Advanced Search (OLGA)

Gene: Nfe2l2 (nuclear factor, erythroid derived 2, like 2) Mus musculus

Analyze

Symbol:

Nfe2l2

Name:

nuclear factor, erythroid derived 2, like 2

RGD ID:

734432

MGI Page

MGI

Description:

Enables DNA-binding transcription activator activity, RNA polymerase II-specific and RNA polymerase II cis-regulatory region sequence-specific DNA binding activity. Involved in several processes, including PERK-mediated unfolded protein response; cell redox homeostasis; and positive regulation of metabolic process. Acts upstream of or within several processes, including cellular response to copper ion; endoplasmic reticulum unfolded protein response; and positive regulation of DNA-templated transcription. Located in chromatin; cytosol; and nucleus. Part of protein-DNA complex. Is expressed in several structures, including alimentary system; central nervous system; genitourinary system; respiratory system; and sensory organ. Human ortholog(s) of this gene implicated in Alzheimer's disease; cataract; hepatocellular carcinoma; macular degeneration; and tuberculosis. Orthologous to human NFE2L2 (NFE2 like bZIP transcription factor 2).

Type:

protein-coding

RefSeq Status:

REVIEWED

Previously known as:

AI194320; NF-E2-related factor 2; NFE2-related factor 2; Nr; Nrf2; nuclear factor erythroid 2-related factor 2

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	NFE2L2 (NFE2 like bZIP transcription factor 2)	HGNC	Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):	Nfe2l2 (NFE2 like bZIP transcription factor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Nfe2l2 (NFE2 like bZIP transcription factor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	NFE2L2 (NFE2 like bZIP transcription factor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	NFE2L2 (NFE2 like bZIP transcription factor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Nfe2l2 (NFE2 like bZIP transcription factor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	NFE2L2 (NFE2 like bZIP transcription factor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	NFE2L2 (NFE2 like bZIP transcription factor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Nfe2l2 (NFE2 like bZIP transcription factor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Rattus norvegicus (Norway rat):	Nfe2l2 (NFE2 like bZIP transcription factor 2)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	NFE2L2 (NFE2 like bZIP transcription factor 2)	Alliance	DIOPT (HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	nfe2l2a (nuclear factor, erythroid 2-like 2a)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid\|ZFIN)
Caenorhabditis elegans (roundworm):	sknr-1	Alliance	DIOPT (InParanoid\|OrthoFinder\|OrthoInspector)
Drosophila melanogaster (fruit fly):	cnc	Alliance	DIOPT (Hieranoid\|OrthoFinder\|OrthoInspector\|PANTHER)
Caenorhabditis elegans (roundworm):	skn-1	Alliance	DIOPT (InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	nfe2l2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCm39 - Mouse Genome Assembly GRCm39

Position:

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	75,505,860 - 75,535,007 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	75,505,857 - 75,534,985 (-)	Ensembl		GRCm39 Ensembl
GRCm38	2	75,675,513 - 75,704,663 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	75,675,513 - 75,704,641 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	2	75,513,576 - 75,542,698 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	2	75,476,358 - 75,505,480 (-)	NCBI		MGSCv36	mm8
Celera	2	77,336,615 - 77,365,680 (-)	NCBI		Celera
Cytogenetic Map	2	C3	NCBI
cM Map	2	44.75	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Acidoses (ISO)

acute kidney failure (ISO)

Acute Lung Injury (ISO)

Alcoholic Liver Diseases (IEP,ISO)

allergic contact dermatitis (ISO)

Alzheimer's disease (IEP,ISO)

amyotrophic lateral sclerosis (IEP,ISO)

Animal Disease Models (ISO)

asthma (ISO)

Birth Weight (ISO)

Brain Injuries (ISO)

Breast Neoplasms (ISO)

Carcinogenesis (ISO)

Cardiac Fibrosis (ISO)

Cardiac Output, Low (ISO)

Cardiomegaly (ISO)

cataract (ISO)

Chemical and Drug Induced Liver Injury (IEP,IMP,ISO)

cholestasis (ISO)

Chromosome Breakage (ISO)

chronic kidney disease (ISO)

chronic obstructive pulmonary disease (ISO)

Chronic Tubulointerstitial Nephropathy (ISO)

colitis (IEP)

colorectal cancer (ISO)

congestive heart failure (ISO)

Diabetic Cardiomyopathies (IEP,ISO)

Diabetic Nephropathies (ISO)

diabetic retinopathy (ISO)

Disease Progression (ISO)

Emphysema (ISO)

endocrine system disease (ISO)

Endometrial Neoplasms (ISO)

Endotoxemia (ISO)

esophagus squamous cell carcinoma (ISO)

Experimental Autoimmune Encephalomyelitis (ISO)

Experimental Colitis (ISO)

Experimental Diabetes Mellitus (IDA,IMP,ISO)

Experimental Liver Cirrhosis (ISO)

Experimental Mammary Neoplasms (ISO)

Experimental Seizures (IMP,ISO)

extrahepatic cholestasis (ISO)

Fetal Death (ISO)

Fetal Growth Retardation (ISO)

Fetal Weight (ISO)

gastrointestinal system disease (ISO)

genital herpes (IMP)

glucose intolerance (ISO)

Hepatic Insufficiency (ISO)

hepatocellular carcinoma (ISO)

Hepatomegaly (IMP,ISO)

Huntington's disease (ISO)

hyperglycemia (ISO)

Hyperplasia (ISO)

hypertension (ISO)

IMMUNODEFICIENCY, DEVELOPMENTAL DELAY, AND HYPOHOMOCYSTEINEMIA (ISO)

Insulin Resistance (ISO)

keratosis (ISO)

kidney disease (ISO)

Kidney Reperfusion Injury (ISO)

liver cirrhosis (ISO)

Liver Neoplasms (ISO)

Liver Reperfusion Injury (ISO)

lung cancer (ISO)

lung disease (IMP,ISO)

Lung Neoplasms (ISO)

lung non-small cell carcinoma (ISO)

macular degeneration (IMP,ISO)

metabolic dysfunction-associated steatohepatitis (ISO)

metabolic dysfunction-associated steatotic liver disease (ISO)

Micronuclei, Chromosome-Defective (ISO)

middle cerebral artery infarction (ISO)

myocardial infarction (IMP,ISO)

Myocardial Reperfusion Injury (IEP)

Necrosis (ISO)

Neoplasm Invasiveness (ISO)

Neoplasm Metastasis (ISO)

Neoplastic Cell Transformation (ISO)

Neurodevelopmental Disorders (ISO)

obesity (IEP,ISO)

pancreatic ductal carcinoma (ISO)

pleurisy (IMP)

Premature Aging (IEP)

primary biliary cholangitis (ISO)

primary ovarian insufficiency (ISO)

Prostatic Neoplasms (ISO)

pulmonary emphysema (ISO)

pulmonary fibrosis (ISO)

renal cell carcinoma (ISO)

sickle cell anemia (ISO)

Skin Neoplasms (ISO)

Spinal Cord Injuries (ISO)

Splenomegaly (ISO)

split hand-foot malformation 5 (ISO)

squamous cell carcinoma (ISO)

steatotic liver disease (IMP,ISO)

Subarachnoid Hemorrhage (ISO)

Sunburn (IMP)

toxic encephalopathy (ISO)

traumatic brain injury (ISO)

tuberculosis (ISO)

type 2 diabetes mellitus (ISO)

Vascular System Injuries (ISO)

Ventricular Dysfunction, Left (ISO)

Ventricular Remodeling (ISO)

visceral leishmaniasis (ISO)

vitiligo (ISO)

Weight Gain (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-albicanol (EXP)

(+)-alpha-viniferin (EXP)

(+)-beta-thujone (ISO)

(+)-catechin (ISO)

(+)-epicatechin-3-O-gallate (ISO)

(+)-isoborneol (EXP)

(+)-pilocarpine (ISO)

(+)-schisandrin B (EXP,ISO)

(+)-taxifolin (EXP,ISO)

(+)-trans-(S)-allethrin (ISO)

(-)-ephedrine (ISO)

(-)-epigallocatechin 3-gallate (EXP,ISO)

(-)-selegiline (ISO)

(1->4)-beta-D-glucan (EXP)

(E)-cinnamyl alcohol (ISO)

(R)-camphor (ISO)

(R)-carnitine (ISO)

(R)-linalyl acetate (ISO)

(R)-lipoic acid (EXP,ISO)

(R)-noradrenaline (ISO)

(R,R,R)-alpha-tocopherol (ISO)

(S)-colchicine (EXP,ISO)

(S)-duloxetine hydrochloride (ISO)

(S)-naringenin (ISO)

(S)-ropivacaine (ISO)

(Z)-ligustilide (EXP,ISO)

1,1'-azobis(N,N-dimethylformamide) (EXP)

1,2,3-Trichloropropane (EXP)

1,2-dibromoethane (EXP)

1,2-dichloroethane (EXP)

1,2-dimethylhydrazine (EXP,ISO)

1,2-naphthoquinone (EXP,ISO)

1,3-dichloropropan-2-ol (ISO)

1,4,7-triazonane (ISO)

1,4-benzoquinone (EXP,ISO)

1,4-dichlorobenzene (EXP)

1,4-dithiothreitol (ISO)

1,4-naphthoquinone (EXP,ISO)

1,4-phenylenediamine (ISO)

1,8-cineole (ISO)

1-Amino-2,4-dibromoanthraquinone (EXP)

1-benzofuran (EXP)

1-bromopropane (EXP,ISO)

1-chloro-2,4-dinitrobenzene (EXP,ISO)

1-fluoro-2,4-dinitrobenzene (ISO)

1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine (EXP)

1-naphthyl isothiocyanate (EXP,ISO)

1-nitropyrene (ISO)

1-octadec-9-enoylglycero-3-phosphate (EXP,ISO)

1-tert-Butoxy-2-propanol (EXP)

13,14-dihydro-Delta(12)-prostaglandin J2 (ISO)

15-deoxy-Delta(12,14)-prostaglandin J2 (ISO)

17alpha-ethynylestradiol (EXP)

17beta-estradiol (EXP,ISO)

17beta-hydroxy-5alpha-androstan-3-one (EXP)

1H-pyrazole (EXP)

2''-galloylhyperin (EXP,ISO)

2',4'-dihydroxy-6'-methoxy-3',5'-dimethylchalcone (EXP)

2,2',4,4',5,5'-hexachlorobiphenyl (EXP)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,2-Bis(bromomethyl)propane-1,3-diol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3,7,8-Tetrachlorodibenzofuran (ISO)

2,3-dimethoxynaphthalene-1,4-dione (ISO)

2,4,6-trinitrobenzenesulfonic acid (ISO)

2,4-dinitrobromobenzene (ISO)

2,4-dinitroiodobenzene (ISO)

2,4-dinitrotoluene (ISO)

2,5-di-tert-butylbenzene-1,4-diol (EXP)

2,5-dihydroxybenzoic acid (EXP)

2,6-di-tert-butyl-4-methylphenol (EXP)

2,6-dinitrotoluene (ISO)

2-(3,4-dimethoxyphenyl)-5-\{[2-(3,4-dimethoxyphenyl)ethyl](methyl)amino\}-2-(propan-2-yl)pentanenitrile (ISO)

2-(chloromethyl)pyridine (EXP)

2-acetamidofluorene (EXP)

2-amino-2-deoxy-D-galactopyranose (EXP,ISO)

2-amino-3-hydroxypyridine (ISO)

2-aminoethoxydiphenylborane (ISO)

2-chloroethanol (ISO)

2-Hydroxy-6-(8,11,14-pentadecatrienyl)benzoic acid (ISO)

2-hydroxyethyl methacrylate (EXP,ISO)

2-methylcholine (ISO)

2-tert-butylhydroquinone (EXP,ISO)

20-hydroxyecdysone (ISO)

3,3',4,4',5-pentachlorobiphenyl (EXP,ISO)

3,3',4,4'-tetrachlorobiphenyl (EXP)

3,3',5,5'-tetrabromobisphenol A (EXP)

3,3',5-triiodo-L-thyronine (ISO)

3,3'-diindolylmethane (ISO)

3,4-dihydroxybenzoic acid (EXP,ISO)

3,5-diethoxycarbonyl-1,4-dihydrocollidine (EXP)

3,6-diaminoacridine (ISO)

3-chloropropane-1,2-diol (EXP,ISO)

3-hydroxybutyric acid (EXP)

3-isobutyl-1-methyl-7H-xanthine (EXP,ISO)

3-methoxycatechol (ISO)

3-methylcatechol (ISO)

3-methylcholanthrene (EXP,ISO)

3-Nitrobenzanthrone (ISO)

3-Nitrofluoranthene (ISO)

3-nitropropanoic acid (ISO)

3-O-Caffeoyl-1-O-methylquinic acid (ISO)

3-phenylprop-2-enal (EXP,ISO)

3H-1,2-dithiole-3-thione (EXP,ISO)

4,4'-diaminodiphenylmethane (EXP)

4,4'-sulfonyldiphenol (EXP,ISO)

4,6-dioxoheptanoic acid (EXP)

4-hydroxy-TEMPO (EXP,ISO)

4-Hydroxybenzyl isothiocyanate (ISO)

4-hydroxyestrone (ISO)

4-hydroxynon-2-enal (EXP,ISO)

4-hydroxyphenyl retinamide (EXP,ISO)

4-methylcatechol (ISO)

4-nitrobenzaldehyde (EXP)

4-phenylbutyric acid (EXP,ISO)

5-aminolevulinic acid (EXP)

5-aza-2'-deoxycytidine (EXP,ISO)

5-fluorouracil (EXP,ISO)

5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole (ISO)

6-(4-chlorophenyl)imidazo[2,1-b][1,3]thiazole-5-carbaldehyde O-(3,4-dichlorobenzyl)oxime (EXP)

6-chloro-2,3,4,9-tetrahydro-1H-carbazole-1-carboxamide (EXP,ISO)

6-propyl-2-thiouracil (ISO)

6alpha-methylprednisolone (ISO)

7,12-dimethyltetraphene (EXP,ISO)

7,8-dihydroxycoumarin (ISO)

7,9-dihydro-1H-purine-2,6,8(3H)-trione (EXP)

8-(4-chlorophenylthio)-cAMP (EXP)

9,10-phenanthroquinone (ISO)

9-cis-retinoic acid (ISO)

[6]-Shogaol (EXP,ISO)

abamectin (ISO)

acetic acid (ISO)

acrolein (EXP,ISO)

acrylamide (EXP,ISO)

actinomycin D (ISO)

Aescin (EXP,ISO)

aflatoxin B1 (EXP,ISO)

AL 8810 (ISO)

alachlor (ISO)

aldehydo-D-glucose (EXP,ISO)

aldosterone (ISO)

all-trans-retinal (ISO)

all-trans-retinoic acid (EXP,ISO)

allethrin (ISO)

allicin (ISO)

alloxan (ISO)

allyl isothiocyanate (EXP,ISO)

allyl methyl disulfide (EXP)

alogliptin (ISO)

alpha-D-galactose (EXP,ISO)

alpha-linolenic acid (ISO)

alpha-pinene (ISO)

alternariol (ISO)

Altertoxin II (ISO)

aluminium atom (ISO)

aluminium hydroxide (ISO)

aluminium(0) (ISO)

aminoguanidine (ISO)

amiodarone (ISO)

amitraz (ISO)

amlexanox (EXP)

ammonia (EXP)

ammonium chloride (ISO)

Ammothamnine (EXP,ISO)

amphetamine (ISO)

andrographolide (EXP,ISO)

anethole (ISO)

angelica lactone (EXP)

angiotensin II (EXP)

anthra[1,9-cd]pyrazol-6(2H)-one (EXP,ISO)

anthranilic acid (EXP)

antimycin A (ISO)

apigenin (ISO)

apocynin (ISO)

aprepitant (ISO)

arachidonic acid (ISO)

arachidonyl-2'-chloroethylamide (EXP)

aristolochic acid A (EXP,ISO)

aristolochic acids (ISO)

Aroclor 1254 (EXP,ISO)

arsane (EXP,ISO)

arsenic acid (EXP)

arsenic atom (EXP,ISO)

arsenic trichloride (EXP,ISO)

arsenite(3-) (EXP,ISO)

arsenous acid (EXP,ISO)

artesunate (ISO)

asperuloside (EXP)

astaxanthin (EXP,ISO)

astilbin (EXP,ISO)

astragaloside IV (EXP)

Atipamezole (ISO)

atorvastatin calcium (EXP,ISO)

ATP (ISO)

atrazine (EXP,ISO)

auranofin (ISO)

auraptene (EXP)

aureusidin (ISO)

azathioprine (EXP)

Azoxymethane (EXP)

bafilomycin A1 (ISO)

baicalin (EXP)

BAPTA (ISO)

Bardoxolone methyl (EXP,ISO)

bathocuproine disulfonic acid (ISO)

bendiocarb (ISO)

benfotiamine (EXP)

benzene (EXP)

benzo[a]pyrene (EXP,ISO)

benzo[a]pyrene diol epoxide I (ISO)

Benzo[k]fluoranthene (EXP)

benzopyran (ISO)

benzoquinones (EXP)

benzyl isothiocyanate (EXP,ISO)

beraprost (EXP)

berberine (EXP,ISO)

Bergenin (EXP,ISO)

beta-carboline (ISO)

beta-naphthoflavone (ISO)

beta-propiolactone (EXP)

beta-tocopherol (ISO)

Betanin (ISO)

betulin (ISO)

bezafibrate (EXP)

bifenthrin (ISO)

bilirubin IXalpha (EXP)

biochanin A (EXP)

biphenyl-4-amine (EXP)

bis(2-chloroethyl) sulfide (EXP)

bis(2-ethylhexyl) phthalate (EXP,ISO)

bisdemethoxycurcumin (EXP)

bisphenol A (EXP,ISO)

Bisphenol A diglycidyl ether (ISO)

bisphenol AF (EXP)

bisphenol F (EXP,ISO)

bixin (ISO)

bleomycin A2 (EXP,ISO)

boric acid (EXP,ISO)

bortezomib (ISO)

brefeldin A (ISO)

bromobenzene (EXP,ISO)

Bromochloroacetonitrile (ISO)

bromocriptine (ISO)

bromosulfophthalein (EXP)

Brusatol (ISO)

bucladesine (EXP)

buspirone (ISO)

busulfan (EXP,ISO)

but-2-en-4-olide (ISO)

butane-2,3-dione (ISO)

butein (ISO)

butylated hydroxyanisole (EXP,ISO)

Butylbenzyl phthalate (EXP)

butyric acid (EXP,ISO)

C.I. Natural Red 20 (EXP)

cadmium acetate (ISO)

cadmium atom (EXP,ISO)

cadmium dichloride (EXP,ISO)

cadmium telluride (ISO)

cafestol (EXP,ISO)

caffeine (ISO)

calciol (EXP,ISO)

calcitriol (EXP,ISO)

calcium atom (EXP)

calcium(0) (EXP)

calycosin (ISO)

calyculin a (EXP)

camphor (ISO)

camptothecin (ISO)

cannabidiol (ISO)

capsaicin (ISO)

carbamazepine (ISO)

carbendazim (ISO)

carbimazole (ISO)

carbon disulfide (ISO)

carbon monoxide (EXP,ISO)

carfilzomib (ISO)

carmustine (EXP)

carnosic acid (ISO)

Carnosol (EXP,ISO)

carrageenan (ISO)

carteolol (ISO)

carvacrol (ISO)

catalpol (EXP,ISO)

CCCP (ISO)

cefuroxime (EXP)

celastrol (EXP,ISO)

ceric oxide (ISO)

cerium (ISO)

ceruletide (EXP)

chalcone (ISO)

chalcones (ISO)

chenodeoxycholic acid (EXP,ISO)

chitosan (ISO)

chlorambucil (EXP,ISO)

chlormidazole (ISO)

chloroacetaldehyde (ISO)

Chloroacetonitrile (ISO)

chlorogenic acid (EXP,ISO)

chloropicrin (ISO)

chlorpromazine (ISO)

chlorpyrifos (EXP,ISO)

cholesterol (ISO)

cholic acid (EXP)

choline (EXP)

chromium atom (ISO)

chromium(6+) (EXP,ISO)

chrysin (ISO)

cidofovir anhydrous (ISO)

cilostazol (ISO)

cinnamyl alcohol (ISO)

ciprofibrate (EXP)

cisplatin (EXP,ISO)

citraconic acid (EXP,ISO)

clodronic acid (ISO)

clofibrate (EXP,ISO)

clorgyline (ISO)

clozapine (ISO)

cobalt atom (EXP,ISO)

cobalt dichloride (ISO)

cocaine (EXP)

coenzyme Q10 (EXP,ISO)

colistin (EXP,ISO)

coniferyl aldehyde (EXP,ISO)

copper atom (EXP,ISO)

copper(0) (EXP,ISO)

copper(II) sulfate (EXP,ISO)

cordycepin (EXP,ISO)

corilagin (EXP)

corn oil (EXP)

cortisol (ISO)

cortisone (ISO)

corynoline (EXP)

coumarin (EXP)

creatinine (EXP)

crocin-1 (ISO)

crotonaldehyde (ISO)

cumene hydroperoxide (EXP,ISO)

Cuprizon (ISO)

curcumin (EXP,ISO)

cyanidin cation (EXP,ISO)

cyanocob(III)alamin (EXP,ISO)

cycloheximide (EXP,ISO)

cyclophosphamide (EXP,ISO)

cyclosporin A (EXP,ISO)

cyfluthrin (ISO)

cyhalothrin (ISO)

cylindrospermopsin (EXP)

Cynaropicrin (ISO)

cypermethrin (EXP,ISO)

cyproconazole (EXP)

cyproterone acetate (EXP)

D-glucose (EXP,ISO)

D-penicillamine (ISO)

dapagliflozin (ISO)

dazomet (ISO)

DDE (ISO)

DDT (ISO)

decabromodiphenyl ether (EXP,ISO)

delta-tocopherol (ISO)

demethoxycurcumin (EXP)

Dendrobine (ISO)

deoxycholic acid (EXP,ISO)

deoxynivalenol (EXP,ISO)

desferrioxamine B (EXP,ISO)

desipramine (ISO)

dexamethasone (EXP,ISO)

dexmedetomidine (ISO)

dextran sulfate (EXP)

dextromethorphan (EXP)

Di-n-octyl phthalate (EXP,ISO)

diallyl disulfide (EXP,ISO)

Diallyl sulfide (EXP,ISO)

diallyl trisulfide (EXP,ISO)

diarsenic trioxide (EXP,ISO)

dibenziodolium (ISO)

dibenzofurans (EXP)

Dibromoacetonitrile (ISO)

Dibutyl phosphate (ISO)

dibutyl phthalate (EXP,ISO)

dichloroacetic acid (EXP)

Dichloroacetonitrile (ISO)

dichloroacetyl chloride (EXP)

dichloromethane (EXP,ISO)

dichlorvos (EXP,ISO)

diclofenac (ISO)

dicyclanil (EXP)

diethyl maleate (EXP,ISO)

diethyl phthalate (EXP)

diethylstilbestrol (ISO)

dihydroactinidiolide (ISO)

dihydroartemisinin (ISO)

dihydrolipoic acid (ISO)

dihydroxyacetone (ISO)

diisobutyl phthalate (EXP)

Diisodecyl phthalate (EXP)

diisononyl phthalate (EXP)

Dimerumic acid (EXP)

dimethomorph (ISO)

dimethyl fumarate (EXP,ISO)

dimethyl sulfoxide (EXP,ISO)

dimethylarsinic acid (ISO)

dioscin (EXP,ISO)

diosmetin (ISO)

dioxygen (EXP,ISO)

diphenyl diselenide (ISO)

diprotium oxide (EXP)

diquat (EXP,ISO)

disodium selenite (EXP,ISO)

dithionite(2-) (ISO)

diuron (ISO)

dorsomorphin (EXP,ISO)

doxorubicin (EXP,ISO)

echinacoside (ISO)

edaravone (EXP,ISO)

elemental selenium (EXP,ISO)

ellagic acid (EXP,ISO)

emodin (EXP,ISO)

enalapril (ISO)

endosulfan (ISO)

epalrestat (EXP,ISO)

epoxiconazole (EXP)

epoxomicin (EXP,ISO)

erastin (EXP,ISO)

erdosteine (EXP,ISO)

ergosta-4,6,8(14),22-tetraen-3-one (ISO)

eriodictyol (ISO)

erythromycin A (ISO)

esculetin (ISO)

etacrynic acid (EXP,ISO)

ethanol (EXP,ISO)

ethionamide (ISO)

ethoxyquin (EXP,ISO)

Ethyl phenylglycidate (EXP)

ethylene glycol bis(2-aminoethyl)tetraacetic acid (ISO)

ethylene glycol dimethacrylate (ISO)

etoposide (ISO)

eugenol (ISO)

falcarindiol (ISO)

farnesol (ISO)

farrerol (EXP)

fenofibrate (EXP,ISO)

fenpyroximate (ISO)

fenvalerate (ISO)

ferroheme b (ISO)

ferrostatin-1 (EXP,ISO)

ferulic acid (EXP,ISO)

fisetin (EXP,ISO)

flufenacet (ISO)

fluoranthene (EXP)

fluorescein 5-isothiocyanate (EXP)

fluoxastrobin (ISO)

fluoxetine (EXP,ISO)

flutamide (ISO)

flutriafol (ISO)

fluvastatin (ISO)

folic acid (EXP,ISO)

formaldehyde (EXP)

formetanate (ISO)

formononetin (EXP,ISO)

Forsythiaside (EXP)

fructose (EXP,ISO)

fulvestrant (ISO)

fumonisin B1 (EXP,ISO)

furan (EXP)

furazolidone (ISO)

furosemide (EXP)

Fusaric acid (ISO)

gadolinium atom (ISO)

gadolinium trichloride (ISO)

galactose (EXP,ISO)

galangin (ISO)

galanthamine (ISO)

galanthamine Trifluoroacetic acid (ISO)

gallic acid (ISO)

gallium nitrate (ISO)

gallocatechin (ISO)

gamma-hexachlorocyclohexane (ISO)

gamma-tocopherol (EXP,ISO)

Gastrodin (EXP,ISO)

gemcitabine (ISO)

Genipin (EXP)

genistein (EXP,ISO)

gentamycin (ISO)

Geraniin (EXP)

geraniol (ISO)

Gingerenone A (EXP,ISO)

ginkgolide B (EXP,ISO)

Ginkgolide C (ISO)

ginsenoside Rb1 (EXP,ISO)

ginsenoside Rg1 (EXP,ISO)

Ginsenoside Rh4 (EXP,ISO)

gliclazide (ISO)

glucoraphanin (ISO)

glucose (EXP,ISO)

glutathione (EXP,ISO)

glutathione disulfide (EXP)

Glutathione ethyl ester (EXP)

glyburide (ISO)

glycine betaine (EXP,ISO)

glycogen (EXP)

glycyrrhetinate (EXP,ISO)

glycyrrhetinic acid (EXP,ISO)

glyphosate (ISO)

gold atom (ISO)

gold(0) (ISO)

gossypin (ISO)

guggulsterone (EXP)

GW 501516 (EXP)

harman (ISO)

heme b (ISO)

hemin (EXP,ISO)

heparin (ISO)

hesperetin (EXP,ISO)

hesperidin (ISO)

hexachlorobenzene (EXP)

hexadecanoic acid (EXP,ISO)

homocysteine (EXP,ISO)

homoeriodictyol (ISO)

hydrogen chloride (EXP,ISO)

hydrogen peroxide (EXP,ISO)

hydrogen sulfide (EXP,ISO)

hydroquinone (EXP,ISO)

hydroquinone O-beta-D-glucopyranoside (ISO)

hydroquinones (ISO)

hydroxysafflor yellow A (EXP)

hydroxyurea (ISO)

hypochlorous acid (EXP,ISO)

hypoxanthine (EXP)

iberin (ISO)

ibuprofen (ISO)

ifosfamide (ISO)

Ile(5)-angiotensin II (EXP)

imidacloprid (ISO)

imperatorin (EXP)

indirubin (ISO)

indole-3-methanol (EXP,ISO)

indolin-2-one (ISO)

indoline (ISO)

indometacin (EXP,ISO)

inositol (ISO)

iodoform (EXP)

ionomycin (EXP,ISO)

irinotecan (ISO)

iron atom (EXP,ISO)

iron dextran (ISO)

iron dichloride (EXP)

iron trichloride (ISO)

iron(0) (EXP,ISO)

iron(2+) sulfate (anhydrous) (ISO)

iron(III) citrate (ISO)

iron(III) nitrilotriacetate (EXP)

isoflurane (EXP,ISO)

isoimperatorin (ISO)

isoliquiritigenin (EXP)

isoniazide (EXP,ISO)

isophorone diisocyanate (EXP)

isoprenaline (ISO)

isorhamnetin (EXP,ISO)

Isosorbide (ISO)

isothiocyanate (EXP)

kaempferol (EXP,ISO)

kahweol (EXP,ISO)

kainic acid (EXP)

ketamine (ISO)

ketanserin (ISO)

ketoconazole (ISO)

kresoxim-methyl (ISO)

KT 5823 (ISO)

L-1,4-dithiothreitol (ISO)

L-ascorbic acid (EXP,ISO)

L-cystine (EXP)

L-glutamic acid (EXP,ISO)

L-methionine (EXP)

lactacystin (EXP,ISO)

lactulose (ISO)

lansoprazole (ISO)

lanthanum trichloride (EXP)

lapatinib (ISO)

lawsone (ISO)

lead diacetate (EXP,ISO)

lead(0) (EXP,ISO)

lead(II) chloride (EXP,ISO)

leflunomide (ISO)

lenvatinib (ISO)

Leonurine (ISO)

letrozole (ISO)

levetiracetam (ISO)

levofloxacin (ISO)

Liensinine (EXP,ISO)

linagliptin (ISO)

linalool (ISO)

linalyl acetate (ISO)

linoleic acid (EXP,ISO)

linsidomine (EXP,ISO)

lipoamide (ISO)

lipoic acid (EXP,ISO)

lipopolysaccharide (EXP,ISO)

lipoxin A4 (ISO)

liquiritigenin (EXP,ISO)

liquiritin (EXP,ISO)

liraglutide (ISO)

lithium atom (EXP,ISO)

lithium chloride (ISO)

lithium hydride (EXP,ISO)

lithocholic acid (EXP,ISO)

lixisenatide (ISO)

loganin (EXP)

loliolide (ISO)

losartan (EXP,ISO)

lovastatin (EXP)

Lucidone (ISO)

lutein (EXP,ISO)

luteolin (EXP,ISO)

Luteolin 7-methyl ether (ISO)

LY294002 (EXP,ISO)

lycopene (EXP,ISO)

Macrosphelide B (EXP)

magnesium dichloride (ISO)

malathion (EXP)

maleic acid (ISO)

malonaldehyde (EXP,ISO)

malvidin (EXP,ISO)

maneb (EXP,ISO)

manganese atom (EXP,ISO)

manganese(0) (EXP,ISO)

manganese(II) chloride (EXP,ISO)

mangiferin (ISO)

masoprocol (ISO)

mechlorethamine (EXP)

medroxyprogesterone acetate (ISO)

meglumine amidotrizoate (ISO)

MeIQx (ISO)

melatonin (EXP,ISO)

meloxicam (ISO)

menadione (EXP,ISO)

mercury atom (EXP,ISO)

mercury dibromide (ISO)

mercury dichloride (EXP,ISO)

mercury(0) (EXP,ISO)

mesalamine (ISO)

metformin (EXP,ISO)

methamphetamine (EXP,ISO)

methotrexate (ISO)

methoxyacetic acid (ISO)

methyl 3,4,5-trihydroxybenzoate (EXP)

methyl methanesulfonate (EXP)

methylarsonic acid (ISO)

methylene blue (EXP,ISO)

methylglyoxal (EXP,ISO)

methylisothiazolinone (ISO)

methyllycaconitine (ISO)

methylmercury chloride (EXP,ISO)

methylparaben (ISO)

Methysticin (EXP)

metolachlor (ISO)

metrafenone (ISO)

mevalonic acid (ISO)

micafungin (EXP,ISO)

microcystin-LR (EXP,ISO)

mifepristone (ISO)

mirtazapine (ISO)

MK-2206 (ISO)

monascin (ISO)

mono(2-ethylhexyl) phthalate (EXP,ISO)

Monobutylphthalate (ISO)

monocrotaline (EXP,ISO)

monocrotophos (ISO)

monosodium L-glutamate (EXP)

morin (ISO)

Morroniside (EXP)

myo-inositol hexakisphosphate (ISO)

myricetin (ISO)

N'-(2,4-dimethylphenyl)-N-methylformamidine (ISO)

N,N-diethyl-m-toluamide (ISO)

N,N-dimethylformamide (EXP,ISO)

N-(1-naphthyl)ethylenediamine (EXP)

N-[2-(4-bromocinnamylamino)ethyl]isoquinoline-5-sulfonamide (ISO)

N-acetyl-1,4-benzoquinone imine (EXP)

N-acetyl-L-cysteine (EXP,ISO)

N-acetylsphingosine (ISO)

N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (EXP,ISO)

N-methyl-4-phenylpyridinium (EXP,ISO)

N-methylnicotinate (EXP,ISO)

N-Methylolacrylamide (EXP)

N-nitrosodiethylamine (EXP,ISO)

N-nitrosodimethylamine (EXP,ISO)

N-phosphocreatine (ISO)

N-tosyl-L-phenylalanyl chloromethyl ketone (EXP)

N1'-[2-[[5-[(dimethylamino)methyl]-2-furanyl]methylthio]ethyl]-N1-methyl-2-nitroethene-1,1-diamine (ISO)

NADP zwitterion (EXP)

NADP(+) (EXP)

naphthalene (EXP)

naphthalene-1,2-diol (ISO)

naphthalene-1,5-diamine (EXP)

naringin (EXP,ISO)

nebivolol (EXP)

nefazodone (ISO)

neoastilbin (EXP,ISO)

nickel dichloride (ISO)

nickel sulfate (EXP,ISO)

nicorandil (ISO)

nicotinamide (EXP,ISO)

nifedipine (ISO)

nilotinib (ISO)

nimesulide (EXP,ISO)

nitrites (EXP,ISO)

nitrofurantoin (ISO)

nitrogen mustard (ISO)

nitroprusside (EXP,ISO)

nobiletin (ISO)

Nonylphenol (ISO)

notoginsenoside R1 (EXP,ISO)

NSC 23766 (EXP)

obeticholic acid (EXP,ISO)

ochratoxin A (EXP,ISO)

octadecanoic acid (ISO)

okadaic acid (ISO)

olanzapine (EXP)

oleanolic acid (EXP,ISO)

oleic acid (EXP,ISO)

Olmesartan medoxomil (ISO)

oltipraz (EXP,ISO)

omeprazole (ISO)

Ophiopogonin D (ISO)

orlistat (ISO)

oxaliplatin (ISO)

oxazepam (EXP)

oxidopamine (EXP,ISO)

Oxyfluorfen (ISO)

ozone (EXP,ISO)

p-chloromercuribenzoic acid (ISO)

p-cresol (ISO)

paclitaxel (ISO)

paeoniflorin (EXP,ISO)

Palbinone (ISO)

pallidol (ISO)

palmatine (EXP)

panobinostat (ISO)

paracetamol (EXP,ISO)

paraquat (EXP,ISO)

parathion-methyl (EXP)

pazopanib (ISO)

pelargonidin (EXP)

pentachloronitrobenzene (EXP)

perfluorobutanesulfonic acid (EXP,ISO)

perfluorodecanoic acid (EXP,ISO)

perfluorohexanesulfonic acid (EXP,ISO)

perfluorohexanoic acid (ISO)

perfluorononanoic acid (EXP,ISO)

perfluorooctane-1-sulfonic acid (EXP,ISO)

perfluorooctanesulfonamide (ISO)

perfluorooctanoic acid (EXP,ISO)

perfluoroundecanoic acid (EXP)

perillyl aldehyde (ISO)

permethrin (ISO)

peroxides (EXP)

pevonedistat (EXP)

phalloidin (EXP)

phenacetin (EXP)

phenanthrene (EXP)

phenethyl caffeate (EXP,ISO)

phenethyl isothiocyanate (EXP,ISO)

phenformin (EXP)

phenobarbital (EXP,ISO)

Phenyl glycidyl ether (ISO)

phenylarsine oxide (EXP)

phenylhydrazine (EXP)

phenylmercury acetate (ISO)

PhIP (ISO)

phloretin (EXP)

phlorizin (EXP)

phlorizin chalcone (ISO)

phorbol 13-acetate 12-myristate (ISO)

phorone (EXP)

phoxim (ISO)

phytoestrogen (ISO)

picolinic acid (ISO)

picoxystrobin (ISO)

pioglitazone (ISO)

piperonyl butoxide (EXP)

pipoxolan (EXP)

pirinixic acid (EXP)

platycodin D (ISO)

plumbagin (ISO)

poly(ethylene) (EXP)

poly(vinyl chloride) (EXP)

polysulfur (ISO)

porphyrins (ISO)

Potassium 2,6-dihydroxytriazinecarboxylate (EXP)

potassium dichromate (EXP,ISO)

potassium iodide (ISO)

prazosin (EXP)

prednisolone (EXP)

pregnenolone (EXP)

pregnenolone 16alpha-carbonitrile (EXP)

probucol (EXP,ISO)

procyanidin (EXP)

procyanidin B1 (ISO)

procyanidin B2 (ISO)

prodigiosin (ISO)

progesterone (ISO)

propacetamol (EXP)

propiconazole (EXP)

prostaglandin E2 (EXP)

prostaglandin J2 (ISO)

psoralen (ISO)

pterostilbene (EXP,ISO)

puerarin (EXP,ISO)

Punicalagin (ISO)

pyocyanine (EXP,ISO)

pyrene (EXP)

pyrethrins (ISO)

pyridaben (ISO)

Pyridostigmine bromide (ISO)

pyrogallol (ISO)

pyrrolidine dithiocarbamate (ISO)

quercetin (EXP,ISO)

quercetin 3-O-beta-D-galactopyranoside (EXP)

quercetin 3-O-beta-D-glucofuranoside (ISO)

quercetin 3-O-beta-D-glucopyranoside (ISO)

quercetin 4'-O-beta-D-glucopyranoside (ISO)

quinolin-8-ol (ISO)

quinolinic acid (ISO)

quinoxyfen (ISO)

rac-1,2-dichloropropane (EXP)

radon atom (EXP)

radon(0) (EXP)

ranitidine (ISO)

raspberry ketone (EXP)

reactive oxygen species (EXP,ISO)

rebaudioside A (ISO)

reserpine (EXP)

resolvin D1 (EXP,ISO)

resorcinol (ISO)

resveratrol (EXP,ISO)

Rhynchophylline (EXP)

rifampicin (EXP,ISO)

rimonabant (ISO)

ritonavir (ISO)

roflumilast (ISO)

rosmarinic acid (ISO)

rosuvastatin calcium (ISO)

rotenone (EXP,ISO)

rottlerin (EXP,ISO)

royal jelly (ISO)

Ruscogenin (EXP)

Rutecarpine (ISO)

rutin (EXP,ISO)

S-adenosyl-L-methioninate (ISO)

S-adenosyl-L-methionine (ISO)

S-allylcysteine (ISO)

S-butyl-DL-homocysteine (S,R)-sulfoximine (EXP,ISO)

sabinene (ISO)

Salinomycin (EXP)

salvianolic acid B (EXP,ISO)

saxagliptin (ISO)

SB 203580 (EXP,ISO)

SB 431542 (ISO)

SCH 23390 (ISO)

SCH772984 (ISO)

scopolamine (EXP,ISO)

scutellarin (EXP)

sebacic acid (EXP)

selenium atom (EXP,ISO)

selenocystine (ISO)

selenomethionine (EXP)

sertraline (ISO)

sesquiterpene (EXP,ISO)

sevoflurane (EXP,ISO)

Shikonin (EXP)

silibinin (ISO)

silicon atom (EXP,ISO)

silicon dioxide (EXP,ISO)

silver atom (ISO)

silver(0) (ISO)

silver(1+) nitrate (ISO)

simvastatin (EXP,ISO)

sinapic acid (ISO)

Siomycin A (ISO)

sirolimus (EXP,ISO)

sirtinol (ISO)

SL-327 (EXP)

sodium arsenate (EXP,ISO)

sodium arsenite (EXP,ISO)

sodium cholate (EXP)

sodium dichromate (EXP,ISO)

sodium fluoride (EXP,ISO)

Sodium oleate (ISO)

sodium selenide (ISO)

sodium sulfide (anhydrous) (ISO)

solanesol (ISO)

Soman (ISO)

spathulenol (ISO)

spermidine (EXP)

spermine (EXP)

spironolactone (ISO)

staurosporine (ISO)

sterigmatocystin (ISO)

streptozocin (EXP,ISO)

succimer (EXP,ISO)

sulfaphenazole (ISO)

sulfasalazine (ISO)

sulfluramid (ISO)

sulforaphane (EXP,ISO)

sulfur atom (ISO)

sunitinib (EXP,ISO)

surfactin (ISO)

surfactin C (ISO)

T-2 toxin (EXP,ISO)

tacrolimus hydrate (EXP)

tadalafil (ISO)

tamibarotene (ISO)

tangeretin (EXP,ISO)

Tanshinone I (EXP,ISO)

taurocholic acid (EXP)

tectorigenin (EXP)

terbinafine (ISO)

terephthalic acid (ISO)

tert-butyl hydroperoxide (EXP,ISO)

testosterone (EXP)

tetrachloromethane (EXP,ISO)

tetramethylpyrazine (EXP,ISO)

tetrathiomolybdate(2-) (ISO)

thalidomide (EXP)

thapsigargin (ISO)

Theaflavin 3,3'-digallate (EXP,ISO)

thiamine(1+) chloride (EXP)

thiazoles (ISO)

thimerosal (ISO)

thioacetamide (EXP,ISO)

thiram (ISO)

thymoquinone (ISO)

tideglusib (ISO)

Tiron (EXP,ISO)

titanium dioxide (EXP)

tolcapone (ISO)

tolterodine tartrate (ISO)

toluquinol (ISO)

torcetrapib (ISO)

trabectedin (ISO)

trans-anethole (ISO)

trans-chalcone (ISO)

trans-piceid (EXP,ISO)

trans-rhaponticin (ISO)

triadimefon (EXP)

tributylstannane (EXP,ISO)

Tributyltin oxide (EXP,ISO)

tricalcium bis(phosphate) (EXP)

tricetin (ISO)

trichlorfon (ISO)

Trichloroacetonitrile (ISO)

trichloroethene (EXP)

trichostatin A (EXP,ISO)

triclocarban (ISO)

triclosan (EXP)

trifloxystrobin (ISO)

trifluridine (ISO)

trilobatin (EXP,ISO)

trimellitic anhydride (EXP)

trimethylarsine oxide (ISO)

trimethyltin (EXP)

triphenyl phosphate (ISO)

Triptolide (EXP,ISO)

Tris(2,3-dibromopropyl) phosphate (EXP)

troglitazone (ISO)

tropisetron (ISO)

tubastatin A (ISO)

Tungsten carbide (EXP)

tunicamycin (EXP,ISO)

tyrphostin AG 1478 (ISO)

umbelliferone (ISO)

undecan-2-one (EXP,ISO)

ursodeoxycholic acid (EXP,ISO)

usnic acid (ISO)

valproic acid (EXP,ISO)

vancomycin (ISO)

verapamil (ISO)

vincamine (EXP)

vinclozolin (EXP,ISO)

vincristine (ISO)

Vinpocetine (ISO)

vitamin D (EXP,ISO)

vitamin E (EXP,ISO)

vitexin (EXP)

vorinostat (ISO)

water (EXP)

wedelolactone (EXP)

withaferin A (EXP,ISO)

Withanone (ISO)

wortmannin (ISO)

xanthohumol (ISO)

yttrium chloride (ISO)

zearalenone (EXP)

zidovudine (ISO)

zinc atom (EXP,ISO)

zinc dichloride (EXP,ISO)

zinc oxide (EXP,ISO)

zinc protoporphyrin (ISO)

zinc pyrithione (EXP)

zinc(0) (EXP,ISO)

zingerone (ISO)

ziram (ISO)

zoledronic acid (ISO)

zoxamide (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

aflatoxin catabolic process (IEA,ISO)

cell redox homeostasis (IMP,ISO,ISS)

cellular response to angiotensin (IEA,ISO)

cellular response to copper ion (IMP)

cellular response to fluid shear stress (ISO,ISS)

cellular response to glucose starvation (IMP)

cellular response to hydrogen peroxide (IEA,ISO)

cellular response to hypoxia (IEA,ISO)

cellular response to laminar fluid shear stress (IEA,ISO)

cellular response to methionine (IEA,ISO)

cellular response to oxidative stress (IBA,IDA,IMP)

cellular response to tumor necrosis factor (IEA,ISO)

cellular response to xenobiotic stimulus (IMP)

endoplasmic reticulum unfolded protein response (IDA)

inflammatory response (IMP)

negative regulation of cardiac muscle cell apoptotic process (IEA,ISO)

negative regulation of cellular process (ISO)

negative regulation of cellular response to hypoxia (IEA,ISO)

negative regulation of endothelial cell apoptotic process (IEA,ISO)

negative regulation of ferroptosis (ISO,ISS)

negative regulation of hematopoietic stem cell differentiation (IMP)

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway (IEA,ISO)

negative regulation of vascular associated smooth muscle cell migration (IEA,ISO)

PERK-mediated unfolded protein response (IDA)

positive regulation of angiogenesis (IEA,ISO)

positive regulation of blood coagulation (IMP)

positive regulation of blood vessel endothelial cell migration (IEA,ISO)

positive regulation of D-glucose import (IDA)

positive regulation of DNA-templated transcription (IDA,IGI,ISO)

positive regulation of gene expression (IGI,ISO)

positive regulation of glutathione biosynthetic process (IMP)

positive regulation of neuron projection development (IEA,ISO)

positive regulation of reactive oxygen species metabolic process (IMP)

positive regulation of transcription by RNA polymerase II (IDA,IMP,ISO)

proteasomal ubiquitin-independent protein catabolic process (ISO,ISS)

proteasome-mediated ubiquitin-dependent protein catabolic process (ISO,ISS)

protein ubiquitination (ISO,ISS)

reactive oxygen species metabolic process (IMP)

regulation of cellular response to oxidative stress (ISO)

regulation of DNA-templated transcription (IDA)

regulation of embryonic development (IGI)

regulation of innate immune response (IMP)

regulation of removal of superoxide radicals (IMP)

regulation of transcription by RNA polymerase II (IBA)

response to endoplasmic reticulum stress (IMP)

response to ischemia (IEA,ISO)

response to oxidative stress (ISO)

response to xenobiotic stimulus (ISO)

Cellular Component

centrosome (IEA,ISO)

chromatin (IDA)

ciliary basal body (IEA)

cytoplasm (IDA,IPI,ISO,TAS)

cytosol (IDA,IPI,ISO,TAS)

Golgi apparatus (IEA,ISO)

mediator complex (ISO)

nucleoplasm (ISO,TAS)

nucleus (IBA,IDA,ISO)

plasma membrane (IEA,ISO)

protein-DNA complex (IDA)

RNA polymerase II transcription regulator complex (IEA,ISO)

transcription regulator complex (TAS)

Molecular Function

DNA binding (IDA,ISO)

DNA-binding transcription activator activity, RNA polymerase II-specific (IDA,ISO)

DNA-binding transcription factor activity (IDA,ISO)

DNA-binding transcription factor activity, RNA polymerase II-specific (IBA)

molecular condensate scaffold activity (IEA,ISO)

protein binding (IPI,ISO)

protein domain specific binding (IEA,ISO)

RNA polymerase II cis-regulatory region sequence-specific DNA binding (IBA,IDA)

RNA polymerase II-specific DNA-binding transcription factor binding (IEA,ISO)

sequence-specific DNA binding (IDA,ISO)

transcription cis-regulatory region binding (IDA,ISO)

transcription coregulator binding (IEA,ISO)

ubiquitin protein ligase binding (IEA,ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

Endoplasmic Reticulum-associated degradation pathway (IEA)

nuclear factor, erythroid 2 like 2 signaling pathway (ISO)

oxidative stress response pathway (ISO)

Phenotype Annotations Click to see Annotation Detail View

Mammalian Phenotype

abnormal adipose tissue development (IAGP)

abnormal aorta morphology (IAGP)

abnormal behavior (IAGP)

abnormal cell death (IAGP)

abnormal enamel morphology (IAGP)

abnormal enzyme/coenzyme activity (IAGP)

abnormal enzyme/coenzyme level (IAGP)

abnormal erythrocyte physiology (IAGP)

abnormal glomerular capillary morphology (IAGP)

abnormal glomerular mesangium morphology (IAGP)

abnormal hepatocyte morphology (IAGP)

abnormal incisor color (IAGP)

abnormal iron homeostasis (IAGP)

abnormal iron level (IAGP)

abnormal leukocyte adhesion (IAGP)

abnormal lipid homeostasis (IAGP)

abnormal liver physiology (IAGP)

abnormal lymph node morphology (IEA)

abnormal macrophage physiology (IAGP)

abnormal male germ cell morphology (IAGP)

abnormal myelin sheath morphology (IAGP)

abnormal neutrophil physiology (IAGP)

abnormal ovary morphology (IEA)

abnormal ovary physiology (IAGP)

abnormal periodontal ligament morphology (IAGP)

abnormal physiological response to xenobiotic (IAGP)

abnormal renal glomerulus morphology (IAGP)

abnormal respiratory system physiology (IAGP)

abnormal seminal vesicle morphology (IEA)

abnormal seminiferous tubule morphology (IAGP)

abnormal skin morphology (IEA)

abnormal spermatogenesis (IAGP)

abnormal spleen physiology (IAGP)

abnormal splenocyte physiology (IAGP)

abnormal testis morphology (IEA)

abnormal thymus morphology (IEA)

abnormal tooth color (IAGP)

abnormal tooth morphology (IAGP)

abnormal urine color (IAGP)

abnormal white fat cell morphology (IAGP)

abnormal xenobiotic pharmacokinetics (IAGP)

acanthocytosis (IAGP)

alveolar process atrophy (IAGP)

ameloblast degeneration (IAGP)

anemia (IAGP)

anisocytosis (IAGP)

asthenozoospermia (IAGP)

astrocytosis (IAGP)

cachexia (IAGP)

circling (IAGP)

cystolithiasis (IAGP)

decreased body weight (IAGP)

decreased catalase level (IAGP)

decreased CD4-positive, alpha-beta T cell number (IAGP)

decreased circulating glucose level (IEA)

decreased circulating interleukin-1 beta level (IAGP)

decreased embryo size (IAGP)

decreased epididymis weight (IAGP)

decreased erythrocyte cell number (IAGP)

decreased food intake (IAGP)

decreased glutathione level (IAGP)

decreased glutathione peroxidase activity (IAGP)

decreased hematocrit (IAGP)

decreased hemoglobin content (IAGP)

decreased hepatocyte proliferation (IAGP)

decreased interleukin-1 beta secretion (IAGP)

decreased liver triglyceride level (IAGP)

decreased liver weight (IAGP)

decreased primordial ovarian follicle number (IAGP)

decreased survivor rate (IAGP)

decreased susceptibility to atherosclerosis (IAGP)

decreased susceptibility to weight gain (IAGP)

decreased T cell number (IAGP)

decreased tertiary ovarian follicle number (IAGP)

decreased testis weight (IAGP)

decreased tumor necrosis factor secretion (IAGP)

decreased urine creatinine level (IAGP)

decreased white adipose tissue amount (IAGP)

delayed liver regeneration (IAGP)

early reproductive senescence (IAGP)

embryonic growth retardation (IAGP)

embryonic lethality during organogenesis, complete penetrance (IAGP)

enlarged lung (IAGP)

enlarged lymph nodes (IAGP)

enlarged seminal vesicle (IEA)

enlarged spleen (IAGP)

enlarged thymus (IEA)

glomerular crescent (IAGP)

glomerulonephritis (IAGP)

glomerulosclerosis (IAGP)

hemolytic anemia (IAGP)

hepatic steatosis (IAGP)

hyperglycemia (IAGP)

hypoglycemia (IAGP)

increased acute inflammation (IAGP)

increased anti-double stranded DNA antibody level (IAGP)

increased anti-nuclear antigen antibody level (IAGP)

increased apoptosis (IAGP)

increased cellular sensitivity to hydrogen peroxide (IAGP)

increased cellular sensitivity to oxidative stress (IAGP)

increased cerebral infarct size (IAGP)

increased circulating alanine transaminase level (IAGP)

increased circulating alkaline phosphatase level (IEA)

increased circulating aspartate transaminase level (IEA)

increased circulating bilirubin level (IAGP)

increased circulating creatinine level (IEA)

increased circulating glucose level (IAGP)

increased circulating interleukin-1 beta level (IAGP)

increased circulating interleukin-6 level (IAGP)

increased circulating lactate dehydrogenase level (IEA)

increased circulating triglyceride level (IAGP)

increased circulating tumor necrosis factor level (IAGP)

increased fibroblast apoptosis (IAGP)

increased hepatocyte apoptosis (IAGP)

increased IgG level (IAGP)

increased IgM level (IAGP)

increased incidence of tumors by chemical induction (IAGP)

increased kidney cell proliferation (IAGP)

increased lactate dehydrogenase level (IAGP)

increased liver iron level (IAGP)

increased lung weight (IAGP)

increased macrophage cell number (IAGP)

increased male germ cell apoptosis (IAGP)

increased mean corpuscular hemoglobin (IEA)

increased mean corpuscular hemoglobin concentration (IEA)

increased mean platelet volume (IEA)

increased mesangial cell number (IAGP)

increased number of Howell-Jolly bodies (IAGP)

increased physiological sensitivity to xenobiotic (IAGP)

increased spleen weight (IAGP)

increased splenocyte apoptosis (IAGP)

increased stomach tumor incidence (IAGP)

increased susceptibility to experimental autoimmune uveoretinitis (IAGP)

increased susceptibility to hyperoxia-induced injury (IAGP)

increased susceptibility to induced colitis (IAGP)

increased susceptibility to ischemic brain injury (IAGP)

increased susceptibility to xenobiotic induced morbidity/mortality (IAGP)

increased urine protein level (IAGP)

insulin resistance (IAGP)

lethality at weaning, incomplete penetrance (IAGP)

liver degeneration (IAGP)

liver inflammation (IAGP)

lung hemorrhage (IAGP)

lung inflammation (IAGP)

macrovesicular hepatic steatosis (IAGP)

no abnormal phenotype detected (IAGP)

oligozoospermia (IAGP)

oxidative stress (IAGP)

pale liver (IAGP)

poikilocytosis (IAGP)

polyovular ovarian follicle (IAGP)

postnatal lethality, incomplete penetrance (IAGP)

premature death (IAGP)

pulmonary fibrosis (IAGP)

reduced male fertility (IAGP)

reticulocytosis (IAGP)

schistocytosis (IAGP)

seminiferous tubule degeneration (IAGP)

small testis (IEA)

spongiform encephalopathy (IAGP)

thrombocytopenia (IAGP)

weight loss (IAGP)

References

References - curated

#	Reference Title	Reference Citation
1.	Mast cell stabilizer modulates Sirt1/Nrf2/TNF pathway and inhibits oxidative stress, inflammation, and apoptosis in rat model of cyclophosphamide hepatotoxicity.	Abdelzaher WY, etal., Immunopharmacol Immunotoxicol. 2020 Feb 18:1-9. doi: 10.1080/08923973.2020.1727499.
2.	The molecular mechanism underlining the preventive effect of vitamin D against hepatic and renal acute toxicity through the NrF2/ BACH1/ HO-1 pathway.	Abo El-Magd NF and Eraky SM, Life Sci. 2020 Mar 1;244:117331. doi: 10.1016/j.lfs.2020.117331. Epub 2020 Jan 20.
3.	Expression of nuclear factor erythroid 2-related factor 2 (Nrf2) and peroxiredoxin 6 (Prdx6) proteins in healthy and pathologic placentas of human and rat.	Acar N, etal., Acta Histochem. 2014 Oct;116(8):1289-300. doi: 10.1016/j.acthis.2014.07.012. Epub 2014 Aug 27.
4.	Role of impaired Nrf2 activation in the pathogenesis of oxidative stress and inflammation in chronic tubulo-interstitial nephropathy.	Aminzadeh MA, etal., Nephrol Dial Transplant. 2013 Aug;28(8):2038-45. doi: 10.1093/ndt/gft022. Epub 2013 Mar 19.
5.	Alpha-lipoic acid upregulates antioxidant enzyme gene expression and enzymatic activity in diabetic rat kidneys through an O-GlcNAc-dependent mechanism.	Arambasic J, etal., Eur J Nutr. 2013 Aug;52(5):1461-73. doi: 10.1007/s00394-012-0452-z. Epub 2012 Oct 12.
6.	Reduction of hippocampal apoptosis by intracerebroventricular administration of extracellular signal-regulated protein kinase and/or p38 inhibitors in amyloid beta rat model of Alzheimer's disease: involvement of nuclear-related factor-2 and nuclear factor-kappaB.	Ashabi G, etal., Basic Clin Pharmacol Toxicol. 2013 Mar;112(3):145-55. doi: 10.1111/bcpt.12000. Epub 2012 Oct 5.
7.	Liver macrophages inhibit the endogenous antioxidant response in obesity-associated insulin resistance.	Azzimato V, etal., Sci Transl Med. 2020 Feb 26;12(532). pii: 12/532/eaaw9709. doi: 10.1126/scitranslmed.aaw9709.
8.	Prevention by sulforaphane of diabetic cardiomyopathy is associated with up-regulation of Nrf2 expression and transcription activation.	Bai Y, etal., J Mol Cell Cardiol. 2013 Apr;57:82-95. doi: 10.1016/j.yjmcc.2013.01.008. Epub 2013 Jan 23.
9.	Association between genetic polymorphisms of NRF2, KEAP1, MAFF, MAFK and anti-tuberculosis drug-induced liver injury: a nested case-control study.	Chen S, etal., Sci Rep. 2019 Oct 4;9(1):14311. doi: 10.1038/s41598-019-50706-y.
10.	Tussilagone, a major active component in Tussilago farfara, ameliorates inflammatory responses in dextran sulphate sodium-induced murine colitis.	Cheon HJ, etal., Chem Biol Interact. 2018 Oct 1;294:74-80. doi: 10.1016/j.cbi.2018.08.022. Epub 2018 Aug 22.
11.	Structural and functional characterization of Nrf2 degradation by glycogen synthase kinase 3/beta-TrCP.	Cuadrado A Free Radic Biol Med. 2015 Nov;88(Pt B):147-57. doi: 10.1016/j.freeradbiomed.2015.04.029. Epub 2015 Apr 30.
12.	A novel Danshensu derivative confers cardioprotection via PI3K/Akt and Nrf2 pathways.	Cui G, etal., Int J Cardiol. 2013 Sep 30;168(2):1349-59. doi: 10.1016/j.ijcard.2012.12.012. Epub 2013 Jan 4.
13.	Effectiveness of miltefosine treatment in targeting anti-leishmanial HO-1/Nrf-2-mediated oxidative responses in visceral leishmaniasis patients.	Das S, etal., J Antimicrob Chemother. 2013 Sep;68(9):2059-65. doi: 10.1093/jac/dkt162. Epub 2013 May 31.
14.	DL-3-n-butylphthalide extends survival by attenuating glial activation in a mouse model of amyotrophic lateral sclerosis.	Feng X, etal., Neuropharmacology. 2012 Feb;62(2):1004-10. doi: 10.1016/j.neuropharm.2011.10.009. Epub 2011 Nov 2.
15.	Thiol redox disturbances in children with severe asthma are associated with posttranslational modification of the transcription factor nuclear factor (erythroid-derived 2)-like 2.	Fitzpatrick AM, etal., J Allergy Clin Immunol. 2011 Jun;127(6):1604-11. Epub 2011 Apr 22.
16.	Activation of the nuclear factor erythroid 2-related factor 2-antioxidant response element signal in rats with diffuse axonal injury.	Gao P, etal., Neuroreport. 2019 Apr 10;30(6):389-396. doi: 10.1097/WNR.0000000000001210.
17.	Olmesartan protects against oxidative stress possibly through the Nrf2 signaling pathway and inhibits inflammation in daunorubicin-induced nephrotoxicity in rats.	Gounder VK, etal., Int Immunopharmacol. 2014 Feb;18(2):282-9. doi: 10.1016/j.intimp.2013.11.018. Epub 2013 Nov 28.
18.	Altered Nrf2/Keap1-Bach1 equilibrium in pulmonary emphysema.	Goven D, etal., Thorax. 2008 Oct;63(10):916-24. Epub 2008 Jun 17.
19.	Nrf2 Negatively Regulates Type I Interferon Responses and Increases Susceptibility to Herpes Genital Infection in Mice.	Gunderstofte C, etal., Front Immunol. 2019 Sep 6;10:2101. doi: 10.3389/fimmu.2019.02101. eCollection 2019.
20.	NRF2 SUMOylation promotes de novo serine synthesis and maintains HCC tumorigenesis.	Guo H, etal., Cancer Lett. 2019 Dec 1;466:39-48. doi: 10.1016/j.canlet.2019.09.010. Epub 2019 Sep 20.
21.	The Nrf2 regulatory network provides an interface between redox and intermediary metabolism.	Hayes JD and Dinkova-Kostova AT, Trends Biochem Sci. 2014 Apr;39(4):199-218. doi: 10.1016/j.tibs.2014.02.002. Epub 2014 Mar 16.
22.	NRF2 Activates Growth Factor Genes and Downstream AKT Signaling to Induce Mouse and Human Hepatomegaly.	He F, etal., J Hepatol. 2020 Feb 12. pii: S0168-8278(20)30070-2. doi: 10.1016/j.jhep.2020.01.023.
23.	Redox regulation by nuclear factor erythroid 2-related factor 2: gatekeeping for the basal and diabetes-induced expression of thioredoxin-interacting protein.	He X and Ma Q, Mol Pharmacol. 2012 Nov;82(5):887-97. doi: 10.1124/mol.112.081133. Epub 2012 Aug 6.
24.	A novel natural Nrf2 activator with PPARgamma-agonist (monascin) attenuates the toxicity of methylglyoxal and hyperglycemia.	Hsu WH, etal., Toxicol Appl Pharmacol. 2013 Nov 1;272(3):842-51. doi: 10.1016/j.taap.2013.07.004. Epub 2013 Aug 15.
25.	The complexity of the Nrf2 pathway: beyond the antioxidant response.	Huang Y, etal., J Nutr Biochem. 2015 Dec;26(12):1401-13. doi: 10.1016/j.jnutbio.2015.08.001. Epub 2015 Aug 8.
26.	Transcription factor Nrf2 regulates inflammation by mediating the effect of 15-deoxy-Delta(12,14)-prostaglandin j(2).	Itoh K, etal., Mol Cell Biol. 2004 Jan;24(1):36-45.
27.	Genetic ablation of Nrf2 enhances susceptibility to acute lung injury after traumatic brain injury in mice.	Jin W, etal., Exp Biol Med (Maywood). 2009 Feb;234(2):181-9.
28.	Protective effects of erythropoietin in traumatic spinal cord injury by inducing the Nrf2 signaling pathway activation.	Jin W, etal., J Trauma Acute Care Surg. 2014 May;76(5):1228-34. doi: 10.1097/TA.0000000000000211.
29.	Eriodictyol-7-O-glucoside activates Nrf2 and protects against cerebral ischemic injury.	Jing X, etal., Toxicol Appl Pharmacol. 2013 Dec 15;273(3):672-9.
30.	Luteolin confers renoprotection against ischemia-reperfusion injury via involving Nrf2 pathway and regulating miR320.	Kalbolandi SM, etal., Mol Biol Rep. 2019 Aug;46(4):4039-4047. doi: 10.1007/s11033-019-04853-0. Epub 2019 May 14.
31.	Melatonin inhibits type 1 interferon signaling of toll-like receptor 4 via heme oxygenase-1 induction in hepatic ischemia/reperfusion.	Kang JW and Lee SM, J Pineal Res. 2012 Aug;53(1):67-76. doi: 10.1111/j.1600-079X.2012.00972.x. Epub 2012 Jan 31.
32.	Intrahippocampal injection of a lentiviral vector expressing Nrf2 improves spatial learning in a mouse model of Alzheimer's disease.	Kanninen K, etal., Proc Natl Acad Sci U S A. 2009 Sep 22;106(38):16505-10. doi: 10.1073/pnas.0908397106. Epub 2009 Sep 10.
33.	Attenuation of UVB-induced sunburn reaction and oxidative DNA damage with no alterations in UVB-induced skin carcinogenesis in Nrf2 gene-deficient mice.	Kawachi Y, etal., J Invest Dermatol. 2008 Jul;128(7):1773-9. Epub 2008 Jan 17.
34.	Anti-fibrotic effects of L-2-oxothiazolidine-4-carboxylic acid via modulation of nuclear factor erythroid 2-related factor 2 in rats.	Kim IH, etal., BMB Rep. 2012 Jun;45(6):348-53.
35.	Sunitinib Inhibits Breast Cancer Cell Proliferation by Inducing Apoptosis, Cell-cycle Arrest and DNA Repair While Inhibiting NF-κB Signaling Pathways.	Korashy HM, etal., Anticancer Res. 2017 Sep;37(9):4899-4909. doi: 10.21873/anticanres.11899.
36.	Niacin and Selenium Attenuate Sepsis-Induced Lung Injury by Up-Regulating Nuclear Factor Erythroid 2-Related Factor 2 Signaling.	Kwon WY, etal., Crit Care Med. 2016 Jun;44(6):e370-82. doi: 10.1097/CCM.0000000000001422.
37.	Effects of monascin on anti-inflammation mediated by Nrf2 activation in advanced glycation end product-treated THP-1 monocytes and methylglyoxal-treated wistar rats.	Lee BH, etal., J Agric Food Chem. 2013 Feb 13;61(6):1288-98. doi: 10.1021/jf305067n. Epub 2013 Jan 31.
38.	Liver injury attenuation by curcumin in a rat NASH model: an Nrf2 activation-mediated effect?	Li B, etal., Ir J Med Sci. 2016 Feb;185(1):93-100. doi: 10.1007/s11845-014-1226-9. Epub 2014 Nov 11.
39.	A synthetic analog of lipoxin A4 partially alleviates dexamethasone-induced fetal growth restriction in rats.	Lin F, etal., Placenta. 2013 Oct;34(10):941-8. doi: 10.1016/j.placenta.2013.07.007. Epub 2013 Aug 1.
40.	Traumatic brain injury dysregulates microRNAs to modulate cell signaling in rat hippocampus.	Liu L, etal., PLoS One. 2014 Aug 4;9(8):e103948. doi: 10.1371/journal.pone.0103948. eCollection 2014.
41.	[The effect of transcription factor KLF2 in expression of gamma-GCS depend on regulation by Nrf2 in lung of rats with chronic obstructive pulmonary disease].	Liu XY, etal., Zhongguo Ying Yong Sheng Li Xue Za Zhi. 2012 Mar;28(2):173-8.
42.	Ferulic acid prevents oxidative stress, inflammation, and liver injury via upregulation of Nrf2/HO-1 signaling in methotrexate-induced rats.	Mahmoud AM, etal., Environ Sci Pollut Res Int. 2020 Mar;27(8):7910-7921. doi: 10.1007/s11356-019-07532-6. Epub 2019 Dec 31.
43.	Decline in NRF2-regulated antioxidants in chronic obstructive pulmonary disease lungs due to loss of its positive regulator, DJ-1.	Malhotra D, etal., Am J Respir Crit Care Med. 2008 Sep 15;178(6):592-604. Epub 2008 Jun 12.
44.	MGDs mouse GO annotations	MGD data from the GO Consortium
45.	MGD IEA	MGD IEA
46.	Cryptotanshinone from the Salvia miltiorrhiza Bunge Attenuates Ethanol-Induced Liver Injury by Activation of AMPK/SIRT1 and Nrf2 Signaling Pathways.	Nagappan A, etal., Int J Mol Sci. 2019 Dec 30;21(1). pii: ijms21010265. doi: 10.3390/ijms21010265.
47.	Polymorphism in the Promoter Region of NFE2L2 Gene Is a Genetic Marker of Susceptibility to Cirrhosis Associated with Alcohol Abuse.	Nunes Dos Santos K, etal., Int J Mol Sci. 2019 Jul 23;20(14). pii: ijms20143589. doi: 10.3390/ijms20143589.
48.	Nrf2 inhibits hepatic iron accumulation and counteracts oxidative stress-induced liver injury in nutritional steatohepatitis.	Okada K, etal., J Gastroenterol. 2012 Aug;47(8):924-35. Epub 2012 Feb 28.
49.	Analysis of the mouse transcriptome based on functional annotation of 60,770 full-length cDNAs.	Okazaki Y, etal., Nature. 2002 Dec 5;420(6915):563-73.
50.	Genetic or pharmacologic amplification of nrf2 signaling inhibits acute inflammatory liver injury in mice.	Osburn WO, etal., Toxicol Sci. 2008 Jul;104(1):218-27. Epub 2008 Apr 15.
51.	Resveratrol protects diabetic kidney by attenuating hyperglycemia-mediated oxidative stress and renal inflammatory cytokines via Nrf2-Keap1 signaling.	Palsamy P and Subramanian S, Biochim Biophys Acta. 2011 Jul;1812(7):719-31. Epub 2011 Mar 23.
52.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
53.	Mouse MP Annotation Import Pipeline	RGD automated import pipeline
54.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
55.	Curcumin nanoparticles attenuate neurochemical and neurobehavioral deficits in experimental model of Huntington's disease.	Sandhir R, etal., Neuromolecular Med. 2014 Mar;16(1):106-18. doi: 10.1007/s12017-013-8261-y. Epub 2013 Sep 6.
56.	Nuclear erythroid 2-related factor 2-antioxidative response element signaling pathway in motor cortex and spinal cord in amyotrophic lateral sclerosis.	Sarlette A, etal., J Neuropathol Exp Neurol. 2008 Nov;67(11):1055-62.
57.	Diet-relevant phytochemical intake affects the cardiac AhR and nrf2 transcriptome and reduces heart failure in hypertensive rats.	Seymour EM, etal., J Nutr Biochem. 2013 Sep;24(9):1580-6. doi: 10.1016/j.jnutbio.2013.01.008. Epub 2013 Mar 22.
58.	Antioxidant and cognitive promotion effects of anthocyanin-rich mulberry (Morus atropurpurea L.) on senescence-accelerated mice and prevention of Alzheimer's disease.	Shih PH, etal., J Nutr Biochem. 2010 Jul;21(7):598-605. doi: 10.1016/j.jnutbio.2009.03.008. Epub 2009 May 14.
59.	Olmesartan ameliorates urinary dysfunction in the spontaneously hypertensive rat via recovering bladder blood flow and decreasing oxidative stress.	Shimizu S, etal., Neurourol Urodyn. 2014 Mar;33(3):350-7. doi: 10.1002/nau.22405. Epub 2013 Jun 17.
60.	Nrf2 activators attenuate the progression of nonalcoholic steatohepatitis-related fibrosis in a dietary rat model.	Shimozono R, etal., Mol Pharmacol. 2013 Jul;84(1):62-70. doi: 10.1124/mol.112.084269. Epub 2013 Apr 16.
61.	Induction of NAD(P)H-quinone oxidoreductase 1 by antioxidants in female ACI rats is associated with decrease in oxidative DNA damage and inhibition of estrogen-induced breast cancer.	Singh B, etal., Carcinogenesis. 2012 Jan;33(1):156-63. doi: 10.1093/carcin/bgr237. Epub 2011 Nov 9.
62.	Curcumin alleviates oxidative stress, inflammation, and renal fibrosis in remnant kidney through the Nrf2-keap1 pathway.	Soetikno V, etal., Mol Nutr Food Res. 2013 Sep;57(9):1649-59. doi: 10.1002/mnfr.201200540. Epub 2012 Nov 23.
63.	Maresin 1, a Proresolving Lipid Mediator, Ameliorates Liver Ischemia-Reperfusion Injury and Stimulates Hepatocyte Proliferation in Sprague-Dawley Rats.	Soto G, etal., Int J Mol Sci. 2020 Jan 15;21(2). pii: ijms21020540. doi: 10.3390/ijms21020540.
64.	Epigallocatechin-3-gallate augments antioxidant activities and inhibits inflammation during bleomycin-induced experimental pulmonary fibrosis through Nrf2-Keap1 signaling.	Sriram N, etal., Pulm Pharmacol Ther. 2009 Jun;22(3):221-36. Epub 2008 Dec 25.
65.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
66.	Association between polymorphism of the NQO1, NOS3 and NFE2L2 genes and AMD.	Synowiec E, etal., Front Biosci (Landmark Ed). 2013 Jan 1;18:80-90.
67.	Derivative of bardoxolone methyl, dh404, in an inverse dose-dependent manner lessens diabetes-associated atherosclerosis and improves diabetic kidney disease.	Tan SM, etal., Diabetes. 2014 Sep;63(9):3091-103. doi: 10.2337/db13-1743. Epub 2014 Apr 16.
68.	Myocardial infarction-induced microRNA-enriched exosomes contribute to cardiac Nrf2 dysregulation in chronic heart failure.	Tian C, etal., Am J Physiol Heart Circ Physiol. 2018 May 1;314(5):H928-H939. doi: 10.1152/ajpheart.00602.2017. Epub 2018 Jan 26.
69.	Antioxidant effects of diallyl trisulfide on high glucose-induced apoptosis are mediated by the PI3K/Akt-dependent activation of Nrf2 in cardiomyocytes.	Tsai CY, etal., Int J Cardiol. 2013 Sep 30;168(2):1286-97. doi: 10.1016/j.ijcard.2012.12.004. Epub 2013 Feb 27.
70.	Tomato powder impedes the development of azoxymethane-induced colorectal cancer in rats through suppression of COX-2 expression via NF-kappaB and regulating Nrf2/HO-1 pathway.	Tuzcu M, etal., Mol Nutr Food Res. 2012 Sep;56(9):1477-81. doi: 10.1002/mnfr.201200130. Epub 2012 Aug 1.
71.	Nrf2-encoding NFE2L2 haplotypes influence disease progression but not risk in Alzheimer's disease and age-related cataract.	von Otter M, etal., Mech Ageing Dev. 2010 Feb;131(2):105-10. Epub 2010 Jan 12.
72.	LncRNA H19 inhibits ER stress induced apoptosis and improves diabetic cardiomyopathy by regulating PI3K/AKT/mTOR axis.	Wang S, etal., Aging (Albany NY). 2022 Aug 30;14(16):6809-6828. doi: 10.18632/aging.204256. Epub 2022 Aug 30.
73.	Activation of Nrf2-ARE signal pathway protects the brain from damage induced by epileptic seizure.	Wang W, etal., Brain Res. 2014 Jan 28;1544:54-61. doi: 10.1016/j.brainres.2013.12.004. Epub 2013 Dec 10.
74.	Melatonin activates the Nrf2-ARE pathway when it protects against early brain injury in a subarachnoid hemorrhage model.	Wang Z, etal., J Pineal Res. 2012 Sep;53(2):129-37. doi: 10.1111/j.1600-079X.2012.00978.x. Epub 2012 Feb 3.
75.	Lipoxin A4 ameliorates cerebral ischaemia/reperfusion injury through upregulation of nuclear factor erythroid 2-related factor 2.	Wu L, etal., Neurol Res. 2013 Nov;35(9):968-75. doi: 10.1179/1743132813Y.0000000242. Epub 2013 Jul 22.
76.	Myocardial ischemic reperfusion induces de novo Nrf2 protein translation.	Xu B, etal., Biochim Biophys Acta. 2014 Sep;1842(9):1638-47. doi: 10.1016/j.bbadis.2014.06.002. Epub 2014 Jun 8.
77.	Nadroparin sodium activates Nrf2/HO-1 pathway in acetic acid-induced colitis in rats.	Yalniz M, etal., Inflammation. 2012 Jun;35(3):1213-21. doi: 10.1007/s10753-012-9431-z.
78.	Traumatic brain injury induces the activation of the Nrf2-ARE pathway in the lung in rats.	Yan W, etal., Brain Inj. 2008 Sep;22(10):802-10.
79.	2,3,5,4'-Tetrahydroxystilbene-2-O-β-d-glucoside alleviated the acute hepatotoxicity and DNA damage in diethylnitrosamine-contaminated mice.	Yu W, etal., Life Sci. 2020 Feb 15;243:117274. doi: 10.1016/j.lfs.2020.117274. Epub 2020 Jan 9.
80.	Acceleration of the development of Alzheimer's disease in amyloid beta-infused peroxiredoxin 6 overexpression transgenic mice.	Yun HM, etal., Mol Neurobiol. 2013 Dec;48(3):941-51. doi: 10.1007/s12035-013-8479-6. Epub 2013 Jun 15.
81.	Astragaloside IV Synergizes with Ferulic Acid to Alleviate Hepatic Fibrosis in Bile Duct-Ligated Cirrhotic Rats.	Zhao XM, etal., Dig Dis Sci. 2020 Jan 3. pii: 10.1007/s10620-019-06017-3. doi: 10.1007/s10620-019-06017-3.
82.	Age-related retinopathy in NRF2-deficient mice.	Zhao Z, etal., PLoS One. 2011 Apr 29;6(4):e19456. doi: 10.1371/journal.pone.0019456.
83.	Protective effect of dioscin against thioacetamide-induced acute liver injury via FXR/AMPK signaling pathway in vivo.	Zheng L, etal., Biomed Pharmacother. 2018 Jan;97:481-488. doi: 10.1016/j.biopha.2017.10.153. Epub 2017 Nov 6.
84.	Transcription factor Nrf2-mediated antioxidant defense system in the development of diabetic retinopathy.	Zhong Q, etal., Invest Ophthalmol Vis Sci. 2013 Jun 6;54(6):3941-8. doi: 10.1167/iovs.13-11598.

Additional References at PubMed

PMID:7567998	PMID:7726861	PMID:8887638	PMID:8943040	PMID:9173930	PMID:9240432	PMID:9538217	PMID:9558405	PMID:9887101	PMID:10037736	PMID:10349636	PMID:10517540
PMID:10535991	PMID:10770291	PMID:10922068	PMID:11042159	PMID:11076861	PMID:11118612	PMID:11217851	PMID:11248092	PMID:11274184	PMID:11576348	PMID:11583586	PMID:11751202
PMID:11895860	PMID:11940647	PMID:11948402	PMID:11991805	PMID:12023900	PMID:12101242	PMID:12145307	PMID:12193649	PMID:12220541	PMID:12356737	PMID:12435735	PMID:12441344
PMID:12506115	PMID:12520002	PMID:12556532	PMID:12646173	PMID:12653965	PMID:12716947	PMID:12726911	PMID:12816537	PMID:12819125	PMID:12842875	PMID:12904583	PMID:12915120
PMID:12968018	PMID:14504288	PMID:14517290	PMID:14517554	PMID:14529549	PMID:14550278	PMID:14610273	PMID:14629110	PMID:14681479	PMID:14752028	PMID:14762128	PMID:14764898
PMID:14978030	PMID:15060151	PMID:15086909	PMID:15087497	PMID:15102471	PMID:15143058	PMID:15173550	PMID:15207916	PMID:15208274	PMID:15210949	PMID:15265007	PMID:15282312
PMID:15292179	PMID:15367669	PMID:15374950	PMID:15489334	PMID:15520857	PMID:15574414	PMID:15611470	PMID:15618518	PMID:15629862	PMID:15734732	PMID:15790560	PMID:15816842
PMID:15831471	PMID:15840590	PMID:15870285	PMID:15896789	PMID:15899855	PMID:15944151	PMID:15998787	PMID:16116181	PMID:16135796	PMID:16141072	PMID:16141073	PMID:16272357
PMID:16293230	PMID:16324149	PMID:16352618	PMID:16354693	PMID:16374848	PMID:16426233	PMID:16428448	PMID:16449384	PMID:16485034	PMID:16487036	PMID:16507366	PMID:16516379
PMID:16551616	PMID:16581765	PMID:16585964	PMID:16602821	PMID:16613847	PMID:16647090	PMID:16648473	PMID:16704410	PMID:16723711	PMID:16781461	PMID:16785233	PMID:16794261
PMID:16872277	PMID:16912211	PMID:16945104	PMID:16958665	PMID:16962985	PMID:16971476	PMID:17008637	PMID:17008872	PMID:17015834	PMID:17029980	PMID:17097057	PMID:17113054
PMID:17142801	PMID:17178849	PMID:17259171	PMID:17276355	PMID:17278884	PMID:17303623	PMID:17313370	PMID:17336276	PMID:17413030	PMID:17420218	PMID:17507167	PMID:17525273
PMID:17535857	PMID:17575130	PMID:17591699	PMID:17602169	PMID:17602956	PMID:17609113	PMID:17631292	PMID:17631644	PMID:17660561	PMID:17668877	PMID:17709388	PMID:17785452
PMID:17881530	PMID:17895394	PMID:17901416	PMID:17903176	PMID:17904103	PMID:17920186	PMID:17925401	PMID:17962605	PMID:17964723	PMID:17967808	PMID:17971305	PMID:17980396
PMID:18005231	PMID:18022235	PMID:18036733	PMID:18039655	PMID:18048326	PMID:18059474	PMID:18162315	PMID:18199529	PMID:18238777	PMID:18268004	PMID:18273910	PMID:18279678
PMID:18281592	PMID:18287083	PMID:18287559	PMID:18302760	PMID:18316592	PMID:18358244	PMID:18364461	PMID:18367636	PMID:18372916	PMID:18395094	PMID:18404528	PMID:18441282
PMID:18463988	PMID:18512965	PMID:18514070	PMID:18535259	PMID:18542053	PMID:18548744	PMID:18566336	PMID:18566435	PMID:18585365	PMID:18614404	PMID:18619545	PMID:18624917
PMID:18666252	PMID:18679376	PMID:18687751	PMID:18703564	PMID:18715849	PMID:18759561	PMID:18799693	PMID:18802057	PMID:18814142	PMID:18826952	PMID:18845810	PMID:18931336
PMID:19007787	PMID:19013447	PMID:19023427	PMID:19027064	PMID:19028565	PMID:19074031	PMID:19086807	PMID:19090810	PMID:19104057	PMID:19125683	PMID:19129213	PMID:19138955
PMID:19151108	PMID:19167360	PMID:19174151	PMID:19181614	PMID:19182219	PMID:19190763	PMID:19196989	PMID:19246623	PMID:19246624	PMID:19273602	PMID:19351736	PMID:19360320
PMID:19371629	PMID:19372249	PMID:19386581	PMID:19394962	PMID:19410644	PMID:19436334	PMID:19454702	PMID:19454723	PMID:19474220	PMID:19484125	PMID:19523933	PMID:19538980
PMID:19560419	PMID:19563780	PMID:19592468	PMID:19608979	PMID:19674192	PMID:19679681	PMID:19720622	PMID:19729611	PMID:19732748	PMID:19734219	PMID:19778293	PMID:19786557
PMID:19805484	PMID:19864258	PMID:19901266	PMID:19908287	PMID:19910389	PMID:19914374	PMID:19926817	PMID:19933842	PMID:19956833	PMID:20005974	PMID:20059953	PMID:20062804
PMID:20064509	PMID:20064636	PMID:20086057	PMID:20089859	PMID:20094061	PMID:20096777	PMID:20103708	PMID:20133372	PMID:20173742	PMID:20211142	PMID:20211940	PMID:20211941
PMID:20223225	PMID:20235094	PMID:20298567	PMID:20300111	PMID:20300512	PMID:20350562	PMID:20378532	PMID:20399915	PMID:20404090	PMID:20410673	PMID:20412781	PMID:20417615
PMID:20418481	PMID:20446765	PMID:20447451	PMID:20448209	PMID:20452971	PMID:20452972	PMID:20460467	PMID:20478997	PMID:20511556	PMID:20513672	PMID:20528745	PMID:20608163
PMID:20621462	PMID:20628156	PMID:20632932	PMID:20651288	PMID:20676377	PMID:20691658	PMID:20692336	PMID:20693319	PMID:20797910	PMID:20810543	PMID:20826812	PMID:20831192
PMID:20855879	PMID:20862369	PMID:20926689	PMID:20930048	PMID:20940400	PMID:20947826	PMID:20956535	PMID:20974733	PMID:20977460	PMID:20978266	PMID:20978343	PMID:21041446
PMID:21075092	PMID:21094136	PMID:21094147	PMID:21097520	PMID:21127061	PMID:21176673	PMID:21177379	PMID:21185264	PMID:21211512	PMID:21216970	PMID:21217061	PMID:21245055
PMID:21245377	PMID:21254817	PMID:21267068	PMID:21281708	PMID:21289052	PMID:21303654	PMID:21328587	PMID:21349591	PMID:21357422	PMID:21367886	PMID:21382013	PMID:21382476
PMID:21382770	PMID:21383067	PMID:21389693	PMID:21406003	PMID:21443946	PMID:21454555	PMID:21466852	PMID:21482715	PMID:21484785	PMID:21487034	PMID:21490276	PMID:21504366
PMID:21529713	PMID:21538727	PMID:21544513	PMID:21545836	PMID:21554947	PMID:21557329	PMID:21569103	PMID:21569840	PMID:21593323	PMID:21605664	PMID:21626108	PMID:21658446
PMID:21659655	PMID:21677132	PMID:21677750	PMID:21681606	PMID:21712086	PMID:21734707	PMID:21764072	PMID:21775727	PMID:21784539	PMID:21787756	PMID:21799073	PMID:21805027
PMID:21852618	PMID:21852674	PMID:21873635	PMID:21880016	PMID:21882243	PMID:21884778	PMID:21905011	PMID:21926641	PMID:21949655	PMID:21989915	PMID:22020098	PMID:22021391
PMID:22024078	PMID:22025779	PMID:22039262	PMID:22039513	PMID:22051043	PMID:22095074	PMID:22095276	PMID:22138520	PMID:22155388	PMID:22169690	PMID:22178546	PMID:22179317
PMID:22188542	PMID:22222206	PMID:22226832	PMID:22227268	PMID:22236145	PMID:22250088	PMID:22272764	PMID:22275372	PMID:22308036	PMID:22311972	PMID:22312014	PMID:22334478
PMID:22339499	PMID:22342405	PMID:22345550	PMID:22353756	PMID:22355716	PMID:22366763	PMID:22370093	PMID:22383093	PMID:22400915	PMID:22401859	PMID:22405071	PMID:22467641
PMID:22469516	PMID:22490042	PMID:22491424	PMID:22495766	PMID:22496397	PMID:22513881	PMID:22522787	PMID:22529521	PMID:22547061	PMID:22559194	PMID:22567161	PMID:22581777
PMID:22586274	PMID:22591204	PMID:22627062	PMID:22677785	PMID:22688683	PMID:22693571	PMID:22728935	PMID:22751928	PMID:22789539	PMID:22808024	PMID:22814021	PMID:22851183
PMID:22855800	PMID:22859313	PMID:22872865	PMID:22911891	PMID:22923197	PMID:22936178	PMID:22940620	PMID:22964642	PMID:22972520	PMID:22975029	PMID:23000044	PMID:23017736
PMID:23023374	PMID:23029187	PMID:23036869	PMID:23043106	PMID:23045680	PMID:23051009	PMID:23056222	PMID:23085426	PMID:23085505	PMID:23109062	PMID:23132297	PMID:23143620
PMID:23166812	PMID:23186333	PMID:23201694	PMID:23209658	PMID:23223297	PMID:23237955	PMID:23238296	PMID:23250896	PMID:23274085	PMID:23275004	PMID:23276496	PMID:23296708
PMID:23311871	PMID:23328769	PMID:23341579	PMID:23413426	PMID:23418358	PMID:23418589	PMID:23434766	PMID:23434824	PMID:23454126	PMID:23469253	PMID:23475767	PMID:23492188
PMID:23494124	PMID:23514035	PMID:23526214	PMID:23527105	PMID:23533698	PMID:23538677	PMID:23564646	PMID:23570914	PMID:23572560	PMID:23587556	PMID:23589329	PMID:23590302
PMID:23595026	PMID:23597505	PMID:23610445	PMID:23618921	PMID:23623252	PMID:23630227	PMID:23637463	PMID:23676441	PMID:23710285	PMID:23711824	PMID:23715558	PMID:23716596
PMID:23721546	PMID:23725046	PMID:23738044	PMID:23747519	PMID:23751407	PMID:23761402	PMID:23764462	PMID:23766849	PMID:23766851	PMID:23775080	PMID:23793505	PMID:23800876
PMID:23801334	PMID:23841575	PMID:23857982	PMID:23867319	PMID:23875776	PMID:23890231	PMID:23896025	PMID:23921124	PMID:23932974	PMID:23936010	PMID:23951401	PMID:23954169
PMID:23954472	PMID:23988840	PMID:23988890	PMID:23994065	PMID:23995233	PMID:24011591	PMID:24015256	PMID:24021424	PMID:24024172	PMID:24024667	PMID:24025640	PMID:24029383
PMID:24053644	PMID:24062466	PMID:24101662	PMID:24112193	PMID:24116971	PMID:24139870	PMID:24147739	PMID:24170703	PMID:24184056	PMID:24186494	PMID:24186865	PMID:24188280
PMID:24191237	PMID:24206218	PMID:24258214	PMID:24269680	PMID:24298019	PMID:24303786	PMID:24310875	PMID:24311782	PMID:24361737	PMID:24361900	PMID:24366543	PMID:24368646
PMID:24379438	PMID:24406502	PMID:24423726	PMID:24441674	PMID:24443206	PMID:24450884	PMID:24462598	PMID:24463449	PMID:24467545	PMID:24474616	PMID:24478369	PMID:24486344
PMID:24486487	PMID:24492006	PMID:24494203	PMID:24503019	PMID:24521946	PMID:24523358	PMID:24530882	PMID:24556415	PMID:24567396	PMID:24576487	PMID:24580727	PMID:24597671
PMID:24600403	PMID:24613345	PMID:24613379	PMID:24628668	PMID:24630724	PMID:24633890	PMID:24636985	PMID:24642087	PMID:24646717	PMID:24667209	PMID:24667411	PMID:24667526
PMID:24709675	PMID:24716787	PMID:24718857	PMID:24725081	PMID:24746614	PMID:24747945	PMID:24753106	PMID:24798340	PMID:24801392	PMID:24810171	PMID:24812425	PMID:24813929
PMID:24815692	PMID:24815875	PMID:24859727	PMID:24866179	PMID:24895528	PMID:24901054	PMID:24915051	PMID:24917652	PMID:24921206	PMID:24924401	PMID:24925757	PMID:24934809
PMID:24943846	PMID:24948812	PMID:24952961	PMID:24953182	PMID:24958099	PMID:24967692	PMID:24981859	PMID:24988078	PMID:25002747	PMID:25014792	PMID:25046864	PMID:25049227
PMID:25092871	PMID:25096517	PMID:25107906	PMID:25111334	PMID:25169438	PMID:25171655	PMID:25193093	PMID:25203443	PMID:25222179	PMID:25224039	PMID:25231996	PMID:25239867
PMID:25242137	PMID:25245478	PMID:25268541	PMID:25270507	PMID:25280775	PMID:25290687	PMID:25294219	PMID:25316599	PMID:25328080	PMID:25336178	PMID:25393425	PMID:25401197
PMID:25421510	PMID:25450328	PMID:25454122	PMID:25482391	PMID:25484314	PMID:25491300	PMID:25493944	PMID:25524062	PMID:25534702	PMID:25542313	PMID:25546133	PMID:25550330
PMID:25556857	PMID:25576674	PMID:25631293	PMID:25637945	PMID:25683606	PMID:25687825	PMID:25701757	PMID:25701884	PMID:25727958	PMID:25728635	PMID:25728706	PMID:25732597
PMID:25754743	PMID:25770125	PMID:25774506	PMID:25777368	PMID:25795629	PMID:25818884	PMID:25825216	PMID:25843654	PMID:25844901	PMID:25882312	PMID:25883219	PMID:25895590
PMID:25908459	PMID:25916883	PMID:25922074	PMID:25934285	PMID:25935309	PMID:25951827	PMID:25957295	PMID:25967870	PMID:25999406	PMID:26004161	PMID:26012548	PMID:26016441
PMID:26024237	PMID:26028482	PMID:26058667	PMID:26075390	PMID:26117323	PMID:26147683	PMID:26151571	PMID:26163001	PMID:26184139	PMID:26187356	PMID:26193055	PMID:26205695
PMID:26208452	PMID:26238671	PMID:26247513	PMID:26280276	PMID:26282218	PMID:26283726	PMID:26285140	PMID:26291391	PMID:26300493	PMID:26307669	PMID:26325428	PMID:26332085
PMID:26340923	PMID:26346162	PMID:26348541	PMID:26371321	PMID:26427884	PMID:26442467	PMID:26454883	PMID:26475037	PMID:26492067	PMID:26493041	PMID:26494449	PMID:26498409
PMID:26505797	PMID:26505893	PMID:26530903	PMID:26548719	PMID:26572828	PMID:26573705	PMID:26617809	PMID:26621751	PMID:26644517	PMID:26647385	PMID:26677805	PMID:26682532
PMID:26689155	PMID:26700463	PMID:26701603	PMID:26718502	PMID:26721202	PMID:26721592	PMID:26724590	PMID:26776972	PMID:26787241	PMID:26795599	PMID:26808544	PMID:26816051
PMID:26827822	PMID:26830132	PMID:26835538	PMID:26839378	PMID:26841864	PMID:26842755	PMID:26845617	PMID:26849944	PMID:26899729	PMID:26935021	PMID:26935388	PMID:26936880
PMID:26972048	PMID:26980071	PMID:27005782	PMID:27006338	PMID:27006451	PMID:27009867	PMID:27012417	PMID:27016073	PMID:27020858	PMID:27037625	PMID:27044864	PMID:27060105
PMID:27070823	PMID:27078105	PMID:27089175	PMID:27094017	PMID:27095375	PMID:27107768	PMID:27107941	PMID:27115417	PMID:27133718	PMID:27148686	PMID:27149848	PMID:27158670
PMID:27161318	PMID:27167730	PMID:27179426	PMID:27180241	PMID:27183391	PMID:27183581	PMID:27198574	PMID:27211841	PMID:27211851	PMID:27215388	PMID:27216826	PMID:27245349
PMID:27251288	PMID:27259810	PMID:27260468	PMID:27300700	PMID:27308893	PMID:27313828	PMID:27315552	PMID:27324483	PMID:27335232	PMID:27344638	PMID:27345495	PMID:27383629
PMID:27409635	PMID:27411381	PMID:27417135	PMID:27427974	PMID:27428900	PMID:27431005	PMID:27436123	PMID:27439389	PMID:27453341	PMID:27457280	PMID:27462873	PMID:27470577
PMID:27471236	PMID:27481061	PMID:27501050	PMID:27521459	PMID:27528061	PMID:27545889	PMID:27566827	PMID:27579494	PMID:27607584	PMID:27614310	PMID:27614618	PMID:27614871
PMID:27625306	PMID:27635399	PMID:27638854	PMID:27645114	PMID:27646262	PMID:27660010	PMID:27669641	PMID:27683801	PMID:27697860	PMID:27721446	PMID:27732910	PMID:27764742
PMID:27764743	PMID:27774118	PMID:27789056	PMID:27804998	PMID:27816475	PMID:27835780	PMID:27836987	PMID:27837167	PMID:27840317	PMID:27847240	PMID:27853236	PMID:27867098
PMID:27872193	PMID:27875748	PMID:27884351	PMID:27903744	PMID:27923559	PMID:27936457	PMID:27940089	PMID:27941837	PMID:27982105	PMID:28012440	PMID:28027929	PMID:28039408
PMID:28045693	PMID:28049732	PMID:28050123	PMID:28055010	PMID:28068647	PMID:28071748	PMID:28078004	PMID:28088324	PMID:28088623	PMID:28102348	PMID:28107754	PMID:28115273
PMID:28122344	PMID:28131830	PMID:28131861	PMID:28152064	PMID:28165480	PMID:28188924	PMID:28189672	PMID:28205579	PMID:28209760	PMID:28212524	PMID:28213269	PMID:28218609
PMID:28219650	PMID:28228267	PMID:28233855	PMID:28234792	PMID:28234915	PMID:28247911	PMID:28253482	PMID:28257879	PMID:28268192	PMID:28280036	PMID:28286065	PMID:28287409
PMID:28304344	PMID:28314773	PMID:28315822	PMID:28322133	PMID:28324005	PMID:28371119	PMID:28373008	PMID:28419990	PMID:28420366	PMID:28423499	PMID:28428137	PMID:28429615
PMID:28440735	PMID:28457936	PMID:28457937	PMID:28461502	PMID:28461605	PMID:28482326	PMID:28507037	PMID:28512147	PMID:28515152	PMID:28515695	PMID:28533375	PMID:28569786
PMID:28572033	PMID:28596000	PMID:28655791	PMID:28667908	PMID:28669729	PMID:28673258	PMID:28674188	PMID:28676836	PMID:28677741	PMID:28684418	PMID:28692050	PMID:28697633
PMID:28698767	PMID:28704727	PMID:28710020	PMID:28724916	PMID:28738526	PMID:28750561	PMID:28751936	PMID:28757412	PMID:28757911	PMID:28758961	PMID:28771719	PMID:28778483
PMID:28784700	PMID:28796629	PMID:28821730	PMID:28867192	PMID:28870520	PMID:28887507	PMID:28901476	PMID:28928081	PMID:28928455	PMID:28930658	PMID:28931625	PMID:28939422
PMID:28946766	PMID:28951325	PMID:28951767	PMID:28954230	PMID:28956063	PMID:28964663	PMID:28971839	PMID:28976551	PMID:28976703	PMID:28984834	PMID:28985506	PMID:29018242
PMID:29034470	PMID:29036636	PMID:29039475	PMID:29044125	PMID:29055012	PMID:29073253	PMID:29079704	PMID:29083257	PMID:29108910	PMID:29115385	PMID:29119686	PMID:29121804
PMID:29149604	PMID:29153842	PMID:29153923	PMID:29167164	PMID:29180572	PMID:29186981	PMID:29211853	PMID:29233793	PMID:29241092	PMID:29254987	PMID:29255069	PMID:29264825
PMID:29276215	PMID:29277609	PMID:29304346	PMID:29326403	PMID:29330760	PMID:29331651	PMID:29353218	PMID:29362432	PMID:29373803	PMID:29402993	PMID:29408448	PMID:29424794
PMID:29433360	PMID:29435098	PMID:29448942	PMID:29457851	PMID:29474348	PMID:29476075	PMID:29481323	PMID:29486138	PMID:29487353	PMID:29498660	PMID:29501041	PMID:29512760
PMID:29515034	PMID:29530794	PMID:29540303	PMID:29542224	PMID:29549163	PMID:29558368	PMID:29571711	PMID:29590092	PMID:29618784	PMID:29621903	PMID:29628876	PMID:29634345
PMID:29649787	PMID:29659176	PMID:29670103	PMID:29670287	PMID:29673700	PMID:29683243	PMID:29684352	PMID:29689442	PMID:29692875	PMID:29694408	PMID:29704532	PMID:29721501
PMID:29730008	PMID:29740449	PMID:29742431	PMID:29742982	PMID:29752288	PMID:29754504	PMID:29764859	PMID:29775963	PMID:29794115	PMID:29799837	PMID:29803835	PMID:29844386
PMID:29860433	PMID:29867516	PMID:29871525	PMID:29905772	PMID:29907708	PMID:29916549	PMID:29917052	PMID:29950142	PMID:29953988	PMID:29959995	PMID:29964168	PMID:29996121
PMID:29997171	PMID:30016619	PMID:30017357	PMID:30018287	PMID:30021365	PMID:30025621	PMID:30028071	PMID:30029164	PMID:30061089	PMID:30070693	PMID:30080657	PMID:30081710
PMID:30105954	PMID:30108253	PMID:30114225	PMID:30120979	PMID:30126895	PMID:30127006	PMID:30140996	PMID:30148822	PMID:30153650	PMID:30171947	PMID:30194014	PMID:30198307
PMID:30200963	PMID:30209334	PMID:30210141	PMID:30248537	PMID:30250973	PMID:30253279	PMID:30261176	PMID:30266650	PMID:30273691	PMID:30281933	PMID:30301527	PMID:30316516
PMID:30318116	PMID:30368232	PMID:30381375	PMID:30391672	PMID:30403148	PMID:30409900	PMID:30426485	PMID:30428342	PMID:30463003	PMID:30470740	PMID:30481822	PMID:30513114
PMID:30520052	PMID:30535439	PMID:30535483	PMID:30538709	PMID:30553970	PMID:30569154	PMID:30586719	PMID:30622671	PMID:30626868	PMID:30638656	PMID:30655574	PMID:30668979
PMID:30674574	PMID:30685263	PMID:30690066	PMID:30692261	PMID:30730004	PMID:30733286	PMID:30756520	PMID:30765703	PMID:30769286	PMID:30796317	PMID:30818059	PMID:30828870
PMID:30831189	PMID:30833408	PMID:30840341	PMID:30850475	PMID:30894323	PMID:30896860	PMID:30897380	PMID:30908580	PMID:30913396	PMID:30950217	PMID:30952864	PMID:30959066
PMID:30995469	PMID:31015205	PMID:31025223	PMID:31026769	PMID:31043271	PMID:31049133	PMID:31056974	PMID:31057560	PMID:31059771	PMID:31144355	PMID:31155513	PMID:31164420
PMID:31169361	PMID:31173878	PMID:31181253	PMID:31187328	PMID:31216030	PMID:31220272	PMID:31248593	PMID:31293067	PMID:31327664	PMID:31350281	PMID:31356919	PMID:31383749
PMID:31385133	PMID:31389006	PMID:31419224	PMID:31426718	PMID:31431502	PMID:31442293	PMID:31442569	PMID:31487225	PMID:31490121	PMID:31491600	PMID:31492498	PMID:31494242
PMID:31494646	PMID:31529356	PMID:31554934	PMID:31556830	PMID:31571363	PMID:31572363	PMID:31601909	PMID:31606431	PMID:31634788	PMID:31661121	PMID:31678598	PMID:31679397
PMID:31704099	PMID:31705858	PMID:31717470	PMID:31722791	PMID:31746357	PMID:31758217	PMID:31760890	PMID:31768838	PMID:31769924	PMID:31774701	PMID:31781321	PMID:31781322
PMID:31781326	PMID:31781345	PMID:31791318	PMID:31796867	PMID:31805612	PMID:31823672	PMID:31868937	PMID:31880208	PMID:31901728	PMID:31913745	PMID:31915502	PMID:31918066
PMID:31932477	PMID:31941842	PMID:31941926	PMID:31945188	PMID:31953037	PMID:31969881	PMID:31972171	PMID:31983610	PMID:31997373	PMID:31998436	PMID:32031966	PMID:32032580
PMID:32043657	PMID:32045430	PMID:32053600	PMID:32071304	PMID:32075740	PMID:32096914	PMID:32147517	PMID:32149102	PMID:32151553	PMID:32171970	PMID:32182211	PMID:32193353
PMID:32197448	PMID:32197464	PMID:32199914	PMID:32213347	PMID:32219872	PMID:32223956	PMID:32234476	PMID:32255424	PMID:32294407	PMID:32295843	PMID:32309436	PMID:32335359
PMID:32347301	PMID:32350570	PMID:32361183	PMID:32365333	PMID:32387618	PMID:32401383	PMID:32407713	PMID:32436623	PMID:32446359	PMID:32454936	PMID:32457102	PMID:32485566
PMID:32487458	PMID:32491225	PMID:32493884	PMID:32500632	PMID:32503880	PMID:32516576	PMID:32520939	PMID:32556090	PMID:32560430	PMID:32566088	PMID:32589943	PMID:32599239
PMID:32601262	PMID:32619021	PMID:32630085	PMID:32636316	PMID:32663195	PMID:32678947	PMID:32690656	PMID:32710977	PMID:32715783	PMID:32727915	PMID:32737764	PMID:32738332
PMID:32751716	PMID:32771520	PMID:32784053	PMID:32791101	PMID:32791187	PMID:32795642	PMID:32802189	PMID:32811851	PMID:32828530	PMID:32858855	PMID:32863231	PMID:32893883
PMID:32896624	PMID:32901092	PMID:32907551	PMID:32912335	PMID:32941941	PMID:32956705	PMID:32967239	PMID:32972446	PMID:32978520	PMID:33001866	PMID:33040827	PMID:33058411
PMID:33067186	PMID:33068552	PMID:33069734	PMID:33077574	PMID:33096251	PMID:33096672	PMID:33096811	PMID:33103077	PMID:33136552	PMID:33152439	PMID:33159886	PMID:33180200
PMID:33199895	PMID:33227565	PMID:33238115	PMID:33238123	PMID:33239093	PMID:33246070	PMID:33248265	PMID:33257504	PMID:33261626	PMID:33270355	PMID:33274009	PMID:33287890
PMID:33298526	PMID:33332723	PMID:33342543	PMID:33368846	PMID:33373776	PMID:33373951	PMID:33390848	PMID:33395605	PMID:33396673	PMID:33418009	PMID:33461765	PMID:33471008
PMID:33486357	PMID:33495836	PMID:33502893	PMID:33505589	PMID:33510137	PMID:33510843	PMID:33520086	PMID:33522359	PMID:33563837	PMID:33567500	PMID:33574984	PMID:33608489
PMID:33628368	PMID:33628382	PMID:33648937	PMID:33654072	PMID:33666795	PMID:33672789	PMID:33691097	PMID:33691909	PMID:33707458	PMID:33710617	PMID:33714958	PMID:33724516
PMID:33752110	PMID:33753237	PMID:33761603	PMID:33770763	PMID:33774279	PMID:33777318	PMID:33820760	PMID:33836179	PMID:33872730	PMID:33876343	PMID:33894310	PMID:33920318
PMID:33933676	PMID:33967806	PMID:33979459	PMID:34013370	PMID:34054582	PMID:34087234	PMID:34089788	PMID:34095879	PMID:34116071	PMID:34129203	PMID:34143548	PMID:34168078
PMID:34168270	PMID:34206048	PMID:34206421	PMID:34218792	PMID:34229009	PMID:34238051	PMID:34245611	PMID:34245771	PMID:34249002	PMID:34249773	PMID:34278519	PMID:34294378
PMID:34313391	PMID:34318973	PMID:34321999	PMID:34332979	PMID:34359956	PMID:34364981	PMID:34403762	PMID:34423582	PMID:34423867	PMID:34426758	PMID:34443628	PMID:34489413
PMID:34516406	PMID:34526660	PMID:34542160	PMID:34547172	PMID:34556021	PMID:34626892	PMID:34628369	PMID:34632658	PMID:34644617	PMID:34663512	PMID:34666603	PMID:34686330
PMID:34697858	PMID:34709991	PMID:34715543	PMID:34716298	PMID:34717678	PMID:34719928	PMID:34730139	PMID:34763297	PMID:34791862	PMID:34823019	PMID:34828261	PMID:34874096
PMID:34882206	PMID:34885708	PMID:34887485	PMID:34890768	PMID:34899723	PMID:34907120	PMID:34917083	PMID:34923041	PMID:34946724	PMID:34975753	PMID:35031770	PMID:35052508
PMID:35076645	PMID:35084215	PMID:35091043	PMID:35092867	PMID:35100024	PMID:35104011	PMID:35124564	PMID:35137128	PMID:35145070	PMID:35157168	PMID:35175494	PMID:35176707
PMID:35189149	PMID:35192689	PMID:35203398	PMID:35204234	PMID:35204252	PMID:35290286	PMID:35290918	PMID:35293971	PMID:35299056	PMID:35323110	PMID:35338853	PMID:35369899
PMID:35381325	PMID:35395160	PMID:35426488	PMID:35455944	PMID:35480867	PMID:35480874	PMID:35523338	PMID:35534896	PMID:35561328	PMID:35577980	PMID:35579787	PMID:35588739
PMID:35588955	PMID:35615581	PMID:35624708	PMID:35644004	PMID:35655024	PMID:35661779	PMID:35668451	PMID:35674451	PMID:35682851	PMID:35696363	PMID:35718142	PMID:35728579
PMID:35839861	PMID:35849954	PMID:35849971	PMID:35921423	PMID:35987144	PMID:35993019	PMID:35993020	PMID:36014382	PMID:36018411	PMID:36030105	PMID:36036912	PMID:36063728
PMID:36096356	PMID:36115578	PMID:36115584	PMID:36148996	PMID:36150560	PMID:36155082	PMID:36162528	PMID:36209041	PMID:36233013	PMID:36238648	PMID:36243294	PMID:36244590
PMID:36245360	PMID:36248746	PMID:36252808	PMID:36272670	PMID:36287630	PMID:36291188	PMID:36309297	PMID:36310172	PMID:36316319	PMID:36334846	PMID:36335764	PMID:36351395
PMID:36359788	PMID:36367485	PMID:36403522	PMID:36421460	PMID:36434613	PMID:36460215	PMID:36461597	PMID:36495698	PMID:36497087	PMID:36539414	PMID:36552789	PMID:36555529
PMID:36592659	PMID:36646002	PMID:36700398	PMID:36720308	PMID:36730842	PMID:36765507	PMID:36766760	PMID:36772996	PMID:36780671	PMID:36791501	PMID:36847832	PMID:36849508
PMID:36862034	PMID:36878272	PMID:36883011	PMID:36893944	PMID:36908855	PMID:36940606	PMID:36940733	PMID:36950983	PMID:36963288	PMID:36976489	PMID:36988555	PMID:37022178
PMID:37060393	PMID:37060561	PMID:37062029	PMID:37062868	PMID:37113990	PMID:37122744	PMID:37126714	PMID:37156294	PMID:37172425	PMID:37199892	PMID:37201674	PMID:37219513
PMID:37224754	PMID:37232576	PMID:37239374	PMID:37245295	PMID:37254290	PMID:37264926	PMID:37265366	PMID:37267508	PMID:37269088	PMID:37286028	PMID:37291151	PMID:37336368
PMID:37339955	PMID:37364049	PMID:37399841	PMID:37422785	PMID:37423156	PMID:37451369	PMID:37490064	PMID:37490346	PMID:37494986	PMID:37501930	PMID:37531930	PMID:37549281
PMID:37550596	PMID:37567517	PMID:37597423	PMID:37598463	PMID:37614147	PMID:37619958	PMID:37626149	PMID:37657135	PMID:37657745	PMID:37686150	PMID:37686229	PMID:37712971
PMID:37728319	PMID:37735410	PMID:37756544	PMID:37760019	PMID:37772380	PMID:37777065	PMID:37801897	PMID:37852547	PMID:37855941	PMID:37857700	PMID:37857886	PMID:37862331
PMID:37872565	PMID:37875930	PMID:37875948	PMID:37894993	PMID:37904612	PMID:37931470	PMID:37948457	PMID:37950788	PMID:37965327	PMID:37984250	PMID:37996447	PMID:37996761
PMID:38000461	PMID:38009195	PMID:38019476	PMID:38031934	PMID:38056897	PMID:38060331	PMID:38063237	PMID:38085578	PMID:38104863	PMID:38154380	PMID:38184999	PMID:38206362
PMID:38233202	PMID:38244516	PMID:38244728	PMID:38266827	PMID:38285461	PMID:38307257	PMID:38308838	PMID:38308910	PMID:38331008	PMID:38332738	PMID:38335300	PMID:38355793
PMID:38383481	PMID:38395995	PMID:38436106	PMID:38438409	PMID:38479223	PMID:38488001	PMID:38488331	PMID:38489253	PMID:38505605	PMID:38506079	PMID:38521055	PMID:38532242
PMID:38537677	PMID:38556546	PMID:38583440	PMID:38584093	PMID:38600378	PMID:38602872	PMID:38725855	PMID:38745644	PMID:38750095	PMID:38761895	PMID:38771415	PMID:38772213
PMID:38777204	PMID:38801840	PMID:38830896	PMID:38837857	PMID:38845495	PMID:38870781	PMID:38879114	PMID:38891776	PMID:38892383	PMID:38917524	PMID:38963974	PMID:38967258
PMID:38977770	PMID:39034312	PMID:39038764	PMID:39048051	PMID:39079388	PMID:39125617	PMID:39136472	PMID:39172462	PMID:39233044	PMID:39238946	PMID:39239519	PMID:39244752
PMID:39313617	PMID:39328932	PMID:39334742	PMID:39351765	PMID:39519380	PMID:39690148

Genomics

Comparative Map Data

Nfe2l2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	75,505,860 - 75,535,007 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	75,505,857 - 75,534,985 (-)	Ensembl		GRCm39 Ensembl
GRCm38	2	75,675,513 - 75,704,663 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	75,675,513 - 75,704,641 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	2	75,513,576 - 75,542,698 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	2	75,476,358 - 75,505,480 (-)	NCBI		MGSCv36	mm8
Celera	2	77,336,615 - 77,365,680 (-)	NCBI		Celera
Cytogenetic Map	2	C3	NCBI
cM Map	2	44.75	NCBI

NFE2L2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	2	177,230,303 - 177,264,727 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	2	177,218,667 - 177,392,756 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	2	178,095,031 - 178,129,455 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	2	177,803,282 - 177,837,663 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	2	177,920,542 - 177,954,924	NCBI
Celera	2	171,697,459 - 171,732,295 (-)	NCBI		Celera
Cytogenetic Map	2	q31.2	NCBI
HuRef	2	169,966,324 - 170,001,125 (-)	NCBI		HuRef
CHM1_1	2	178,100,863 - 178,135,685 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	2	177,712,539 - 177,746,971 (-)	NCBI		T2T-CHM13v2.0

Nfe2l2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	81,001,529 - 81,031,165 (-)	NCBI		GRCr8
mRatBN7.2	3	60,594,239 - 60,621,712 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	60,594,242 - 60,621,737 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	63,968,507 - 63,995,961 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	72,552,163 - 72,579,616 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	70,318,419 - 70,345,871 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	62,497,568 - 62,525,146 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	62,497,571 - 62,524,996 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	69,041,641 - 69,069,190 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	58,366,693 - 58,394,116 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	58,263,064 - 58,290,488 (-)	NCBI
Celera	3	60,095,041 - 60,122,464 (-)	NCBI		Celera
Cytogenetic Map	3	q23	NCBI

Nfe2l2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955403	19,532,103 - 19,535,944 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955403	19,510,122 - 19,536,428 (+)	NCBI	ChiLan1.0	ChiLan1.0

NFE2L2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	13	79,896,932 - 80,058,685 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	2B	79,911,905 - 80,073,664 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	2B	64,509,446 - 64,544,600 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	2B	182,214,116 - 182,248,282 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	2B	182,214,116 - 182,248,085 (-)	Ensembl	panpan1.1		panPan2

NFE2L2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	36	20,989,205 - 21,087,044 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	36	20,989,360 - 21,012,524 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	36	21,008,912 - 21,151,059 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	36	21,133,291 - 21,275,953 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	36	21,133,296 - 21,276,012 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	36	21,203,925 - 21,237,606 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	36	21,205,089 - 21,302,516 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	36	21,320,865 - 21,418,596 (-)	NCBI		UU_Cfam_GSD_1.0

Nfe2l2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405303	138,036,230 - 138,177,608 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936509	6,590,630 - 6,620,262 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936509	6,589,967 - 6,621,171 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

NFE2L2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	15	82,973,656 - 83,146,183 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	15	82,967,485 - 83,146,185 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	15	92,433,294 - 92,469,024 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

NFE2L2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	10	62,789,647 - 62,825,651 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	10	62,790,124 - 62,825,339 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666040	136,640,202 - 136,820,663 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Nfe2l2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624787	14,355,791 - 14,381,251 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624787	14,355,330 - 14,381,353 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Nfe2l2
1401 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	207
Count of miRNA genes:	189
Interacting mature miRNAs:	199
Transcripts:	ENSMUST00000102672, ENSMUST00000152371
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCm39)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
13464141	Hbbcq3_m	hemoglobin concentration QTL 3 (mouse)					2	52448019	86448136	Mouse
13824983	Vclq1_m	curvilinear velocity QTL 1 (mouse)					2	61830344	136841920	Mouse
1301402	Ap2q_m	alcohol preference 2 QTL (mouse)			Not determined		2	43520612	77520756	Mouse
1300761	Lgth1_m	body length 1 (mouse)			Not determined		2	51703276	85703425	Mouse
4141236	Hbnr5_m	Heligmosomoides bakeri nematode resistance 5 (mouse)			Not determined			31214567	105143570	Mouse
1302174	Dssc2_m	dextran sodium sulfate induced colitis QTL2 (mouse)			Not determined		2	24224632	148700377	Mouse
1301405	Etohr_m	ethanol response acute (mouse)			Not determined		2	63005954	97006113	Mouse
1301660	Iba1_m	induction of brown adipocytes 1 (mouse)			Not determined		2	67647887	101648142	Mouse
1558915	W3q1_m	weight 3 weeks QTL 1 (mouse)			Not determined		2	20897778	118894840	Mouse
1300875	Taste1_m	taste-saccharin preference 1 (mouse)			Not determined		2	50923175	84923278	Mouse
1301769	Orgwq2_m	organ weight QTL 2 (mouse)			Not determined		2	3887126	93421651	Mouse
1357454	Kidq1_m	kidney weight QTL 1 (mouse)			Not determined		2	20897778	118894840	Mouse
1357577	Trmq3_m	T cell ratio modifier QTL 3 (mouse)			Not determined		2	60520612	119355518	Mouse
1558966	W10q9_m	weight 10 weeks QTL 9 (mouse)			Not determined		2	20897778	118894840	Mouse
4141854	T2dm2sa_m	type 2 diabetes mellitus 2 in SMXA RI mice (mouse)			Not determined		2	29307947	148374934	Mouse
1300662	Etohila_m	ethanol induced locomotor activity (mouse)			Not determined		2	63005954	97006113	Mouse
1300788	Cia2_m	collagen induced arthritis QTL 2 (mouse)			Not determined		2	43520612	77520756	Mouse
10053681	Lith24_m	lithogenic gene 24 (mouse)			Not determined		2	63005954	97006113	Mouse
1301048	Actre2_m	activity response to ethanol 2 (mouse)			Not determined		2	63005954	97006113	Mouse
1300671	Cia4_m	collagen induced arthritis QTL 4 (mouse)			Not determined		2	43520612	77520756	Mouse
1357881	Estoq1_m	embryo survival total QTL 1 (mouse)			Not determined		2	20897778	118894840	Mouse
5491197	Mobq5_m	multigenic obesity QTL 5 (mouse)			Not determined		2	65269746	162518926	Mouse
1301948	Elsgp3_m	elevated serum gp70 3 (mouse)			Not determined		2	68724269	102724407	Mouse
1301411	Pitm1_m	prion incubation time 1 (mouse)			Not determined		2	43520612	77520756	Mouse
4141069	Pbwg1.5_m	postnatal body weight growth 1.5 (mouse)			Not determined			43520612	77520756	Mouse
1558820	Moo1_m	modifier of Odc1 (mouse)			Not determined		17	48269746	82269934	Mouse
4142088	Parms1_m	patched associated RMS 1 (mouse)			Not determined			74524117	114123532	Mouse
12738429	Lfibq18_m	liver fibrosis QTL 18 (mouse)					2	57919991	91919991	Mouse
39128209	Lwq14_m	liver weight QTL 14 (mouse)					2	20897778	118894840	Mouse
1558738	W6q1_m	weight 6 weeks QTL 1 (mouse)			Not determined		2	20897778	118894840	Mouse
11528549	Sluc31_m	susceptibility to lung cancer 31 (mouse)					2	74524117	129213005	Mouse
1300568	Hdl1_m	high density lipoprotein (HDL) level 1 (mouse)			Not determined		2	48269746	82269934	Mouse
1301703	Bomd3_m	bone mineral density 3 (mouse)			Not determined		2	63005954	97006113	Mouse
1301747	Eae21_m	experimental allergic encephalomyelitis 21 (mouse)			Not determined		2	48269746	82269934	Mouse
1301235	Alcw4_m	alcohol withdrawal 4 (mouse)			Not determined		2	48269746	82269934	Mouse
4141406	Alpq2_m	alcohol preference QTL 2 (mouse)			Not determined		2	57524117	91524288	Mouse
10755526	Lymph1_m	lymphocyte differential 1 (mouse)					2	50819314	84819314	Mouse
13463471	Hctq6_m	hematocrit QTL 6 (mouse)					2	52448019	86448136	Mouse
1301873	Hsl1_m	hyperoxia susceptibility locus 1 (mouse)			Not determined		2	63570154	97570301	Mouse
1558899	Egq1_m	early growth QTL 1 (mouse)			Not determined		2	20897778	118894840	Mouse
1357681	Hrtq1_m	heart weight QTL 1 (mouse)			Not determined		2	20897778	118894840	Mouse
1301109	Dntcs2_m	dental caries susceptibility 2 (mouse)			Not determined		2	40885493	114910165	Mouse
1357436	Splq1_m	spleen weight QTL 1 (mouse)			Not determined		2	20897778	118894840	Mouse
10755532	Lymph5_m	lymphocyte differential 5 (mouse)					2	44199017	78199017	Mouse
1301882	Etohc2_m	ethanol consumption 2 (mouse)			Not determined		2	68724269	102724407	Mouse
11532740	Pbwg1.10_m	postnatal body weight growth 1.10 (mouse)					2	48132412	82132495	Mouse
1300577	Capsq1_m	capsaicin sensitivity related QTL 1 (mouse)			Not determined		2	27602060	84013384	Mouse
1301344	Lith1_m	lithogenic gene 1 (mouse)			Not determined		2	45347635	145312647	Mouse
13463482	Mchq17_m	mean corpuscular hemoglobin QTL 17 (mouse)					2	67647887	101648142	Mouse
1301480	Pbwg1_m	postnatal body weight growth 1 (mouse)			Not determined		2	41820719	75820843	Mouse
10044002	Hdl7_m	HDL level 7 (mouse)			Not determined		2	63005954	97006113	Mouse

Markers in Region

RH135926

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	2	75,676,183 - 75,676,387	UniSTS	GRCm38
MGSCv37	2	75,514,240 - 75,514,444	UniSTS	GRCm37
Celera	2	77,337,279 - 77,337,483	UniSTS
Cytogenetic Map	2	C3	UniSTS
cM Map	2	45.0	UniSTS

BB236304

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	2	75,683,572 - 75,683,688	UniSTS	GRCm38
MGSCv37	2	75,521,629 - 75,521,745	UniSTS	GRCm37
Celera	2	77,344,627 - 77,344,743	UniSTS
Cytogenetic Map	2	C3	UniSTS
cM Map	2	45.0	UniSTS
Whitehead/MRC_RH	2	1182.15	UniSTS

Nfe2l2

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	2	75,676,395 - 75,677,594	UniSTS	GRCm38
MGSCv37	2	75,514,452 - 75,515,651	UniSTS	GRCm37
Celera	2	77,337,491 - 77,338,690	UniSTS
Cytogenetic Map	2	C3	UniSTS
cM Map	2	45.0	UniSTS

BI284301

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	2	75,675,985 - 75,676,141	UniSTS	GRCm38
MGSCv37	2	75,514,042 - 75,514,198	UniSTS	GRCm37
Celera	2	77,337,081 - 77,337,237	UniSTS
Cytogenetic Map	2	C3	UniSTS
cM Map	2	45.0	UniSTS

PMC133753P2

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	2	75,705,119 - 75,705,225	UniSTS	GRCm38
MGSCv37	2	75,543,176 - 75,543,282	UniSTS	GRCm37
Celera	2	77,366,157 - 77,366,263	UniSTS
Cytogenetic Map	2	C3	UniSTS
cM Map	2	45.0	UniSTS

PMC30667P1

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	2	75,676,112 - 75,676,844	UniSTS	GRCm38
MGSCv37	2	75,514,169 - 75,514,901	UniSTS	GRCm37
Celera	2	77,337,208 - 77,337,940	UniSTS
Cytogenetic Map	2	C3	UniSTS
cM Map	2	45.0	UniSTS

BB205564

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	2	75,691,355 - 75,691,462	UniSTS	GRCm38
MGSCv37	2	75,529,412 - 75,529,519	UniSTS	GRCm37
Celera	2	77,352,402 - 77,352,509	UniSTS
Cytogenetic Map	2	C3	UniSTS
cM Map	2	45.0	UniSTS
Whitehead/MRC_RH	2	1182.88	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001399226	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_010902	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AH006764	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK029360	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK142347	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK144247	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AL772404	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC003340	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC026943	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC057948	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BY792550	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH466519	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U20532	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSMUST00000102672 ⟹ ENSMUSP00000099733

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	2	75,505,857 - 75,534,985 (-)	Ensembl
GRCm38.p6 Ensembl	2	75,675,513 - 75,704,641 (-)	Ensembl

Ensembl Acc Id:

ENSMUST00000152371

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	2	75,521,396 - 75,534,833 (-)	Ensembl
GRCm38.p6 Ensembl	2	75,691,052 - 75,704,489 (-)	Ensembl

RefSeq Acc Id:

NM_001399226 ⟹ NP_001386155

RefSeq Status:

REVIEWED

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39	2	75,521,396 - 75,535,007 (-)	NCBI

RefSeq Acc Id:

NM_010902 ⟹ NP_035032

RefSeq Status:

REVIEWED

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39	2	75,505,860 - 75,534,860 (-)	NCBI
GRCm38	2	75,675,513 - 75,704,663 (-)	NCBI
MGSCv37	2	75,513,576 - 75,542,698 (-)	RGD
Celera	2	77,336,615 - 77,365,680 (-)	RGD
cM Map	2		ENTREZGENE

Sequence:

show sequence

CTCCATGCCCTTGTCCTGCCTCTGGCCCTTGCCTCTTGCCCTAGCCTTTTCTCCGCCTCTAAGT
TCTTGTCCCGTCCCTAGGTCCTTGTTCCGCCCCCAGGGGGCGGGGGCGGGGCGGACTAAGGCTG
GCCTGCCACTCCAGCGAGCAGGCTATCTCCTAGTTCTCCGCTGCTCGGACTAGCCATTGCCGCC
GCCTCACCTCTGCTGCAAGTAGCCTCGCCGTCGGGGAGCCCTACCACAGCGTCCGCCCTCAGCA
TGATGGACTTGGAGTTGCCACCGCCAGGACTACAGTCCCAGCAGGACATGGATTTGATTGACAT
CCTTTGGAGGCAAGACATAGATCTTGGAGTAAGTCGAGAAGTGTTTGACTTTAGTCAGCGACAG
AAGGACTATGAGCTGGAAAAACAGAAAAAACTCGAAAAGGAAAGACAAGAGCAACTCCAGAAGG
AACAGGAGAAGGCCTTTTTTGCTCAGTTTCAACTGGATGAAGAAACAGGAGAATTCCTCCCAAT
TCAGCCGGCCCAGCACATCCAGACAGACACCAGTGGATCCGCCAGCTACTCCCAGGTTGCCCAC
ATTCCCAAACAAGATGCCTTGTACTTTGAAGACTGTATGCAGCTTTTGGCAGAGACATTCCCAT
TTGTAGATGACCATGAGTCGCTTGCCCTGGATATCCCCAGCCACGCTGAAAGTTCAGTCTTCAC
TGCCCCTCATCAGGCCCAGTCCCTCAATAGCTCTCTGGAGGCAGCCATGACTGATTTAAGCAGC
ATAGAGCAGGACATGGAGCAAGTTTGGCAGGAGCTATTTTCCATTCCCGAATTACAGTGTCTTA
ATACCGAAAACAAGCAGCTGGCTGATACTACCGCTGTTCCCAGCCCAGAAGCCACACTGACAGA
AATGGACAGCAATTACCATTTTTACTCATCGATCTCCTCGCTGGAAAAAGAAGTGGGCAACTGT
GGTCCACATTTCCTTCATGGTTTTGAGGATTCTTTCAGCAGCATCCTCTCCACTGATGATGCCA
GCCAGCTGACCTCCTTAGACTCAAATCCCACCTTAAACACAGATTTTGGCGATGAATTTTATTC
TGCTTTCATAGCAGAGCCCAGTGACGGTGGCAGCATGCCTTCCTCCGCTGCCATCAGTCAGTCA
CTCTCTGAACTCCTGGACGGGACTATTGAAGGCTGTGACCTGTCACTGTGTAAAGCTTTCAACC
CGAAGCACGCTGAAGGCACAATGGAATTCAATGACTCTGACTCTGGCATTTCACTGAACACGAG
TCCCAGCCGAGCGTCCCCAGAGCACTCCGTGGAGTCTTCCATTTACGGAGACCCACCGCCTGGG
TTCAGTGACTCGGAAATGGAGGAGCTAGATAGTGCCCCTGGAAGTGTCAAACAGAACGGCCCTA
AAGCACAGCCAGCACATTCTCCTGGAGACACAGTACAGCCTCTGTCACCAGCTCAAGGGCACAG
TGCTCCTATGCGTGAATCCCAATGTGAAAATACAACAAAAAAAGAAGTTCCCGTGAGTCCTGGT
CATCAAAAAGCCCCATTCACAAAAGACAAACATTCAAGCCGCTTAGAGGCTCATCTCACACGAG
ATGAGCTTAGGGCAAAAGCTCTCCATATTCCATTCCCTGTCGAAAAAATCATTAACCTCCCTGT
TGATGACTTCAATGAAATGATGTCCAAGGAGCAATTCAATGAAGCTCAGCTCGCATTGATCCGA
GATATACGCAGGAGAGGTAAGAATAAAGTCGCCGCCCAGAACTGTAGGAAAAGGAAGCTGGAGA
ACATTGTCGAGCTGGAGCAAGACTTGGGCCACTTAAAAGACGAGAGAGAAAAACTACTCAGAGA
AAAGGGAGAAAACGACAGAAACCTCCATCTACTGAAAAGGCGGCTCAGCACCTTGTATCTTGAA
GTCTTCAGCATGTTACGTGATGAGGATGGAAAGCCTTACTCTCCCAGTGAATACTCTCTGCAGC
AAACCAGAGATGGCAATGTGTTCCTTGTTCCCAAAAGCAAGAAGCCAGATACAAAGAAAAACTA
GGTTCGGGAGGATGGAGCCTTTTCTGAGCTAGTGTTTGTTTTGTACTGCTAAAACTTCCTACTG
TGATGTGAAATGCAGAAACACTTTATAAGTAACTATGCAGAATTATAGCCAAAGCTAGTATAGC
AATAATATGAAACTTTACAAAGCATTAAAGTCTCAATGTTGAATCAGTTTCATTTTAACTCTCA
AGTTAATTTCTTAGGCACCATTTGGGAGAGTTTCTGTTTAAGTGTAAATACTACAGAACTTATT
TATACTGTTCTCACTTGTTACAGTCATAGACTTATATGACATCTGGCTAAAAGCAAACTATTGA
AAACTAACCAGACCACTATACTTTTTTATATACTGTATGAACAGGAAATGACATTTTTATATTA
AATTGTTTAGCTCATAAAAATTAAAAGGAGCTAGCACTAATAAAAGAATATCATGACTTAAACT
A

hide sequence

Protein Sequences


Protein RefSeqs	NP_001386155	(Get FASTA)	NCBI Sequence Viewer
	NP_035032	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA68291	(Get FASTA)	NCBI Sequence Viewer
	AAC52983	(Get FASTA)	NCBI Sequence Viewer
	AAH03340	(Get FASTA)	NCBI Sequence Viewer
	AAH26943	(Get FASTA)	NCBI Sequence Viewer
	BAE25040	(Get FASTA)	NCBI Sequence Viewer
	EDL27192	(Get FASTA)	NCBI Sequence Viewer
	EDL27193	(Get FASTA)	NCBI Sequence Viewer
	EDL27194	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSMUSP00000099733
	ENSMUSP00000099733.5
GenBank Protein	Q60795	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_035032 ⟸ NM_010902
- Peptide Label:	isoform 1
- UniProtKB:	Q3UQK0 (UniProtKB/Swiss-Prot), Q60795 (UniProtKB/Swiss-Prot)
- Sequence:	show sequence MMDLELPPPGLQSQQDMDLIDILWRQDIDLGVSREVFDFSQRQKDYELEKQKKLEKERQEQLQK EQEKAFFAQFQLDEETGEFLPIQPAQHIQTDTSGSASYSQVAHIPKQDALYFEDCMQLLAETFP FVDDHESLALDIPSHAESSVFTAPHQAQSLNSSLEAAMTDLSSIEQDMEQVWQELFSIPELQCL NTENKQLADTTAVPSPEATLTEMDSNYHFYSSISSLEKEVGNCGPHFLHGFEDSFSSILSTDDA SQLTSLDSNPTLNTDFGDEFYSAFIAEPSDGGSMPSSAAISQSLSELLDGTIEGCDLSLCKAFN PKHAEGTMEFNDSDSGISLNTSPSRASPEHSVESSIYGDPPPGFSDSEMEELDSAPGSVKQNGP KAQPAHSPGDTVQPLSPAQGHSAPMRESQCENTTKKEVPVSPGHQKAPFTKDKHSSRLEAHLTR DELRAKALHIPFPVEKIINLPVDDFNEMMSKEQFNEAQLALIRDIRRRGKNKVAAQNCRKRKLE NIVELEQDLGHLKDEREKLLREKGENDRNLHLLKRRLSTLYLEVFSMLRDEDGKPYSPSEYSLQ QTRDGNVFLVPKSKKPDTKKN hide sequence

Ensembl Acc Id:

ENSMUSP00000099733 ⟸ ENSMUST00000102672

RefSeq Acc Id:	NP_001386155 ⟸ NM_001399226
- Peptide Label:	isoform 2

Protein Domains

bZIP

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q60795-F1-model_v2	AlphaFold	Q60795	1-597	view protein structure

Promoters

RGD ID:

6830641

Promoter ID:

MM_KWN:29789

Type:

CpG-Island

SO ACC ID:

SO:0000170

Source:

MPROMDB

Tissues & Cell Lines:

3T3L1_Day0, 3T3L1_Day1, 3T3L1_Day2, 3T3L1_Day3, 3T3L1_Day4, 3T3L1_Day6, BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, Brain, ES_Cell, Kidney, Liver, Lung, MEF_B4, MEF_B6, Spleen

Transcripts:

AK031731_6030499A19RIK, OTTMUST00000032002, OTTMUST00000032007, UC008KER.1

Position:

Mouse Assembly	Chr	Position (strand)	Source
MGSCv36	2	75,540,231 - 75,543,282 (-)	MPROMDB

RGD ID:

6877686

Promoter ID:

EPDNEW_M2293

Type:

initiation region

Name:

Nfe2l2_1

Description:

Mus musculus nuclear factor, erythroid derived 2, like 2 , transcriptvariant 2, non-coding RNA.

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm38	2	75,704,504 - 75,704,564	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	MGI:108420	AgrOrtholog
Ensembl Genes	ENSMUSG00000015839	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSMUST00000102672	ENTREZGENE
	ENSMUST00000102672.5	UniProtKB/Swiss-Prot
	ENSMUST00000152371	ENTREZGENE
Gene3D-CATH	Transcription factor, Skn-1-like, DNA-binding domain	UniProtKB/Swiss-Prot
InterPro	bZIP	UniProtKB/Swiss-Prot
	bZIP_Maf	UniProtKB/Swiss-Prot
	bZIP_sf	UniProtKB/Swiss-Prot
	NFE2-like	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	TF_DNA-bd_sf	UniProtKB/Swiss-Prot
KEGG Report	mmu:18024	UniProtKB/Swiss-Prot
MGD	MGI:108420	ENTREZGENE
NCBI Gene	18024	ENTREZGENE
PANTHER	NUCLEAR FACTOR ERYTHROID 2-RELATED FACTOR	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR24411:SF3	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	bZIP_Maf	UniProtKB/Swiss-Prot
PhenoGen	Nfe2l2	PhenoGen
PROSITE	BZIP	UniProtKB/Swiss-Prot
	BZIP_BASIC	UniProtKB/Swiss-Prot
SMART	BRLZ	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF47454	UniProtKB/Swiss-Prot
	SSF57959	UniProtKB/Swiss-Prot
UniProt	NF2L2_MOUSE	UniProtKB/Swiss-Prot
	Q05DU7_MOUSE	UniProtKB/TrEMBL
	Q3UQK0	ENTREZGENE
	Q60795	ENTREZGENE
UniProt Secondary	Q3UQK0	UniProtKB/Swiss-Prot

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Mammalian Phenotype

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Mammalian Phenotype