		4e-27	memory performance		19	44918620	44918621	Human
597178278	GWAS1274352_H	ubiquitin-conjugating enzyme E2 G2 measurement QTL GWAS1274352 (human)		4e-12	ubiquitin-conjugating enzyme E2 G2 measurement		19	44915533	44915534	Human
596982741	GWAS1102260_H	memory performance QTL GWAS1102260 (human)		5e-13	memory performance		19	44917997	44917998	Human
597135318	GWAS1231392_H	memory performance QTL GWAS1231392 (human)		1e-16	memory performance		19	44915704	44915705	Human
597154781	GWAS1250855_H	triglycerides:total lipids ratio, intermediate density lipoprotein measurement QTL GWAS1250855 (human)		5e-19	triglycerides:total lipids ratio, intermediate density lipoprotein measurement	blood intermediate density lipoprotein cholesterol level (CMO:0001562)	19	44915229	44915230	Human
596982746	GWAS1102265_H	memory performance QTL GWAS1102265 (human)		9e-12	memory performance		19	44915704	44915705	Human
597604303	GWAS1661163_H	triglyceride measurement QTL GWAS1661163 (human)		4e-32	triglyceride measurement	blood triglyceride level (CMO:0000118)	19	44915533	44915534	Human
596982733	GWAS1102252_H	memory performance QTL GWAS1102252 (human)		8e-14	memory performance		19	44918620	44918621	Human
597263300	GWAS1359374_H	endothelial monocyte-activating polypeptide 2 measurement QTL GWAS1359374 (human)		5e-39	endothelial monocyte-activating polypeptide 2 measurement		19	44915533	44915534	Human
597166075	GWAS1262149_H	cholesteryl ester measurement, low density lipoprotein cholesterol measurement QTL GWAS1262149 (human)		9e-22	blood lipid amount (VT:0003949)	blood low density lipoprotein cholesterol level (CMO:0000053)	19	44915229	44915230	Human
596980732	GWAS1100251_H	memory performance QTL GWAS1100251 (human)		4e-17	memory performance		19	44918903	44918904	Human
597157881	GWAS1253955_H	low density lipoprotein cholesterol measurement, phospholipid measurement QTL GWAS1253955 (human)		5e-31	low density lipoprotein cholesterol measurement, phospholipid measurement	blood low density lipoprotein cholesterol level (CMO:0000053)	19	44915229	44915230	Human
597191661	GWAS1287735_H	metabolite measurement, diet measurement QTL GWAS1287735 (human)		7e-19	eating behavior trait (VT:0001431)	food intake measurement (CMO:0000772)	19	44918620	44918621	Human
596982754	GWAS1102273_H	memory performance QTL GWAS1102273 (human)		2e-10	memory performance		19	44917843	44917844	Human
597134319	GWAS1230393_H	memory performance QTL GWAS1230393 (human)		2e-15	memory performance		19	44918487	44918488	Human
597185305	GWAS1281379_H	cholesteryl ester measurement QTL GWAS1281379 (human)		5e-10	blood lipid amount (VT:0003949)		19	44917997	44917998	Human
597500699	GWAS1596773_H	memory performance QTL GWAS1596773 (human)		9e-21	memory performance		19	44918903	44918904	Human
597135129	GWAS1231203_H	memory performance QTL GWAS1231203 (human)		4e-13	memory performance		19	44917843	44917844	Human
597198600	GWAS1294674_H	memory performance QTL GWAS1294674 (human)		1e-22	memory performance		19	44915704	44915705	Human
597198602	GWAS1294676_H	memory performance QTL GWAS1294676 (human)		2e-21	memory performance		19	44918487	44918488	Human
597198605	GWAS1294679_H	memory performance QTL GWAS1294679 (human)		1e-22	memory performance		19	44917947	44917948	Human
597135104	GWAS1231178_H	memory performance QTL GWAS1231178 (human)		2e-10	memory performance		19	44915704	44915705	Human
597495562	GWAS1591636_H	memory performance QTL GWAS1591636 (human)		4e-15	memory performance		19	44918903	44918904	Human
597156616	GWAS1252690_H	low density lipoprotein cholesterol measurement, lipid measurement QTL GWAS1252690 (human)		1e-23	high density lipoprotein cholesterol measurement	blood high density lipoprotein cholesterol level (CMO:0000052)	19	44915229	44915230	Human
597158711	GWAS1254785_H	fatty acid measurement QTL GWAS1254785 (human)		3e-11	fatty acid measurement		19	44918620	44918621	Human
597152564	GWAS1248638_H	low density lipoprotein cholesterol measurement, phospholipid measurement QTL GWAS1248638 (human)		3e-31	low density lipoprotein cholesterol measurement, phospholipid measurement	blood low density lipoprotein cholesterol level (CMO:0000053)	19	44915229	44915230	Human
597248826	GWAS1344900_H	low density lipoprotein cholesterol measurement QTL GWAS1344900 (human)		1e-300	low density lipoprotein cholesterol measurement	blood low density lipoprotein cholesterol level (CMO:0000053)	19	44915533	44915534	Human
597198652	GWAS1294726_H	memory performance QTL GWAS1294726 (human)		6e-09	memory performance		19	44917997	44917998	Human
597123888	GWAS1219962_H	triglyceride measurement QTL GWAS1219962 (human)		4e-24	triglyceride measurement	blood triglyceride level (CMO:0000118)	19	44919330	44919331	Human
597198642	GWAS1294716_H	memory performance QTL GWAS1294716 (human)		2e-12	memory performance		19	44918487	44918488	Human
597132091	GWAS1228165_H	memory performance QTL GWAS1228165 (human)		7e-11	memory performance		19	44918487	44918488	Human
597198646	GWAS1294720_H	memory performance QTL GWAS1294720 (human)		6e-11	memory performance		19	44915533	44915534	Human
597132089	GWAS1228163_H	memory performance QTL GWAS1228163 (human)		2e-11	memory performance		19	44918620	44918621	Human
597111591	GWAS1207665_H	total cholesterol measurement QTL GWAS1207665 (human)		5e-23	total cholesterol measurement	blood total cholesterol level (CMO:0000051)	19	44919330	44919331	Human
597201710	GWAS1297784_H	memory performance QTL GWAS1297784 (human)		3e-10	memory performance		19	44915533	44915534	Human
597135150	GWAS1231224_H	memory performance QTL GWAS1231224 (human)		8e-08	memory performance		19	44915704	44915705	Human
597134166	GWAS1230240_H	memory performance QTL GWAS1230240 (human)		2e-12	protein measurement		19	44915533	44915534	Human
597187419	GWAS1283493_H	1-stearoyl-2-arachidonoyl-GPE (18:0/20:4) measurement QTL GWAS1283493 (human)		3e-11	metabolic syndrome		19	44915533	44915534	Human
597134164	GWAS1230238_H	memory performance QTL GWAS1230238 (human)		6e-15	memory performance		19	44917843	44917844	Human
596970326	GWAS1089845_H	free cholesterol measurement, high density lipoprotein cholesterol measurement QTL GWAS1089845 (human)		7e-14	free cholesterol measurement, high density lipoprotein cholesterol measurement		19	44918903	44918904	Human
597194590	GWAS1290664_H	memory performance QTL GWAS1290664 (human)		0.000003	memory performance		19	44917947	44917948	Human
597256031	GWAS1352105_H	triglyceride measurement QTL GWAS1352105 (human)		3e-22	triglyceride measurement	blood triglyceride level (CMO:0000118)	19	44919304	44919305	Human
597314397	GWAS1410471_H	triglyceride measurement QTL GWAS1410471 (human)		7e-275	triglyceride measurement	blood triglyceride level (CMO:0000118)	19	44915533	44915534	Human
596970329	GWAS1089848_H	high density lipoprotein cholesterol measurement QTL GWAS1089848 (human)		2e-08	high density lipoprotein cholesterol measurement		19	44918903	44918904	Human
597134168	GWAS1230242_H	memory performance QTL GWAS1230242 (human)		5e-12	memory performance		19	44918620	44918621	Human
597132100	GWAS1228174_H	memory performance QTL GWAS1228174 (human)		3e-09	memory performance		19	44915229	44915230	Human
597132098	GWAS1228172_H	memory performance QTL GWAS1228172 (human)		1e-09	memory performance		19	44915704	44915705	Human
597156687	GWAS1252761_H	sex hormone-binding globulin measurement QTL GWAS1252761 (human)		2e-08	BMI-adjusted hip circumference	hip circumference (CMO:0000014)	19	44915533	44915534	Human
597151565	GWAS1247639_H	cholesteryl ester measurement, intermediate density lipoprotein measurement QTL GWAS1247639 (human)		8e-23	blood lipid amount (VT:0003949)	blood total cholesterol level (CMO:0000051)	19	44915229	44915230	Human
596981582	GWAS1101101_H	memory performance QTL GWAS1101101 (human)		3e-08	memory performance		19	44918487	44918488	Human
596981577	GWAS1101096_H	memory performance QTL GWAS1101096 (human)		5e-09	memory performance		19	44917947	44917948	Human
597172038	GWAS1268112_H	intelligence QTL GWAS1268112 (human)		4e-08	intelligence		19	44918393	44918394	Human
597156681	GWAS1252755_H	triglyceride:HDL cholesterol ratio QTL GWAS1252755 (human)		3e-17	blood triglyceride amount (VT:0002644)		19	44919304	44919305	Human
597194616	GWAS1290690_H	memory performance QTL GWAS1290690 (human)		2e-14	memory performance		19	44916825	44916826	Human
596982645	GWAS1102164_H	memory performance QTL GWAS1102164 (human)		6e-09	memory performance		19	44917997	44917998	Human
597194617	GWAS1290691_H	memory performance QTL GWAS1290691 (human)		3e-19	memory performance		19	44917843	44917844	Human
596983671	GWAS1103190_H	memory performance QTL GWAS1103190 (human)		0.000004	memory performance		19	44915533	44915534	Human
597194620	GWAS1290694_H	memory performance QTL GWAS1290694 (human)		9e-19	memory performance		19	44916825	44916826	Human
597067632	GWAS1163706_H	Alzheimer disease, family history of Alzheimer’s disease QTL GWAS1163706 (human)		7e-162	Alzheimer disease, family history of Alzheimer’s disease		19	44917843	44917844	Human
597156733	GWAS1252807_H	phospholipids:total lipids ratio, high density lipoprotein cholesterol measurement QTL GWAS1252807 (human)		5e-62	phospholipids:total lipids ratio, high density lipoprotein cholesterol measurement	blood high density lipoprotein cholesterol level (CMO:0000052)	19	44915229	44915230	Human
597300080	GWAS1396154_H	serum alanine aminotransferase measurement QTL GWAS1396154 (human)		2e-20	serum alanine aminotransferase measurement	serum alanine aminotransferase activity level (CMO:0000575)	19	44915533	44915534	Human
596980607	GWAS1100126_H	memory performance QTL GWAS1100126 (human)		9e-21	memory performance		19	44918903	44918904	Human
596985723	GWAS1105242_H	memory performance QTL GWAS1105242 (human)		8e-08	memory performance		19	44915704	44915705	Human
597165942	GWAS1262016_H	low density lipoprotein cholesterol measurement, cholesteryl esters:total lipids ratio QTL GWAS1262016 (human)		1e-14	low density lipoprotein cholesterol measurement, cholesteryl esters:total lipids ratio	blood low density lipoprotein cholesterol level (CMO:0000053)	19	44918620	44918621	Human
596987770	GWAS1107289_H	memory performance QTL GWAS1107289 (human)		1e-15	memory performance		19	44915704	44915705	Human
597599082	GWAS1655942_H	serum alanine aminotransferase measurement QTL GWAS1655942 (human)		7e-37	serum alanine aminotransferase measurement	serum alanine aminotransferase activity level (CMO:0000575)	19	44915533	44915534	Human
597616482	GWAS1673342_H	cirrhosis of liver QTL GWAS1673342 (human)		6e-14	cirrhosis of liver		19	44915533	44915534	Human
596980584	GWAS1100103_H	memory performance QTL GWAS1100103 (human)		9e-13	memory performance		19	44917997	44917998	Human
596969320	GWAS1088839_H	phospholipid measurement, high density lipoprotein cholesterol measurement QTL GWAS1088839 (human)		3e-09	phospholipid measurement, high density lipoprotein cholesterol measurement		19	44918903	44918904	Human
597175142	GWAS1271216_H	triglycerides in VLDL measurement QTL GWAS1271216 (human)		8e-26	blood VLDL triglyceride amount (VT:0010700)		19	44915533	44915534	Human
597131924	GWAS1227998_H	memory performance QTL GWAS1227998 (human)		1e-08	memory performance		19	44917997	44917998	Human
597136019	GWAS1232093_H	lipid measurement QTL GWAS1232093 (human)		3e-12	lipid measurement	blood lipid measurement (CMO:0000050)	19	44915704	44915705	Human
596980382	GWAS1099901_H	memory performance QTL GWAS1099901 (human)		1e-11	memory performance		19	44915704	44915705	Human
597183126	GWAS1279200_H	protein measurement QTL GWAS1279200 (human)		6e-103	protein measurement		19	44915533	44915534	Human
596980379	GWAS1099898_H	memory performance QTL GWAS1099898 (human)		2e-12	memory performance		19	44918487	44918488	Human
597452428	GWAS1548502_H	high density lipoprotein cholesterol measurement QTL GWAS1548502 (human)		2e-08	high density lipoprotein cholesterol measurement	blood high density lipoprotein cholesterol level (CMO:0000052)	19	44918903	44918904	Human
596982404	GWAS1101923_H	memory performance QTL GWAS1101923 (human)		7e-09	memory performance		19	44917997	44917998	Human
596988551	GWAS1108070_H	memory performance QTL GWAS1108070 (human)		7e-20	memory performance		19	44918393	44918394	Human
596980358	GWAS1099877_H	memory performance QTL GWAS1099877 (human)		0.000004	memory performance		19	44918393	44918394	Human
596982401	GWAS1101920_H	memory performance QTL GWAS1101920 (human)		4e-09	memory performance		19	44915229	44915230	Human
597199502	GWAS1295576_H	memory performance QTL GWAS1295576 (human)		1e-15	memory performance		19	44915704	44915705	Human
597452426	GWAS1548500_H	free cholesterol measurement, high density lipoprotein cholesterol measurement QTL GWAS1548500 (human)		7e-14	free cholesterol measurement, high density lipoprotein cholesterol measurement	blood high density lipoprotein cholesterol level (CMO:0000052)	19	44918903	44918904	Human
597425804	GWAS1521878_H	cortical thickness QTL GWAS1521878 (human)		5e-08	ceramide measurement		19	44918903	44918904	Human
597183106	GWAS1279180_H	selenoprotein S measurement QTL GWAS1279180 (human)		6e-47	selenoprotein S measurement		19	44915533	44915534	Human
597143180	GWAS1239254_H	C-reactive protein measurement QTL GWAS1239254 (human)		2e-17	C-reactive protein measurement	blood C-reactive protein level (CMO:0003160)	19	44919304	44919305	Human
597173892	GWAS1269966_H	intelligence QTL GWAS1269966 (human)		5e-12	intelligence		19	44917997	44917998	Human
596988553	GWAS1108072_H	memory performance QTL GWAS1108072 (human)		5e-19	memory performance		19	44918620	44918621	Human
596982408	GWAS1101927_H	memory performance QTL GWAS1101927 (human)		1e-08	memory performance		19	44916825	44916826	Human
596988552	GWAS1108071_H	memory performance QTL GWAS1108071 (human)		9e-20	memory performance		19	44917947	44917948	Human
597154486	GWAS1250560_H	triglyceride:HDL cholesterol ratio QTL GWAS1250560 (human)		6e-23	blood triglyceride amount (VT:0002644)		19	44919304	44919305	Human
597269178	GWAS1365252_H	metabolite measurement QTL GWAS1365252 (human)		5e-12	metabolite measurement		19	44919330	44919331	Human
597495481	GWAS1591555_H	memory performance QTL GWAS1591555 (human)		9e-25	memory performance		19	44918903	44918904	Human
596962995	GWAS1082514_H	response to COVID-19 vaccine, COVID-19 QTL GWAS1082514 (human)		5e-09	response to COVID-19 vaccine, COVID-19		19	44915533	44915534	Human
596980413	GWAS1099932_H	memory performance QTL GWAS1099932 (human)		2e-10	memory performance		19	44915533	44915534	Human
597194417	GWAS1290491_H	memory performance QTL GWAS1290491 (human)		2e-10	memory performance		19	44917843	44917844	Human
597131963	GWAS1228037_H	memory performance QTL GWAS1228037 (human)		1e-15	memory performance		19	44916825	44916826	Human
597194420	GWAS1290494_H	memory performance QTL GWAS1290494 (human)		6e-09	memory performance		19	44918487	44918488	Human
597194421	GWAS1290495_H	memory performance QTL GWAS1290495 (human)		7e-09	memory performance		19	44915533	44915534	Human
596980388	GWAS1099907_H	memory performance QTL GWAS1099907 (human)		6e-11	memory performance		19	44915533	44915534	Human
597263021	GWAS1359095_H	triglyceride measurement, high density lipoprotein cholesterol measurement QTL GWAS1359095 (human)		1e-51	triglyceride measurement, high density lipoprotein cholesterol measurement	blood high density lipoprotein cholesterol level (CMO:0000052)	19	44915533	44915534	Human
597157538	GWAS1253612_H	total cholesterol measurement QTL GWAS1253612 (human)		1e-20	triglycerides:total lipids ratio, low density lipoprotein cholesterol measurement	blood low density lipoprotein cholesterol level (CMO:0000053)	19	44915229	44915230	Human
597194413	GWAS1290487_H	memory performance QTL GWAS1290487 (human)		9e-12	memory performance		19	44915704	44915705	Human
597131937	GWAS1228011_H	memory performance QTL GWAS1228011 (human)		1e-08	memory performance		19	44916825	44916826	Human
597485216	GWAS1581290_H	cholesteryl ester 24:1 measurement QTL GWAS1581290 (human)		0.000004	cholesteryl ester 24:1 measurement		19	44918903	44918904	Human
597617374	GWAS1674234_H	liver disease QTL GWAS1674234 (human)		2e-26	liver disease		19	44915533	44915534	Human
597152470	GWAS1248544_H	low density lipoprotein cholesterol measurement QTL GWAS1248544 (human)		1e-26	very low density lipoprotein cholesterol measurement, cholesterol:total lipids ratio	blood low density lipoprotein cholesterol level (CMO:0000053)	19	44915229	44915230	Human
407082241	GWAS731217_H	lobar intracerebral hemorrhage QTL GWAS731217 (human)		6e-10	lobar intracerebral hemorrhage		19	44915533	44915534	Human
597135059	GWAS1231133_H	memory performance QTL GWAS1231133 (human)		4e-20	memory performance		19	44917997	44917998	Human
597135057	GWAS1231131_H	memory performance QTL GWAS1231131 (human)		2e-20	memory performance		19	44918620	44918621	Human
597292766	GWAS1388840_H	alkaline phosphatase measurement QTL GWAS1388840 (human)		2e-14	alkaline phosphatase measurement	blood alkaline phosphatase activity level (CMO:0000576)	19	44915704	44915705	Human
597158608	GWAS1254682_H	free cholesterol:total lipids ratio, high density lipoprotein cholesterol measurement QTL GWAS1254682 (human)		3e-16	free cholesterol:total lipids ratio, high density lipoprotein cholesterol measurement	blood high density lipoprotein cholesterol level (CMO:0000052)	19	44917961	44917963	Human
597135070	GWAS1231144_H	memory performance QTL GWAS1231144 (human)		4e-19	memory performance		19	44917843	44917844	Human
596980446	GWAS1099965_H	memory performance QTL GWAS1099965 (human)		4e-10	memory performance		19	44918393	44918394	Human
597205717	GWAS1301791_H	metabolic syndrome QTL GWAS1301791 (human)		1e-13	metabolic syndrome		19	44916825	44916826	Human
597107417	GWAS1203491_H	triglyceride measurement QTL GWAS1203491 (human)		6e-39	triglyceride measurement	blood triglyceride level (CMO:0000118)	19	44919330	44919331	Human
596982468	GWAS1101987_H	memory performance QTL GWAS1101987 (human)		2e-14	memory performance		19	44916825	44916826	Human
597105346	GWAS1201420_H	sex hormone-binding globulin measurement QTL GWAS1201420 (human)		3e-15	memory performance		19	44915533	44915534	Human
597529291	GWAS1625365_H	memory performance QTL GWAS1625365 (human)		2e-20	memory performance		19	44918903	44918904	Human
597158607	GWAS1254681_H	free cholesterol:total lipids ratio, high density lipoprotein cholesterol measurement QTL GWAS1254681 (human)		6e-34	free cholesterol:total lipids ratio, high density lipoprotein cholesterol measurement	blood high density lipoprotein cholesterol level (CMO:0000052)	19	44915229	44915230	Human
597299904	GWAS1395978_H	hemoglobin subunit theta-1 measurement QTL GWAS1395978 (human)		7e-36	hemoglobin subunit theta-1 measurement		19	44918715	44918716	Human
597182151	GWAS1278225_H	total lipids in very large VLDL measurement QTL GWAS1278225 (human)		1e-22	blood lipid amount (VT:0003949)		19	44915533	44915534	Human
597338874	GWAS1434948_H	body mass index QTL GWAS1434948 (human)		5e-11	body mass index	body mass index (BMI) (CMO:0000105)	19	44917947	44917948	Human
596982512	GWAS1102031_H	memory performance QTL GWAS1102031 (human)		9e-13	memory performance		19	44915533	44915534	Human
597150457	GWAS1246531_H	triglycerides:total lipids ratio, low density lipoprotein cholesterol measurement QTL GWAS1246531 (human)		5e-18	triglycerides:total lipids ratio, low density lipoprotein cholesterol measurement	blood low density lipoprotein cholesterol level (CMO:0000053)	19	44915229	44915230	Human
597152504	GWAS1248578_H	triglyceride measurement, high density lipoprotein cholesterol measurement QTL GWAS1248578 (human)		7e-12	triglyceride measurement, high density lipoprotein cholesterol measurement	blood high density lipoprotein cholesterol level (CMO:0000052)	19	44918620	44918621	Human
597135079	GWAS1231153_H	memory performance QTL GWAS1231153 (human)		1e-22	memory performance		19	44918393	44918394	Human
596983523	GWAS1103042_H	memory performance QTL GWAS1103042 (human)		2e-21	memory performance		19	44918487	44918488	Human
597156591	GWAS1252665_H	fatty acid measurement QTL GWAS1252665 (human)		6e-15	fatty acid measurement		19	44918620	44918621	Human
597502691	GWAS1598765_H	total cholesterol measurement QTL GWAS1598765 (human)		2e-77	total cholesterol measurement	blood total cholesterol level (CMO:0000051)	19	44918903	44918904	Human
596981269	GWAS1100788_H	memory performance QTL GWAS1100788 (human)		8e-08	memory performance		19	44915533	44915534	Human
597528093	GWAS1624167_H	memory performance QTL GWAS1624167 (human)		6e-18	memory performance		19	44918903	44918904	Human
596981267	GWAS1100786_H	memory performance QTL GWAS1100786 (human)		7e-09	memory performance		19	44918903	44918904	Human
596981266	GWAS1100785_H	memory performance QTL GWAS1100785 (human)		5e-09	memory performance		19	44917843	44917844	Human
597121567	GWAS1217641_H	triglyceride measurement QTL GWAS1217641 (human)		7e-47	triglyceride measurement	blood triglyceride level (CMO:0000118)	19	44919330	44919331	Human
597155358	GWAS1251432_H	free cholesterol measurement, intermediate density lipoprotein measurement QTL GWAS1251432 (human)		6e-22	free cholesterol measurement, intermediate density lipoprotein measurement	blood intermediate density lipoprotein cholesterol level (CMO:0001562)	19	44915229	44915230	Human
597130781	GWAS1226855_H	memory performance QTL GWAS1226855 (human)		0.000004	memory performance		19	44915533	44915534	Human
597198358	GWAS1294432_H	memory performance QTL GWAS1294432 (human)		6e-25	memory performance		19	44918393	44918394	Human
597301771	GWAS1397845_H	apolipoprotein A 1 measurement, apolipoprotein B measurement QTL GWAS1397845 (human)		5e-30	apolipoprotein A 1 measurement, apolipoprotein B measurement	blood apoliprotein B level (CMO:0000522)	19	44915229	44915230	Human
597132806	GWAS1228880_H	memory performance QTL GWAS1228880 (human)		0.0000004	memory performance		19	44917843	44917844	Human
407048658	GWAS697634_H	triglyceride measurement QTL GWAS697634 (human)		3e-19	triglyceride measurement	blood triglyceride level (CMO:0000118)	19	44919330	44919331	Human
597140997	GWAS1237071_H	apolipoprotein C measurement QTL GWAS1237071 (human)		2e-09	apolipoprotein C measurement		19	44915704	44915705	Human
597247503	GWAS1343577_H	low density lipoprotein cholesterol measurement QTL GWAS1343577 (human)		3e-137	low density lipoprotein cholesterol measurement	blood low density lipoprotein cholesterol level (CMO:0000053)	19	44915229	44915230	Human
597132801	GWAS1228875_H	memory performance QTL GWAS1228875 (human)		1e-09	memory performance		19	44917947	44917948	Human
597153295	GWAS1249369_H	low density lipoprotein cholesterol measurement QTL GWAS1249369 (human)		5e-23	low density lipoprotein cholesterol measurement	blood low density lipoprotein cholesterol level (CMO:0000053)	19	44915229	44915230	Human
597134859	GWAS1230933_H	memory performance QTL GWAS1230933 (human)		3e-13	memory performance		19	44917947	44917948	Human
597134857	GWAS1230931_H	memory performance QTL GWAS1230931 (human)		3e-13	memory performance		19	44918393	44918394	Human
597132855	GWAS1228929_H	memory performance QTL GWAS1228929 (human)		3e-18	memory performance		19	44918393	44918394	Human
597132853	GWAS1228927_H	memory performance QTL GWAS1228927 (human)		2e-19	memory performance		19	44917947	44917948	Human
596982326	GWAS1101845_H	memory performance QTL GWAS1101845 (human)		0.0000004	memory performance		19	44917843	44917844	Human
597195324	GWAS1291398_H	memory performance QTL GWAS1291398 (human)		4e-09	memory performance		19	44915229	44915230	Human
597141042	GWAS1237116_H	linoleoyl-arachidonoyl-glycerol (18:2/20:4) [2] measurement QTL GWAS1237116 (human)		1e-19	linoleoyl-arachidonoyl-glycerol (18:2/20:4) [2] measurement		19	44915533	44915534	Human
597195326	GWAS1291400_H	memory performance QTL GWAS1291400 (human)		7e-09	memory performance		19	44917997	44917998	Human
597197375	GWAS1293449_H	memory performance QTL GWAS1293449 (human)		6e-12	memory performance		19	44918487	44918488	Human
597148223	GWAS1244297_H	low density lipoprotein cholesterol measurement QTL GWAS1244297 (human)		4e-17	cholesterol:total lipids ratio, intermediate density lipoprotein measurement	blood intermediate density lipoprotein cholesterol level (CMO:0001562)	19	44915229	44915230	Human
597150268	GWAS1246342_H	free cholesterol measurement, low density lipoprotein cholesterol measurement QTL GWAS1246342 (human)		8e-34	free cholesterol measurement, low density lipoprotein cholesterol measurement	blood low density lipoprotein cholesterol level (CMO:0000053)	19	44915229	44915230	Human
597132860	GWAS1228934_H	memory performance QTL GWAS1228934 (human)		1e-16	memory performance		19	44917997	44917998	Human
597132859	GWAS1228933_H	memory performance QTL GWAS1228933 (human)		9e-17	memory performance		19	44916825	44916826	Human
597165623	GWAS1261697_H	sex hormone-binding globulin measurement QTL GWAS1261697 (human)		6e-08	sex hormone-binding globulin measurement		19	44915533	44915534	Human
597201448	GWAS1297522_H	memory performance QTL GWAS1297522 (human)		2e-13	memory performance		19	44917997	44917998	Human
596982305	GWAS1101824_H	memory performance QTL GWAS1101824 (human)		2e-08	memory performance		19	44915229	44915230	Human
597106209	GWAS1202283_H	sex hormone-binding globulin measurement QTL GWAS1202283 (human)		1e-14	body size trait (VT:0100005)		19	44915533	44915534	Human
597201441	GWAS1297515_H	memory performance QTL GWAS1297515 (human)		2e-16	memory performance		19	44916825	44916826	Human
597131819	GWAS1227893_H	memory performance QTL GWAS1227893 (human)		4e-14	memory performance		19	44917843	44917844	Human
406928778	GWAS577754_H	apolipoprotein B measurement QTL GWAS577754 (human)		2e-224	apolipoprotein B measurement	blood apoliprotein B level (CMO:0000522)	19	44915229	44915230	Human
597133915	GWAS1229989_H	memory performance QTL GWAS1229989 (human)		7e-21	memory performance		19	44918393	44918394	Human
597165640	GWAS1261714_H	low density lipoprotein cholesterol measurement QTL GWAS1261714 (human)		4e-20	low density lipoprotein cholesterol measurement	blood low density lipoprotein cholesterol level (CMO:0000053)	19	44915229	44915230	Human
597153347	GWAS1249421_H	intermediate density lipoprotein measurement QTL GWAS1249421 (human)		1e-21	intermediate density lipoprotein measurement	blood intermediate density lipoprotein cholesterol level (CMO:0001562)	19	44915229	44915230	Human
597532233	GWAS1628307_H	memory performance QTL GWAS1628307 (human)		7e-09	memory performance		19	44918903	44918904	Human
597155406	GWAS1251480_H	cholesterol:total lipids ratio, low density lipoprotein cholesterol measurement QTL GWAS1251480 (human)		3e-24	cholesterol:total lipids ratio, low density lipoprotein cholesterol measurement	blood low density lipoprotein cholesterol level (CMO:0000053)	19	44915229	44915230	Human
597197377	GWAS1293451_H	memory performance QTL GWAS1293451 (human)		1e-11	memory performance		19	44915704	44915705	Human
597198402	GWAS1294476_H	memory performance QTL GWAS1294476 (human)		5e-13	memory performance		19	44918620	44918621	Human
597168707	GWAS1264781_H	BMI-adjusted waist-hip ratio QTL GWAS1264781 (human)		4e-14	body size trait (VT:0100005)		19	44915533	44915534	Human
1331657	COPD9_H	Chronic obstructive pulmonary disease QTL 9 (human)	1.94		Chronic airflow obstruction	post-bronchodilator FEV1	19	31021760	57021760	Human
596980340	GWAS1099859_H	memory performance QTL GWAS1099859 (human)		4e-13	memory performance		19	44917843	44917844	Human
596982391	GWAS1101910_H	memory performance QTL GWAS1101910 (human)		2e-12	memory performance		19	44918903	44918904	Human
597149300	GWAS1245374_H	free cholesterol measurement, low density lipoprotein cholesterol measurement QTL GWAS1245374 (human)		2e-37	free cholesterol measurement, low density lipoprotein cholesterol measurement	blood low density lipoprotein cholesterol level (CMO:0000053)	19	44915229	44915230	Human
596988540	GWAS1108059_H	memory performance QTL GWAS1108059 (human)		1e-21	memory performance		19	44917997	44917998	Human
596983420	GWAS1102939_H	memory performance QTL GWAS1102939 (human)		5e-12	memory performance		19	44918620	44918621	Human
597507700	GWAS1603774_H	COVID-19, mortality QTL GWAS1603774 (human)		8e-08	COVID-19	ratio of deaths to total study population during a period of time (CMO:0001023)	19	44918903	44918904	Human
597175922	GWAS1271996_H	total lipids in HDL measurement QTL GWAS1271996 (human)		2e-16	blood lipid amount (VT:0003949)		19	44917997	44917998	Human
596980351	GWAS1099870_H	memory performance QTL GWAS1099870 (human)		2e-12	memory performance		19	44918393	44918394	Human
596983423	GWAS1102942_H	memory performance QTL GWAS1102942 (human)		1e-11	memory performance		19	44918487	44918488	Human
596983416	GWAS1102935_H	memory performance QTL GWAS1102935 (human)		6e-15	memory performance		19	44917843	44917844	Human
596983418	GWAS1102937_H	memory performance QTL GWAS1102937 (human)		2e-12	memory performance		19	44915533	44915534	Human
596982394	GWAS1101913_H	memory performance QTL GWAS1101913 (human)		6e-12	memory performance		19	44918487	44918488	Human
596982373	GWAS1101892_H	memory performance QTL GWAS1101892 (human)		7e-18	memory performance		19	44916825	44916826	Human
597133927	GWAS1230001_H	memory performance QTL GWAS1230001 (human)		5e-09	memory performance		19	44917947	44917948	Human
597155427	GWAS1251501_H	triglycerides:total lipids ratio, low density lipoprotein cholesterol measurement QTL GWAS1251501 (human)		5e-16	triglycerides:total lipids ratio, low density lipoprotein cholesterol measurement	blood low density lipoprotein cholesterol level (CMO:0000053)	19	44915229	44915230	Human
597265004	GWAS1361078_H	protein S100-A4 measurement QTL GWAS1361078 (human)		7e-24	protein S100-A4 measurement		19	44919330	44919331	Human
596982371	GWAS1101890_H	memory performance QTL GWAS1101890 (human)		1e-18	memory performance		19	44918903	44918904	Human
596980335	GWAS1099854_H	memory performance QTL GWAS1099854 (human)		4e-15	memory performance		19	44918903	44918904	Human
597133931	GWAS1230005_H	memory performance QTL GWAS1230005 (human)		3e-08	memory performance		19	44918487	44918488	Human
596984212	GWAS1103731_H	memory performance QTL GWAS1103731 (human)		8e-16	memory performance		19	44918487	44918488	Human
596984209	GWAS1103728_H	memory performance QTL GWAS1103728 (human)		2e-16	memory performance		19	44918393	44918394	Human
596988304	GWAS1107823_H	memory performance QTL GWAS1107823 (human)		9e-25	memory performance		19	44918903	44918904	Human
597153168	GWAS1249242_H	cholesteryl ester measurement, low density lipoprotein cholesterol measurement QTL GWAS1249242 (human)		6e-28	blood lipid amount (VT:0003949)	blood low density lipoprotein cholesterol level (CMO:0000053)	19	44915229	44915230	Human
597131664	GWAS1227738_H	memory performance QTL GWAS1227738 (human)		1e-09	memory performance		19	44918620	44918621	Human
596980124	GWAS1099643_H	memory performance QTL GWAS1099643 (human)		3e-13	memory performance		19	44918903	44918904	Human
596980126	GWAS1099645_H	memory performance QTL GWAS1099645 (human)		5e-13	memory performance		19	44918620	44918621	Human
596984216	GWAS1103735_H	memory performance QTL GWAS1103735 (human)		3e-15	memory performance		19	44917947	44917948	Human
596984197	GWAS1103716_H	memory performance QTL GWAS1103716 (human)		6e-18	memory performance		19	44918903	44918904	Human
596984193	GWAS1103712_H	memory performance QTL GWAS1103712 (human)		9e-19	memory performance		19	44916825	44916826	Human
597157262	GWAS1253336_H	triglyceride:HDL cholesterol ratio QTL GWAS1253336 (human)		4e-09	blood triglyceride amount (VT:0002644)		19	44919304	44919305	Human
596988303	GWAS1107822_H	memory performance QTL GWAS1107822 (human)		7e-25	memory performance		19	44915229	44915230	Human
597116300	GWAS1212374_H	cerebral amyloid deposition measurement QTL GWAS1212374 (human)		3e-13	blood protein amount (VT:0005416)	blood protein measurement (CMO:0000028)	19	44915533	44915534	Human
597133708	GWAS1229782_H	memory performance QTL GWAS1229782 (human)		4e-10	memory performance		19	44918393	44918394	Human
597116299	GWAS1212373_H	cerebral amyloid deposition measurement QTL GWAS1212373 (human)		1e-14	cerebral cortex integrity trait (VT:0010923)		19	44917997	44917998	Human
597133706	GWAS1229780_H	memory performance QTL GWAS1229780 (human)		3e-13	memory performance		19	44917843	44917844	Human
596984200	GWAS1103719_H	memory performance QTL GWAS1103719 (human)		2e-17	memory performance		19	44917997	44917998	Human
597131658	GWAS1227732_H	memory performance QTL GWAS1227732 (human)		7e-10	memory performance		19	44918487	44918488	Human
596988299	GWAS1107818_H	memory performance QTL GWAS1107818 (human)		2e-26	memory performance		19	44916825	44916826	Human
597165447	GWAS1261521_H	low density lipoprotein cholesterol measurement, lipid measurement QTL GWAS1261521 (human)		1e-31	low density lipoprotein cholesterol measurement, lipid measurement	blood lipid measurement (CMO:0000050)	19	44915229	44915230	Human
597112242	GWAS1208316_H	low density lipoprotein cholesterol measurement QTL GWAS1208316 (human)		3e-17	low density lipoprotein cholesterol measurement	blood low density lipoprotein cholesterol level (CMO:0000053)	19	44919330	44919331	Human
597162416	GWAS1258490_H	apolipoprotein B measurement QTL GWAS1258490 (human)		6e-21	apolipoprotein B measurement	blood apoliprotein B level (CMO:0000522)	19	44915229	44915230	Human
597153215	GWAS1249289_H	phospholipid measurement, intermediate density lipoprotein measurement QTL GWAS1249289 (human)		4e-18	phospholipid measurement, intermediate density lipoprotein measurement	blood intermediate density lipoprotein cholesterol level (CMO:0001562)	19	44915229	44915230	Human
596989349	GWAS1108868_H	memory performance QTL GWAS1108868 (human)		3e-13	memory performance		19	44917947	44917948	Human
596989348	GWAS1108867_H	memory performance QTL GWAS1108867 (human)		3e-13	memory performance		19	44918393	44918394	Human
597151141	GWAS1247215_H	free cholesterol measurement, low density lipoprotein cholesterol measurement QTL GWAS1247215 (human)		1e-36	free cholesterol measurement, low density lipoprotein cholesterol measurement	blood low density lipoprotein cholesterol level (CMO:0000053)	19	44915229	44915230	Human
597181868	GWAS1277942_H	ras-related protein Rab-14 measurement QTL GWAS1277942 (human)		9e-16	ras-related protein Rab-14 measurement		19	44915533	44915534	Human
597302694	GWAS1398768_H	white matter integrity, age at assessment QTL GWAS1398768 (human)		2e-08	white matter integrity, age at assessment		19	44917997	44917998	Human
597299621	GWAS1395695_H	quinone oxidoreductase-like protein 1 measurement QTL GWAS1395695 (human)		5e-28	quinone oxidoreductase-like protein 1 measurement		19	44918715	44918716	Human
596986326	GWAS1105845_H	memory performance QTL GWAS1105845 (human)		1e-08	memory performance		19	44917997	44917998	Human
597181918	GWAS1277992_H	phospholipids in very large VLDL measurement QTL GWAS1277992 (human)		9e-25	blood VLDL phospholipid amount (VT:0010507)		19	44915533	44915534	Human
597102047	GWAS1198121_H	low density lipoprotein cholesterol measurement QTL GWAS1198121 (human)		4e-323	low density lipoprotein cholesterol measurement	blood low density lipoprotein cholesterol level (CMO:0000053)	19	44918393	44918394	Human
596980188	GWAS1099707_H	memory performance QTL GWAS1099707 (human)		6e-25	memory performance		19	44918620	44918621	Human
596980191	GWAS1099710_H	memory performance QTL GWAS1099710 (human)		2e-22	memory performance		19	44915229	44915230	Human
597134813	GWAS1230887_H	memory performance QTL GWAS1230887 (human)		9e-28	memory performance		19	44917947	44917948	Human
597134812	GWAS1230886_H	memory performance QTL GWAS1230886 (human)		3e-28	memory performance		19	44918393	44918394	Human
597222868	GWAS1318942_H	C-reactive protein measurement QTL GWAS1318942 (human)		8e-145	C-reactive protein measurement	blood C-reactive protein level (CMO:0003160)	19	44915229	44915230	Human
596980186	GWAS1099705_H	memory performance QTL GWAS1099705 (human)		3e-13	memory performance		19	44917843	44917844	Human
1559110	SCL22_H	Serum cholesterol level QTL 22 (human)	3.59	0.000241	Lipid level	LDL cholesterol	19	31907594	57907594	Human
596981191	GWAS1100710_H	memory performance QTL GWAS1100710 (human)		1e-16	memory performance		19	44917997	44917998	Human
596981190	GWAS1100709_H	memory performance QTL GWAS1100709 (human)		9e-17	memory performance		19	44916825	44916826	Human
597384654	GWAS1480728_H	mean corpuscular hemoglobin concentration QTL GWAS1480728 (human)		5e-24	mean corpuscular hemoglobin concentration	mean corpuscular hemoglobin concentration (CMO:0000291)	19	44918903	44918904	Human
597268943	GWAS1365017_H	metabolite measurement QTL GWAS1365017 (human)		8e-12	metabolite measurement		19	44919330	44919331	Human
597252545	GWAS1348619_H	apolipoprotein B measurement QTL GWAS1348619 (human)		1e-219	apolipoprotein B measurement	blood apoliprotein B level (CMO:0000522)	19	44915229	44915230	Human
597132746	GWAS1228820_H	memory performance QTL GWAS1228820 (human)		1e-08	memory performance		19	44915533	44915534	Human
407176731	GWAS825707_H	phospholipid measurement, high density lipoprotein cholesterol measurement QTL GWAS825707 (human)		3e-09	phospholipid measurement, high density lipoprotein cholesterol measurement		19	44918903	44918904	Human
597254598	GWAS1350672_H	apolipoprotein B measurement QTL GWAS1350672 (human)		1e-15	apolipoprotein B measurement	blood apoliprotein B level (CMO:0000522)	19	44917086	44917087	Human
597132799	GWAS1228873_H	memory performance QTL GWAS1228873 (human)		5e-10	memory performance		19	44918393	44918394	Human
597496309	GWAS1592383_H	memory performance QTL GWAS1592383 (human)		3e-15	memory performance		19	44918903	44918904	Human
597170676	GWAS1266750_H	ephrin-B1 measurement QTL GWAS1266750 (human)		9e-31	ephrin-B1 measurement		19	44915533	44915534	Human
597194228	GWAS1290302_H	memory performance QTL GWAS1290302 (human)		0.000004	memory performance		19	44918393	44918394	Human
597134823	GWAS1230897_H	memory performance QTL GWAS1230897 (human)		3e-15	memory performance		19	44917843	44917844	Human
597086695	GWAS1182769_H	triglyceride measurement QTL GWAS1182769 (human)		4e-11	triglyceride measurement	blood triglyceride level (CMO:0000118)	19	44915533	44915534	Human
597069284	GWAS1165358_H	triglyceride measurement QTL GWAS1165358 (human)		6e-10	triglyceride measurement	blood triglyceride level (CMO:0000118)	19	44919330	44919331	Human
597069285	GWAS1165359_H	triglyceride measurement QTL GWAS1165359 (human)		3e-10	triglyceride measurement	blood triglyceride level (CMO:0000118)	19	44919330	44919331	Human
597174767	GWAS1270841_H	triglyceride measurement QTL GWAS1270841 (human)		8e-31	triglyceride measurement	blood triglyceride level (CMO:0000118)	19	44915533	44915534	Human
597134816	GWAS1230890_H	memory performance QTL GWAS1230890 (human)		6e-25	memory performance		19	44916825	44916826	Human
596982254	GWAS1101773_H	memory performance QTL GWAS1101773 (human)		2e-15	memory performance		19	44918487	44918488	Human
596982045	GWAS1101564_H	memory performance QTL GWAS1101564 (human)		5e-10	memory performance		19	44918393	44918394	Human
597153051	GWAS1249125_H	low density lipoprotein cholesterol measurement, lipid measurement QTL GWAS1249125 (human)		4e-28	low density lipoprotein cholesterol measurement, lipid measurement	blood lipid measurement (CMO:0000050)	19	44915229	44915230	Human
597068058	GWAS1164132_H	family history of Alzheimer’s disease QTL GWAS1164132 (human)		3e-90	family history of Alzheimer’s disease		19	44917843	44917844	Human
597183764	GWAS1279838_H	phospholipids in large HDL measurement QTL GWAS1279838 (human)		6e-10	phospholipids in large HDL measurement	blood high density lipoprotein phospholipid level (CMO:0001565)	19	44917997	44917998	Human
597178646	GWAS1274720_H	protein measurement QTL GWAS1274720 (human)		7e-33	protein measurement		19	44915533	44915534	Human
596983043	GWAS1102562_H	memory performance QTL GWAS1102562 (human)		7e-09	memory performance		19	44915533	44915534	Human
597134593	GWAS1230667_H	memory performance QTL GWAS1230667 (human)		7e-23	memory performance		19	44917947	44917948	Human
596982018	GWAS1101537_H	memory performance QTL GWAS1101537 (human)		3e-10	memory performance		19	44915533	44915534	Human
596983042	GWAS1102561_H	memory performance QTL GWAS1102561 (human)		6e-09	memory performance		19	44918487	44918488	Human
597197057	GWAS1293131_H	memory performance QTL GWAS1293131 (human)		7e-10	memory performance		19	44918393	44918394	Human
597197059	GWAS1293133_H	memory performance QTL GWAS1293133 (human)		8e-10	memory performance		19	44917947	44917948	Human
597135627	GWAS1231701_H	memory performance QTL GWAS1231701 (human)		2e-10	memory performance		19	44916825	44916826	Human
407179993	GWAS828969_H	free cholesterol measurement, high density lipoprotein cholesterol measurement QTL GWAS828969 (human)		7e-14	free cholesterol measurement, high density lipoprotein cholesterol measurement		19	44918903	44918904	Human
597135624	GWAS1231698_H	memory performance QTL GWAS1231698 (human)		1e-10	memory performance		19	44917997	44917998	Human
596980021	GWAS1099540_H	memory performance QTL GWAS1099540 (human)		3e-15	memory performance		19	44918903	44918904	Human
596980020	GWAS1099539_H	memory performance QTL GWAS1099539 (human)		1e-15	memory performance		19	44916825	44916826	Human
597335346	GWAS1431420_H	COVID-19, mortality QTL GWAS1431420 (human)		0.0000003	COVID-19, mortality	ratio of deaths to total study population during a period of time (CMO:0001023)	19	44915533	44915534	Human
596964668	GWAS1084187_H	alkaline phosphatase measurement QTL GWAS1084187 (human)		2e-14	alkaline phosphatase measurement		19	44915704	44915705	Human
597146940	GWAS1243014_H	triglyceride measurement QTL GWAS1243014 (human)		3e-13	triglyceride measurement	blood triglyceride level (CMO:0000118)	19	44919304	44919305	Human
597267762	GWAS1363836_H	diacylglycerol 36:4 measurement QTL GWAS1363836 (human)		1e-11	diacylglycerol 36:4 measurement		19	44919330	44919331	Human
596982048	GWAS1101567_H	memory performance QTL GWAS1101567 (human)		1e-09	memory performance		19	44917947	44917948	Human
597154094	GWAS1250168_H	low density lipoprotein cholesterol measurement, phospholipid measurement QTL GWAS1250168 (human)		6e-27	low density lipoprotein cholesterol measurement, phospholipid measurement	blood low density lipoprotein cholesterol level (CMO:0000053)	19	44915229	44915230	Human
597255461	GWAS1351535_H	total cholesterol measurement QTL GWAS1351535 (human)		7e-89	total cholesterol measurement	blood total cholesterol level (CMO:0000051)	19	44915229	44915230	Human
596983126	GWAS1102645_H	memory performance QTL GWAS1102645 (human)		1e-16	memory performance		19	44915704	44915705	Human
597200208	GWAS1296282_H	memory performance QTL GWAS1296282 (human)		5e-19	memory performance		19	44918620	44918621	Human
596982111	GWAS1101630_H	memory performance QTL GWAS1101630 (human)		2e-09	memory performance		19	44918393	44918394	Human
597152068	GWAS1248142_H	free cholesterol:total lipids ratio, high density lipoprotein cholesterol measurement QTL GWAS1248142 (human)		2e-31	free cholesterol:total lipids ratio, high density lipoprotein cholesterol measurement	blood high density lipoprotein cholesterol level (CMO:0000052)	19	44918393	44918394	Human
597152067	GWAS1248141_H	free cholesterol:total lipids ratio, high density lipoprotein cholesterol measurement QTL GWAS1248141 (human)		7e-20	free cholesterol:total lipids ratio, high density lipoprotein cholesterol measurement	blood high density lipoprotein cholesterol level (CMO:0000052)	19	44915229	44915230	Human
597303631	GWAS1399705_H	level of apolipoprotein C-I in blood serum QTL GWAS1399705 (human)		2e-25	level of apolipoprotein C-I in blood serum		19	44919330	44919331	Human
597200206	GWAS1296280_H	memory performance QTL GWAS1296280 (human)		7e-20	memory performance		19	44918393	44918394	Human
597200207	GWAS1296281_H	memory performance QTL GWAS1296281 (human)		9e-20	memory performance		19	44917947	44917948	Human
597197121	GWAS1293195_H	memory performance QTL GWAS1293195 (human)		1e-14	memory performance		19	44917843	44917844	Human
597042508	GWAS1138582_H	triglyceride measurement QTL GWAS1138582 (human)		7e-25	triglyceride measurement	blood triglyceride level (CMO:0000118)	19	44919330	44919331	Human
597194052	GWAS1290126_H	memory performance QTL GWAS1290126 (human)		2e-08	memory performance		19	44915229	44915230	Human
597200196	GWAS1296270_H	memory performance QTL GWAS1296270 (human)		1e-21	memory performance		19	44917997	44917998	Human
597197124	GWAS1293198_H	memory performance QTL GWAS1293198 (human)		3e-13	memory performance		19	44918620	44918621	Human
596983115	GWAS1102634_H	memory performance QTL GWAS1102634 (human)		4e-19	memory performance		19	44917843	44917844	Human
597133693	GWAS1229767_H	memory performance QTL GWAS1229767 (human)		2e-22	memory performance		19	44917947	44917948	Human
596982119	GWAS1101638_H	memory performance QTL GWAS1101638 (human)		3e-13	memory performance		19	44918620	44918621	Human
597174634	GWAS1270708_H	saturated fatty acids measurement QTL GWAS1270708 (human)		9e-34	fatty acid amount (VT:0010046)		19	44918620	44918621	Human
597176685	GWAS1272759_H	protein measurement QTL GWAS1272759 (human)		1e-18	protein measurement		19	44915533	44915534	Human
596982112	GWAS1101631_H	memory performance QTL GWAS1101631 (human)		2e-09	memory performance		19	44917947	44917948	Human
596982115	GWAS1101634_H	memory performance QTL GWAS1101634 (human)		1e-14	memory performance		19	44917843	44917844	Human
596982125	GWAS1101644_H	memory performance QTL GWAS1101644 (human)		0.00001	memory performance		19	44918487	44918488	Human
597342563	GWAS1438637_H	high density lipoprotein cholesterol measurement QTL GWAS1438637 (human)		5e-109	high density lipoprotein cholesterol measurement	blood high density lipoprotein cholesterol level (CMO:0000052)	19	44919330	44919331	Human
597167462	GWAS1263536_H	triglyceride measurement QTL GWAS1263536 (human)		7e-39	triglyceride measurement	blood triglyceride level (CMO:0000118)	19	44919330	44919331	Human
596980885	GWAS1100404_H	memory performance QTL GWAS1100404 (human)		4e-14	memory performance		19	44917843	44917844	Human
597192863	GWAS1288937_H	memory performance QTL GWAS1288937 (human)		6e-25	memory performance		19	44918620	44918621	Human
596980893	GWAS1100412_H	memory performance QTL GWAS1100412 (human)		2e-11	memory performance		19	44918620	44918621	Human
596980895	GWAS1100414_H	memory performance QTL GWAS1100414 (human)		7e-11	memory performance		19	44918487	44918488	Human
597195913	GWAS1291987_H	memory performance QTL GWAS1291987 (human)		3e-09	memory performance		19	44915533	44915534	Human
596980868	GWAS1100387_H	memory performance QTL GWAS1100387 (human)		3e-18	memory performance		19	44918393	44918394	Human
596980866	GWAS1100385_H	memory performance QTL GWAS1100385 (human)		2e-19	memory performance		19	44917947	44917948	Human
597195911	GWAS1291985_H	memory performance QTL GWAS1291985 (human)		0.00001	memory performance		19	44918487	44918488	Human
596982963	GWAS1102482_H	memory performance QTL GWAS1102482 (human)		4e-27	memory performance		19	44918620	44918621	Human
597061808	GWAS1157882_H	total cholesterol measurement QTL GWAS1157882 (human)		0.000002	total cholesterol measurement	blood total cholesterol level (CMO:0000051)	19	44919330	44919331	Human
596982962	GWAS1102481_H	memory performance QTL GWAS1102481 (human)		1e-27	memory performance		19	44917843	44917844	Human
597061809	GWAS1157883_H	total cholesterol measurement QTL GWAS1157883 (human)		0.0000002	total cholesterol measurement	blood total cholesterol level (CMO:0000051)	19	44919330	44919331	Human
597111996	GWAS1208070_H	Alzheimer disease, family history of Alzheimer’s disease QTL GWAS1208070 (human)		1e-300	Alzheimer disease, family history of Alzheimer’s disease		19	44915229	44915230	Human
596980903	GWAS1100422_H	memory performance QTL GWAS1100422 (human)		1e-09	memory performance		19	44915704	44915705	Human
597159075	GWAS1255149_H	remnant cholesterol measurement QTL GWAS1255149 (human)		5e-13	remnant cholesterol measurement		19	44915229	44915230	Human
597194926	GWAS1291000_H	memory performance QTL GWAS1291000 (human)		0.000006	memory performance		19	44918393	44918394	Human
597192866	GWAS1288940_H	memory performance QTL GWAS1288940 (human)		2e-22	memory performance		19	44915229	44915230	Human
596986027	GWAS1105546_H	memory performance QTL GWAS1105546 (human)		1e-09	memory performance		19	44918620	44918621	Human
596980906	GWAS1100425_H	memory performance QTL GWAS1100425 (human)		3e-09	memory performance		19	44915229	44915230	Human
596986026	GWAS1105545_H	memory performance QTL GWAS1105545 (human)		7e-10	memory performance		19	44918487	44918488	Human
597198044	GWAS1294118_H	memory performance QTL GWAS1294118 (human)		2e-09	memory performance		19	44918393	44918394	Human
597198045	GWAS1294119_H	memory performance QTL GWAS1294119 (human)		2e-09	memory performance		19	44917947	44917948	Human
597498075	GWAS1594149_H	memory performance QTL GWAS1594149 (human)		1e-10	memory performance		19	44918903	44918904	Human
596984030	GWAS1103549_H	memory performance QTL GWAS1103549 (human)		1e-10	memory performance		19	44918903	44918904	Human
597134555	GWAS1230629_H	memory performance QTL GWAS1230629 (human)		9e-13	memory performance		19	44915533	44915534	Human
597156039	GWAS1252113_H	triglyceride:HDL cholesterol ratio QTL GWAS1252113 (human)		1e-09	blood triglyceride amount (VT:0002644)		19	44919330	44919331	Human
596982983	GWAS1102502_H	memory performance QTL GWAS1102502 (human)		1e-10	memory performance		19	44915533	44915534	Human
597132489	GWAS1228563_H	memory performance QTL GWAS1228563 (human)		2e-10	memory performance		19	44915533	44915534	Human
597253369	GWAS1349443_H	C-reactive protein measurement QTL GWAS1349443 (human)		4e-14	C-reactive protein measurement	blood C-reactive protein level (CMO:0003160)	19	44919304	44919305	Human
596980980	GWAS1100499_H	memory performance QTL GWAS1100499 (human)		0.000006	memory performance		19	44918393	44918394	Human
597271803	GWAS1367877_H	triglyceride measurement QTL GWAS1367877 (human)		2e-46	triglyceride measurement	blood triglyceride level (CMO:0000118)	19	44915533	44915534	Human
596982003	GWAS1101522_H	memory performance QTL GWAS1101522 (human)		2e-16	memory performance		19	44916825	44916826	Human
597150975	GWAS1247049_H	total cholesterol measurement, low density lipoprotein cholesterol measurement QTL GWAS1247049 (human)		4e-22	total cholesterol measurement, low density lipoprotein cholesterol measurement	blood low density lipoprotein cholesterol level (CMO:0000053)	19	44915229	44915230	Human
597181683	GWAS1277757_H	free cholesterol in very large VLDL measurement QTL GWAS1277757 (human)		2e-23	blood VLDL cholesterol amount (VT:0005144)		19	44915533	44915534	Human
596982011	GWAS1101530_H	memory performance QTL GWAS1101530 (human)		2e-13	memory performance		19	44917997	44917998	Human
597153007	GWAS1249081_H	cholesteryl esters:total lipids ratio, intermediate density lipoprotein measurement QTL GWAS1249081 (human)		2e-13	total cholesterol measurement	blood total cholesterol level (CMO:0000051)	19	44915229	44915230	Human
597176544	GWAS1272618_H	triglycerides in very large VLDL measurement QTL GWAS1272618 (human)		7e-26	blood VLDL triglyceride amount (VT:0010700)		19	44915533	44915534	Human
597197024	GWAS1293098_H	memory performance QTL GWAS1293098 (human)		1e-10	memory performance		19	44915533	44915534	Human
597132523	GWAS1228597_H	memory performance QTL GWAS1228597 (human)		9e-13	memory performance		19	44917997	44917998	Human
597161194	GWAS1257268_H	low density lipoprotein cholesterol measurement QTL GWAS1257268 (human)		3e-28	low density lipoprotein cholesterol measurement	blood low density lipoprotein cholesterol level (CMO:0000053)	19	44915229	44915230	Human
597135383	GWAS1231457_H	memory performance QTL GWAS1231457 (human)		2e-12	memory performance		19	44918393	44918394	Human
597194777	GWAS1290851_H	memory performance QTL GWAS1290851 (human)		3e-15	memory performance		19	44917947	44917948	Human
596982807	GWAS1102326_H	memory performance QTL GWAS1102326 (human)		3e-28	memory performance		19	44918393	44918394	Human
597196830	GWAS1292904_H	memory performance QTL GWAS1292904 (human)		7e-11	memory performance		19	44918620	44918621	Human
596982812	GWAS1102331_H	memory performance QTL GWAS1102331 (human)		2e-25	memory performance		19	44918903	44918904	Human
596982815	GWAS1102334_H	memory performance QTL GWAS1102334 (human)		6e-25	memory performance		19	44916825	44916826	Human
597135389	GWAS1231463_H	memory performance QTL GWAS1231463 (human)		7e-12	memory performance		19	44917947	44917948	Human
597194770	GWAS1290844_H	memory performance QTL GWAS1290844 (human)		2e-16	memory performance		19	44918393	44918394	Human
596982809	GWAS1102328_H	memory performance QTL GWAS1102328 (human)		9e-28	memory performance		19	44917947	44917948	Human
597135386	GWAS1231460_H	memory performance QTL GWAS1231460 (human)		3e-12	memory performance		19	44915533	44915534	Human
597194773	GWAS1290847_H	memory performance QTL GWAS1290847 (human)		8e-16	memory performance		19	44918487	44918488	Human
597282825	GWAS1378899_H	free cholesterol:total lipids ratio, high density lipoprotein cholesterol measurement QTL GWAS1378899 (human)		7e-35	free cholesterol:total lipids ratio, high density lipoprotein cholesterol measurement	blood high density lipoprotein cholesterol level (CMO:0000052)	19	44915533	44915534	Human
597264395	GWAS1360469_H	triglyceride measurement QTL GWAS1360469 (human)		2e-169	triglyceride measurement	blood triglyceride level (CMO:0000118)	19	44919330	44919331	Human
596983809	GWAS1103328_H	memory performance QTL GWAS1103328 (human)		6e-25	memory performance		19	44918393	44918394	Human
597194753	GWAS1290827_H	memory performance QTL GWAS1290827 (human)		5e-13	memory performance		19	44917997	44917998	Human
597528583	GWAS1624657_H	memory performance QTL GWAS1624657 (human)		4e-17	memory performance		19	44918903	44918904	Human
597444614	GWAS1540688_H	fatty acid measurement QTL GWAS1540688 (human)		2e-26	fatty acid measurement		19	44918903	44918904	Human
596983817	GWAS1103336_H	memory performance QTL GWAS1103336 (human)		1e-22	memory performance		19	44915704	44915705	Human
597491713	GWAS1587787_H	high density lipoprotein cholesterol measurement QTL GWAS1587787 (human)		1e-101	high density lipoprotein cholesterol measurement	blood high density lipoprotein cholesterol level (CMO:0000052)	19	44918903	44918904	Human
596983816	GWAS1103335_H	memory performance QTL GWAS1103335 (human)		1e-22	memory performance		19	44917947	44917948	Human
597151753	GWAS1247827_H	low density lipoprotein cholesterol measurement, lipid measurement QTL GWAS1247827 (human)		2e-28	low density lipoprotein cholesterol measurement, lipid measurement	blood lipid measurement (CMO:0000050)	19	44915229	44915230	Human
597194758	GWAS1290832_H	memory performance QTL GWAS1290832 (human)		8e-14	memory performance		19	44918620	44918621	Human
597196848	GWAS1292922_H	memory performance QTL GWAS1292922 (human)		8e-08	memory performance		19	44915533	44915534	Human
597169202	GWAS1265276_H	free cholesterol measurement QTL GWAS1265276 (human)		1e-18	free cholesterol measurement	blood cholesterol level (CMO:0002280)	19	44917961	44917963	Human
597165107	GWAS1261181_H	total cholesterol measurement, low density lipoprotein cholesterol measurement QTL GWAS1261181 (human)		6e-29	apolipoprotein A 1 measurement	blood apolipoprotein AI level (CMO:0000520)	19	44915229	44915230	Human
407180264	GWAS829240_H	high density lipoprotein cholesterol measurement QTL GWAS829240 (human)		2e-08	high density lipoprotein cholesterol measurement		19	44918903	44918904	Human
597196846	GWAS1292920_H	memory performance QTL GWAS1292920 (human)		5e-09	memory performance		19	44917843	44917844	Human
597169199	GWAS1265273_H	free cholesterol measurement QTL GWAS1265273 (human)		6e-12	free cholesterol measurement	blood cholesterol level (CMO:0002280)	19	44915229	44915230	Human
597510182	GWAS1606256_H	cerebral amyloid deposition measurement QTL GWAS1606256 (human)		3e-21	cerebral cortex integrity trait (VT:0010923)		19	44918903	44918904	Human
596982824	GWAS1102343_H	memory performance QTL GWAS1102343 (human)		2e-20	memory performance		19	44918620	44918621	Human
597130281	GWAS1226355_H	cerebral amyloid angiopathy QTL GWAS1226355 (human)		9e-18	cerebral amyloid angiopathy		19	44915533	44915534	Human
596982826	GWAS1102345_H	memory performance QTL GWAS1102345 (human)		4e-20	memory performance		19	44917997	44917998	Human
597028949	GWAS1125023_H	BMI-adjusted waist-hip ratio QTL GWAS1125023 (human)		3e-20	body size trait (VT:0100005)		19	44915533	44915534	Human
597288025	GWAS1384099_H	phospholipids in very large HDL measurement QTL GWAS1384099 (human)		2e-18	blood HDL phospholipid amount (VT:0010504)		19	44915533	44915534	Human
596983888	GWAS1103407_H	memory performance QTL GWAS1103407 (human)		7e-21	memory performance		19	44915704	44915705	Human
597471321	GWAS1567395_H	total cholesterol measurement QTL GWAS1567395 (human)		1e-179	total cholesterol measurement	blood total cholesterol level (CMO:0000051)	19	44918903	44918904	Human
596983891	GWAS1103410_H	memory performance QTL GWAS1103410 (human)		3e-19	memory performance		19	44917843	44917844	Human
597186646	GWAS1282720_H	free cholesterol in medium HDL measurement QTL GWAS1282720 (human)		2e-15	blood HDL cholesterol amount (VT:0000184)		19	44917997	44917998	Human
596983877	GWAS1103396_H	memory performance QTL GWAS1103396 (human)		7e-10	memory performance		19	44918393	44918394	Human
596983879	GWAS1103398_H	memory performance QTL GWAS1103398 (human)		8e-10	memory performance		19	44917947	44917948	Human
597486670	GWAS1582744_H	ceramide measurement QTL GWAS1582744 (human)		0.000006	ceramide measurement		19	44918903	44918904	Human
597134403	GWAS1230477_H	memory performance QTL GWAS1230477 (human)		1e-11	memory performance		19	44918487	44918488	Human
596983884	GWAS1103403_H	memory performance QTL GWAS1103403 (human)		7e-11	memory performance		19	44918620	44918621	Human
597198971	GWAS1295045_H	memory performance QTL GWAS1295045 (human)		3e-20	memory performance		19	44918393	44918394	Human
597501054	GWAS1597128_H	memory performance QTL GWAS1597128 (human)		2e-12	memory performance		19	44918903	44918904	Human
597248113	GWAS1344187_H	serum alanine aminotransferase measurement QTL GWAS1344187 (human)		2e-09	serum alanine aminotransferase measurement	serum alanine aminotransferase activity level (CMO:0000575)	19	44915229	44915230	Human
597184627	GWAS1280701_H	free cholesterol in very small VLDL measurement QTL GWAS1280701 (human)		1e-16	blood VLDL cholesterol amount (VT:0005144)		19	44918393	44918394	Human
597198967	GWAS1295041_H	memory performance QTL GWAS1295041 (human)		2e-20	memory performance		19	44917947	44917948	Human
597254251	GWAS1350325_H	aspartate aminotransferase to alanine aminotransferase ratio QTL GWAS1350325 (human)		5e-12	aspartate aminotransferase to alanine aminotransferase ratio	serum aspartate aminotransferase activity level to alanine aminotransferase activity level ratio (CMO:0002245)	19	44915229	44915230	Human
597184619	GWAS1280693_H	total lipids in very small VLDL measurement QTL GWAS1280693 (human)		2e-17	blood phospholipid amount (VT:0006084)		19	44918393	44918394	Human
596980847	GWAS1100366_H	memory performance QTL GWAS1100366 (human)		1e-08	memory performance		19	44915533	44915534	Human
597199970	GWAS1296044_H	memory performance QTL GWAS1296044 (human)		2e-26	memory performance		19	44916825	44916826	Human
597199972	GWAS1296046_H	memory performance QTL GWAS1296046 (human)		7e-25	memory performance		19	44915229	44915230	Human

Markers in Region

PMC164795P2

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	19	45,429,809 - 45,430,280	UniSTS	GRCh37
GRCh37	19	45,417,713 - 45,418,196	UniSTS	GRCh37
Build 36	19	50,109,553 - 50,110,036	RGD	NCBI36
Celera	19	42,234,132 - 42,234,603	UniSTS
Celera	19	42,222,030 - 42,222,513	RGD
Cytogenetic Map	19	q13.2	UniSTS
HuRef	19	41,848,482 - 41,848,965	UniSTS
HuRef	19	41,860,362 - 41,860,833	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

adipose tissue	alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	entire extraembryonic component	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system
1204	2424	2784	2240	4939	1721	2336	4	622	1865	464	2268	7189	6367	52	3705	845	1729	1603	170

Sequence

Nucleotide Sequences


RefSeq Transcripts	NG_012859	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001321065	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001321066	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001379687	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001645	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC011481	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF050154	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF308154	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF308155	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AI310334	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AI885116	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK225971	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK312036	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY422954	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC009698	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC055093	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BT007142	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CA445083	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH471126	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CP068259	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CR456907	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DA482306	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FJ525874	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M20843	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M20902	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M27359	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X00570	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENST00000586638 ⟹ ENSP00000466146

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	19	44,914,869 - 44,919,346 (+)	Ensembl

Ensembl Acc Id:

ENST00000588750 ⟹ ENSP00000465356

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	19	44,914,247 - 44,919,342 (+)	Ensembl

Ensembl Acc Id:

ENST00000588802 ⟹ ENSP00000468029

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	19	44,914,325 - 44,919,346 (+)	Ensembl

Ensembl Acc Id:

ENST00000589078 ⟹ ENSP00000465710

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	19	44,914,840 - 44,916,292 (+)	Ensembl

Ensembl Acc Id:

ENST00000589781 ⟹ ENSP00000467504

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	19	44,914,710 - 44,919,343 (+)	Ensembl

Ensembl Acc Id:

ENST00000590334 ⟹ ENSP00000465190

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	19	44,914,869 - 44,919,342 (+)	Ensembl

Ensembl Acc Id:

ENST00000592176 ⟹ ENSP00000466227

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	19	44,914,869 - 44,919,349 (+)	Ensembl

Ensembl Acc Id:

ENST00000592535 ⟹ ENSP00000468276

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	19	44,914,608 - 44,919,346 (+)	Ensembl

Ensembl Acc Id:

ENST00000592885 ⟹ ENSP00000467368

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	19	44,914,703 - 44,919,344 (+)	Ensembl

RefSeq Acc Id:

NM_001321065 ⟹ NP_001307994

RefSeq Status:

REVIEWED

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	19	44,914,325 - 44,919,346 (+)	NCBI
CHM1_1	19	45,420,226 - 45,425,333 (+)	NCBI
T2T-CHM13v2.0	19	47,739,017 - 47,744,046 (+)	NCBI

Sequence:

show sequence

GAGCTCGGCTCTTGAGACAGGAATCTTGCCCATTCCCCGAACGAATAAACCCCTTCCTTAACTC
AGCGTCTGAGGAATTTTGTCTGCGGCTCCTCCTGCTACATTCTGAGTGGGGAAAGGGACTAAGG
TGGTCTGAGGACCCCACAGAGTCAGGAAGATTGAGAGAGTGCCCCTCCGGCCTCGCCATGAGGC
TCTTCCTGTCGCTCCCGGTCCTGGTGGTGGTTCTGTCGATCGTCTTGGAAGGCCCAGCCCCAGC
CCAGGGGACCCCAGACGTCTCCAGTGCCTTGGATAAGCTGAAGGAGTTTGGAAACACACTGGAG
GACAAGGCTCGGGAACTCATCAGCCGCATCAAACAGAGTGAACTTTCTGCCAAGATGCGGGAGT
GGTTTTCAGAGACATTTCAGAAAGTGAAGGAGAAACTCAAGATTGACTCATGAGGACCTGAAGG
GTGACATCCCAGGAGGGGCCTCTGAAATTTCCCACACCCCAGCGCCTGTGCTGAGGACTCCCTC
CATGTGGCCCCAGGTGCCACCAATAAAAATCCTACAGAAAA

hide sequence

RefSeq Acc Id:

NM_001321066 ⟹ NP_001307995

RefSeq Status:

REVIEWED

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	19	44,914,325 - 44,919,346 (+)	NCBI
CHM1_1	19	45,420,226 - 45,425,333 (+)	NCBI
T2T-CHM13v2.0	19	47,739,017 - 47,744,046 (+)	NCBI

Sequence:

show sequence

GAGCTCGGCTCTTGAGACAGGAATCTTGCCCATTCCCCGAACGAATAAACCCCTTCCTTAACTC
AGCGTCTGAGGAATTTTGTCTGCGGCTCCTCCTGCTACATTCTGAGTGGGGAAAGGGACTAAGG
TGGTCTGAGGACCCCACAGAGTCAGGAAGATTGAGAGCCTGATAAAGGTCCTGCGGGCAGGACA
GGACCTCCCAACCAAGCCCTCCAGCAAGGATTCAGAGTGCCCCTCCGGCCTCGCCATGAGGCTC
TTCCTGTCGCTCCCGGTCCTGGTGGTGGTTCTGTCGATCGTCTTGGAAGGCCCAGCCCCAGCCC
AGGGGACCCCAGACGTCTCCAGTGCCTTGGATAAGCTGAAGGAGTTTGGAAACACACTGGAGGA
CAAGGCTCGGGAACTCATCAGCCGCATCAAACAGAGTGAACTTTCTGCCAAGATGCGGGAGTGG
TTTTCAGAGACATTTCAGAAAGTGAAGGAGAAACTCAAGATTGACTCATGAGGACCTGAAGGGT
GACATCCCAGGAGGGGCCTCTGAAATTTCCCACACCCCAGCGCCTGTGCTGAGGACTCCCTCCA
TGTGGCCCCAGGTGCCACCAATAAAAATCCTACAGAAAA

hide sequence

RefSeq Acc Id:

NM_001379687 ⟹ NP_001366616

RefSeq Status:

REVIEWED

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	19	44,914,672 - 44,919,346 (+)	NCBI
T2T-CHM13v2.0	19	47,739,364 - 47,744,046 (+)	NCBI

Sequence:

show sequence

CCTGATAAAGGTCCTGCGGGCAGGACAGGACCTCCCAACCAAGCCCTCCAGCAAGGATTCAGAG
TGCCCCTCCGGCCTCGCCATGAGGCTCTTCCTGTCGCTCCCGGTCCTGGTGGTGGTTCTGTCGA
TCGTCTTGGAAGGCCCAGCCCCAGCCCAGGGGACCCCAGACGTCTCCAGTGCCTTGGATAAGCT
GAAGGAGTTTGGAAACACACTGGAGGACAAGGCTCGGGAACTCATCAGCCGCATCAAACAGAGT
GAACTTTCTGCCAAGATGCGGTTAGAACCCTTCCCAGGGCACGGGAGAGCTGGGGTGTGTTTTT
GGGTGGAGCCCTGGCAGATGGTCCAAGATGAACAGATTGAAAAAAAAACAAGTCCTGGAGAGGC
TGACAACATCCCTCTGGTCACACAGCTAGATCTCAAGGGAGTGGTTTTCAGAGACATTTCAGAA
AGTGAAGGAGAAACTCAAGATTGACTCATGAGGACCTGAAGGGTGACATCCCAGGAGGGGCCTC
TGAAATTTCCCACACCCCAGCGCCTGTGCTGAGGACTCCCTCCATGTGGCCCCAGGTGCCACCA
ATAAAAATCCTACAGAAAA

hide sequence

RefSeq Acc Id:

NM_001645 ⟹ NP_001636

RefSeq Status:

REVIEWED

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	19	44,914,608 - 44,919,346 (+)	NCBI
GRCh37	19	45,417,577 - 45,422,606 (+)	NCBI
Build 36	19	50,109,761 - 50,114,446 (+)	NCBI Archive
HuRef	19	41,848,690 - 41,853,227 (+)	ENTREZGENE
CHM1_1	19	45,420,534 - 45,425,333 (+)	NCBI
T2T-CHM13v2.0	19	47,739,300 - 47,744,046 (+)	NCBI

Sequence:

show sequence

AGGCGGTCAGGGGAAGGCTCAGGAGGAGGGAGATCAACATCAACCTGCCCCGCCCCCTCCCCAG
CCTGATAAAGGTCCTGCGGGCAGGACAGGACCTCCCAACCAAGCCCTCCAGCAAGGATTCAGAG
TGCCCCTCCGGCCTCGCCATGAGGCTCTTCCTGTCGCTCCCGGTCCTGGTGGTGGTTCTGTCGA
TCGTCTTGGAAGGCCCAGCCCCAGCCCAGGGGACCCCAGACGTCTCCAGTGCCTTGGATAAGCT
GAAGGAGTTTGGAAACACACTGGAGGACAAGGCTCGGGAACTCATCAGCCGCATCAAACAGAGT
GAACTTTCTGCCAAGATGCGGGAGTGGTTTTCAGAGACATTTCAGAAAGTGAAGGAGAAACTCA
AGATTGACTCATGAGGACCTGAAGGGTGACATCCCAGGAGGGGCCTCTGAAATTTCCCACACCC
CAGCGCCTGTGCTGAGGACTCCCTCCATGTGGCCCCAGGTGCCACCAATAAAAATCCTACAGAA
AA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001307994	(Get FASTA)	NCBI Sequence Viewer
	NP_001307995	(Get FASTA)	NCBI Sequence Viewer
	NP_001366616	(Get FASTA)	NCBI Sequence Viewer
	NP_001636	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA51762	(Get FASTA)	NCBI Sequence Viewer
	AAA88018	(Get FASTA)	NCBI Sequence Viewer
	AAD02506	(Get FASTA)	NCBI Sequence Viewer
	AAG49499	(Get FASTA)	NCBI Sequence Viewer
	AAG49500	(Get FASTA)	NCBI Sequence Viewer
	AAH09698	(Get FASTA)	NCBI Sequence Viewer
	AAH55093	(Get FASTA)	NCBI Sequence Viewer
	AAP35806	(Get FASTA)	NCBI Sequence Viewer
	AAQ91813	(Get FASTA)	NCBI Sequence Viewer
	BAG34973	(Get FASTA)	NCBI Sequence Viewer
	CAA25235	(Get FASTA)	NCBI Sequence Viewer
	CAG33188	(Get FASTA)	NCBI Sequence Viewer
	EAW57307	(Get FASTA)	NCBI Sequence Viewer
	EAW57308	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSP00000465190.1
	ENSP00000465356
	ENSP00000465356.1
	ENSP00000465710.1
	ENSP00000466146.1
	ENSP00000466227.1
	ENSP00000467368
	ENSP00000467368.1
	ENSP00000467504.1
	ENSP00000468029
	ENSP00000468029.1
	ENSP00000468276
	ENSP00000468276.2
GenBank Protein	P02654	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001636 ⟸ NM_001645
- Peptide Label:	isoform a precursor
- UniProtKB:	B2R526 (UniProtKB/Swiss-Prot), Q6IB97 (UniProtKB/Swiss-Prot), P02654 (UniProtKB/Swiss-Prot), K7ERI9 (UniProtKB/TrEMBL)
- Sequence:	show sequence MRLFLSLPVLVVVLSIVLEGPAPAQGTPDVSSALDKLKEFGNTLEDKARELISRIKQSELSAKM REWFSETFQKVKEKLKIDS hide sequence

RefSeq Acc Id:	NP_001307995 ⟸ NM_001321066
- Peptide Label:	isoform a precursor
- UniProtKB:	B2R526 (UniProtKB/Swiss-Prot), Q6IB97 (UniProtKB/Swiss-Prot), P02654 (UniProtKB/Swiss-Prot), K7ERI9 (UniProtKB/TrEMBL)
- Sequence:	show sequence MRLFLSLPVLVVVLSIVLEGPAPAQGTPDVSSALDKLKEFGNTLEDKARELISRIKQSELSAKM REWFSETFQKVKEKLKIDS hide sequence

RefSeq Acc Id:	NP_001307994 ⟸ NM_001321065
- Peptide Label:	isoform a precursor
- UniProtKB:	B2R526 (UniProtKB/Swiss-Prot), Q6IB97 (UniProtKB/Swiss-Prot), P02654 (UniProtKB/Swiss-Prot), K7ERI9 (UniProtKB/TrEMBL)
- Sequence:	show sequence MRLFLSLPVLVVVLSIVLEGPAPAQGTPDVSSALDKLKEFGNTLEDKARELISRIKQSELSAKM REWFSETFQKVKEKLKIDS hide sequence

RefSeq Acc Id:	NP_001366616 ⟸ NM_001379687
- Peptide Label:	isoform b precursor
- UniProtKB:	K7EPF9 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSP00000466146 ⟸ ENST00000586638

Ensembl Acc Id:

ENSP00000465356 ⟸ ENST00000588750

Ensembl Acc Id:

ENSP00000468029 ⟸ ENST00000588802

Ensembl Acc Id:

ENSP00000465710 ⟸ ENST00000589078

Ensembl Acc Id:

ENSP00000467504 ⟸ ENST00000589781

Ensembl Acc Id:

ENSP00000465190 ⟸ ENST00000590334

Ensembl Acc Id:

ENSP00000467368 ⟸ ENST00000592885

Ensembl Acc Id:

ENSP00000466227 ⟸ ENST00000592176

Ensembl Acc Id:

ENSP00000468276 ⟸ ENST00000592535

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P02654-F1-model_v2	AlphaFold	P02654	1-83	view protein structure

Promoters

RGD ID:

7240359

Promoter ID:

EPDNEW_H25926

Type:

initiation region

Name:

APOC1_2

Description:

apolipoprotein C1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Alternative Promoters:

null; see alsoEPDNEW_H25927

Experiment Methods:

Single-end sequencing.

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	19	44,914,325 - 44,914,385	EPDNEW

RGD ID:

7240365

Promoter ID:

EPDNEW_H25927

Type:

multiple initiation site

Name:

APOC1_1

Description:

apolipoprotein C1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Alternative Promoters:

null; see alsoEPDNEW_H25926

Experiment Methods:

Single-end sequencing.

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	19	44,914,708 - 44,914,768	EPDNEW

RGD ID:

6795141

Promoter ID:

HG_KWN:30241

Type:

CpG-Island

SO ACC ID:

SO:0000170

Source:

MPROMDB

Tissues & Cell Lines:

K562

Transcripts:

NM_001645, UC002PAC.1, UC002PAD.1

Position:

Human Assembly	Chr	Position (strand)	Source
Build 36	19	50,109,596 - 50,110,096 (+)	MPROMDB

RGD ID:	6852788
Promoter ID:	EP74196
Type:	single initiation site
Name:	HS_APOC1
Description:	Apolipoprotein C-I.
SO ACC ID:	SO:0000170
Source:	EPD (Eukaryotic Promoter Database, http://epd.vital-it.ch/)
Experiment Methods:	Mammalian gene collection (MGC) full-length cDNA cloning
Position:	No map positions available.

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	HGNC:607	AgrOrtholog
COSMIC	APOC1	COSMIC
Ensembl Genes	ENSG00000130208	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Ensembl Transcript	ENST00000586638.5	UniProtKB/TrEMBL
	ENST00000588750	ENTREZGENE
	ENST00000588750.5	UniProtKB/Swiss-Prot
	ENST00000588802	ENTREZGENE
	ENST00000588802.5	UniProtKB/Swiss-Prot
	ENST00000589078.1	UniProtKB/TrEMBL
	ENST00000589781.1	UniProtKB/TrEMBL
	ENST00000590334.5	UniProtKB/TrEMBL
	ENST00000592176.1	UniProtKB/TrEMBL
	ENST00000592535	ENTREZGENE, UniProtKB/TrEMBL
	ENST00000592535.6	UniProtKB/Swiss-Prot
	ENST00000592885	ENTREZGENE
	ENST00000592885.5	UniProtKB/TrEMBL
Gene3D-CATH	4.10.260.30	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
GTEx	ENSG00000130208	GTEx
HGNC ID	HGNC:607	ENTREZGENE
Human Proteome Map	APOC1	Human Proteome Map
InterPro	ApoC-1_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ApoC-I	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	hsa:341	UniProtKB/Swiss-Prot
NCBI Gene	341	ENTREZGENE
OMIM	107710	OMIM
PANTHER	APOLIPOPROTEIN C-I	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR16565	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	ApoC-I	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PharmGKB	PA51	PharmGKB
UniProt	APOC1_HUMAN	UniProtKB/Swiss-Prot
	B2R526	ENTREZGENE
	K7EJI9_HUMAN	UniProtKB/TrEMBL
	K7EKP1_HUMAN	UniProtKB/TrEMBL
	K7ELM9_HUMAN	UniProtKB/TrEMBL
	K7ELU7_HUMAN	UniProtKB/TrEMBL
	K7EPF9	ENTREZGENE, UniProtKB/TrEMBL
	K7EPR9_HUMAN	UniProtKB/TrEMBL
	K7ERI9	ENTREZGENE, UniProtKB/TrEMBL
	P02654	ENTREZGENE
	Q6IB97	ENTREZGENE
UniProt Secondary	B2R526	UniProtKB/Swiss-Prot
	Q6IB97	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-05-03	APOC1	apolipoprotein C1	APOC1	apolipoprotein C-I	Symbol and/or name change	5135510	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - CTD

RGD Manual Annotations

Manual Human Phenotype Annotations - RGD

Send us a Message

Imported Disease Annotations - CTD

RGD Manual Annotations

Manual Human Phenotype Annotations - RGD