Bcl10 (B cell leukemia/lymphoma 10)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Bcl10 (B cell leukemia/lymphoma 10) Mus musculus

Analyze

Symbol:

Bcl10

Name:

B cell leukemia/lymphoma 10

RGD ID:

733736

MGI Page

MGI

Description:

Enables CARD domain binding activity and identical protein binding activity. Involved in antifungal innate immune response; neural tube closure; and regulation of gene expression. Acts upstream of or within several processes, including cellular defense response; lymphocyte apoptotic process; and regulation of signal transduction. Located in cytosol; immunological synapse; and membrane raft. Part of CBM complex and polkadots. Is expressed in several structures, including adipose tissue; alimentary system; central nervous system; sensory organ; and vibrissa follicle. Human ortholog(s) of this gene implicated in extranodal marginal zone lymphoma of mucosa-associated lymphoid tissue; immunodeficiency 37; malignant mesothelioma; and non-Hodgkin lymphoma. Orthologous to human BCL10 (BCL10 immune signaling adaptor).

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

AI132454; B-cell CLL/lymphoma 10; B-cell leukemia/lymphoma 10; B-cell lymphoma/leukemia 10; BCL-1; BCL-10; c-E10; C81403; CARD-containing molecule enhancing NF-kappa-B; CARD-like apoptotic protein; CARMEN; cCARMEN; cE10; CED-3/ICH-1 prodomain homologous E10-like regulator; cellular homolog of vCARMEN; cellular-E10; CIPER; CLAP; mammalian CARD-containing adapter molecule E10; mCIPER; mCLAP; ME10

RGD Orthologs

Human

Rat

Chinchilla

Bonobo

Dog

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	BCL10 (BCL10 immune signaling adaptor)	HGNC	Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):	Bcl10 (BCL10, immune signaling adaptor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Bcl10 (BCL10 immune signaling adaptor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	BCL10 (BCL10 immune signaling adaptor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	BCL10 (BCL10 immune signaling adaptor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Bcl10 (BCL10 immune signaling adaptor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	BCL10 (BCL10 immune signaling adaptor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	BCL10 (BCL10 immune signaling adaptor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Bcl10 (BCL10 immune signaling adaptor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Rattus norvegicus (Norway rat):	Bcl10 (BCL10, immune signaling adaptor)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	BCL10 (BCL10 immune signaling adaptor)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	bcl10 (BCL10 immune signaling adaptor)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid\|ZFIN)

Related Pseudogenes:

Gm6141

Latest Assembly:

GRCm39 - Mouse Genome Assembly GRCm39

Position:

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	3	145,630,017 - 145,640,121 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	3	145,628,559 - 145,640,111 (+)	Ensembl		GRCm39 Ensembl
GRCm38	3	145,924,262 - 145,934,366 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	3	145,922,804 - 145,934,356 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	3	145,587,342 - 145,597,247 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	3	145,861,764 - 145,871,669 (+)	NCBI		MGSCv36	mm8
Celera	3	152,377,901 - 152,387,817 (+)	NCBI		Celera
Cytogenetic Map	3	H2	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

colon carcinoma (ISO)

extranodal marginal zone lymphoma of mucosa-associated lymphoid tissue (ISO)

follicular lymphoma (ISO)

genetic disease (ISO)

immunodeficiency 37 (ISO)

malignant mesothelioma (ISO)

marginal zone lymphoma (ISO)

Mesothelioma (ISO)

non-Hodgkin lymphoma (ISO)

Sezary's disease (ISO)

T-cell acute lymphoblastic leukemia (ISO)

testicular cancer (ISO)

Testicular Germ Cell Tumor (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-pilocarpine (ISO)

1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane (ISO)

1,2-dimethylhydrazine (EXP)

1-naphthyl isothiocyanate (ISO)

1H-pyrazole (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2-hydroxypropanoic acid (ISO)

2-methoxyethanol (ISO)

3-methylcholanthrene (EXP)

acrylamide (ISO)

aflatoxin B1 (ISO)

ammonium chloride (ISO)

aripiprazole (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenous acid (ISO)

benzo[a]pyrene (EXP,ISO)

bisphenol A (ISO)

cadmium dichloride (ISO)

calcitriol (ISO)

capsaicin (ISO)

carbon nanotube (EXP)

carmustine (ISO)

cisplatin (ISO)

cobalt dichloride (ISO)

copper atom (ISO)

copper(0) (ISO)

copper(II) sulfate (ISO)

crocidolite asbestos (ISO)

curcumin (ISO)

cyclosporin A (ISO)

deoxynivalenol (ISO)

diarsenic trioxide (ISO)

dibutyl phthalate (EXP,ISO)

dioxygen (EXP,ISO)

doxorubicin (ISO)

ethanol (EXP)

ethyl methanesulfonate (ISO)

fluoranthene (EXP)

folic acid (EXP)

formaldehyde (ISO)

furan (ISO)

furosemide (ISO)

genistein (EXP,ISO)

gentamycin (ISO)

glyphosate (ISO)

hydrogen peroxide (ISO)

iron atom (ISO)

iron(0) (ISO)

ivermectin (ISO)

lead diacetate (EXP)

methyl methanesulfonate (ISO)

methylmercury chloride (ISO)

Myrtucommulone A (EXP)

N-methyl-N-nitrosourea (ISO)

N-nitrosodiethylamine (EXP)

nickel dichloride (ISO)

nitrates (ISO)

o-anisidine (ISO)

ozone (ISO)

p-menthan-3-ol (ISO)

paracetamol (EXP,ISO)

paraquat (ISO)

pentobarbital (ISO)

phenobarbital (ISO)

phosgene (EXP)

pirinixic acid (EXP)

rac-lactic acid (ISO)

resveratrol (ISO)

silicon dioxide (EXP)

sulforaphane (EXP)

testosterone (ISO)

tetrachloromethane (EXP,ISO)

thioacetamide (ISO)

titanium dioxide (EXP)

Tributyltin oxide (EXP,ISO)

triptonide (EXP)

valproic acid (EXP)

vancomycin (EXP)

zinc atom (ISO)

zinc(0) (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

activation of cysteine-type endopeptidase activity involved in apoptotic process (ISO)

adaptive immune response (IBA,ISO)

antifungal innate immune response (IDA)

apoptotic process (IEA)

B cell apoptotic process (IDA,IMP)

cell death (ISO)

cellular defense response (IMP)

cellular response to lipopolysaccharide (ISO)

cellular response to mechanical stimulus (ISO)

fibroblast apoptotic process (IMP)

I-kappaB kinase/NF-kappaB signaling (IBA,IMP,ISO)

immune system process (IEA)

immunoglobulin mediated immune response (IMP)

innate immune response (IEA,ISO)

lipopolysaccharide-mediated signaling pathway (ISO)

mast cell activation (NAS)

negative regulation of mature B cell apoptotic process (ISO)

neural tube closure (IMP)

positive regulation of apoptotic process (ISO)

positive regulation of cysteine-type endopeptidase activity involved in apoptotic process (IDA,ISO)

positive regulation of cytokine production (IDA)

positive regulation of DNA-templated transcription (ISO)

positive regulation of execution phase of apoptosis (ISO)

positive regulation of extrinsic apoptotic signaling pathway (IBA,IDA,ISO)

positive regulation of I-kappaB kinase/NF-kappaB signaling (ISO)

positive regulation of interleukin-8 production (ISO)

positive regulation of JUN kinase activity (ISO)

positive regulation of NF-kappaB transcription factor activity (IDA,ISO)

positive regulation of phosphorylation (ISO)

positive regulation of protein ubiquitination (ISO)

positive regulation of T cell activation (IMP)

positive regulation of T cell receptor signaling pathway (ISO)

programmed cell death (ISO)

protein homooligomerization (ISO)

regulation of apoptotic process (IEA)

regulation of T cell receptor signaling pathway (IMP)

response to food (ISO)

response to fungus (IMP)

T cell apoptotic process (IDA,IMP)

T cell receptor signaling pathway (ISO)

thymocyte apoptotic process (IMP)

toll-like receptor signaling pathway (ISO)

Cellular Component

CBM complex (IBA,IDA,ISO)

cytoplasm (IDA,ISO)

cytoplasmic microtubule (ISO)

cytosol (IBA,IDA,ISO)

cytosol (ISO)

cytosol (TAS)

immunological synapse (IDA)

lysosome (ISO)

membrane (IEA)

membrane raft (IDA)

nucleus (ISO)

perinuclear region of cytoplasm (ISO)

polkadots (IDA)

protein-containing complex (ISO)

Molecular Function

CARD domain binding (IPI)

cysteine-type endopeptidase activator activity involved in apoptotic process (ISO)

enzyme binding (ISO)

general transcription initiation factor binding (ISO)

identical protein binding (IPI,ISO)

kinase activator activity (IBA,ISO)

kinase binding (ISO)

NF-kappaB binding (IBA,ISO)

obsolete protein C-terminus binding (ISO)

protease binding (ISO)

protein binding (IPI,ISO)

protein heterodimerization activity (ISO)

protein homodimerization activity (ISO)

protein kinase B binding (IBA,ISO)

protein kinase binding (ISO)

protein self-association (ISO)

protein-containing complex binding (ISO)

transcription coactivator activity (IBA,ISO)

ubiquitin protein ligase binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

B cell receptor signaling pathway (IEA)

nuclear factor kappa B signaling pathway (ISO)

T cell receptor signaling pathway (IEA)

tuberculosis pathway (IEA)

Phenotype Annotations Click to see Annotation Detail View

Mammalian Phenotype

abnormal B cell differentiation (IAGP)

abnormal cytokine secretion (IAGP)

abnormal cytotoxic T cell physiology (IAGP)

abnormal dendritic cell physiology (IAGP)

abnormal humoral immune response (IAGP)

abnormal immune cell physiology (IAGP)

abnormal marginal zone B cell physiology (IAGP)

abnormal neural fold elevation formation (IAGP)

abnormal response to infection (IAGP)

abnormal T cell activation (IAGP)

abnormal T cell differentiation (IAGP)

decreased activated T cell number (IAGP)

decreased B cell number (IAGP)

decreased B cell proliferation (IAGP)

decreased B-1 B cell number (IAGP)

decreased double-positive T cell number (IAGP)

decreased follicular B cell number (IAGP)

decreased IgG level (IAGP)

decreased IgM level (IAGP)

decreased immunoglobulin level (IAGP)

decreased marginal zone B cell number (IAGP)

decreased mature B cell number (IAGP)

decreased T cell proliferation (IAGP)

decreased thymocyte number (IAGP)

exencephaly (IAGP)

increased CD4-positive, alpha-beta T cell number (IEA)

increased double-negative T cell number (IAGP)

increased hindbrain apoptosis (IAGP)

increased IgE level (IEA)

increased IgM level (IEA)

increased single-positive T cell number (IEA)

increased susceptibility to bacterial infection (IAGP)

increased susceptibility to infection (IAGP)

increased T cell number (IEA)

open neural tube (IAGP)

perinatal lethality, incomplete penetrance (IAGP)

References

References - curated

#	Reference Title	Reference Citation
1.	Functional annotation of a full-length mouse cDNA collection.	Kawai J, etal., Nature. 2001 Feb 8;409(6821):685-90.
2.	Large-scale cDNA analysis reveals phased gene expression patterns during preimplantation mouse development.	Ko MS, etal., Development 2000 Apr;127(8):1737-49.
3.	MGDs mouse GO annotations	MGD data from the GO Consortium
4.	MGD IEA	MGD IEA
5.	Analysis of the mouse transcriptome based on functional annotation of 60,770 full-length cDNAs.	Okazaki Y, etal., Nature. 2002 Dec 5;420(6915):563-73.
6.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
7.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
8.	PID Annotation Import Pipeline	Pipeline to import Pathway Interaction Database annotations from NCI into RGD
9.	Comparative analysis of apoptosis and inflammation genes of mice and humans.	Reed JC, etal., Genome Res 2003 Jun;13(6B):1376-88.
10.	Mouse MP Annotation Import Pipeline	RGD automated import pipeline
11.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
12.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
13.	Bcl10 is a positive regulator of antigen receptor-induced activation of NF-kappaB and neural tube closure.	Ruland J, etal., Cell 2001 Jan 12;104(1):33-42.
14.	Regulatory mechanisms of TRAF2-mediated signal transduction by Bcl10, a MALT lymphoma-associated protein.	Yoneda T, etal., J Biol Chem 2000 Apr 14;275(15):11114-20.

Additional References at PubMed

PMID:9989495	PMID:10187770	PMID:10187771	PMID:10187815	PMID:10349636	PMID:10364242	PMID:10922068	PMID:11042159	PMID:11076861	PMID:11238466	PMID:11387339	PMID:12477932
PMID:12520002	PMID:12867038	PMID:12910267	PMID:14610273	PMID:14614861	PMID:14638696	PMID:14724296	PMID:15049289	PMID:15213237	PMID:15489334	PMID:15782199	PMID:16141072
PMID:16141073	PMID:16432253	PMID:16495340	PMID:16602821	PMID:16831874	PMID:16862125	PMID:17095601	PMID:17101977	PMID:17179215	PMID:17182539	PMID:17189706	PMID:17202357
PMID:17371994	PMID:17462996	PMID:17486093	PMID:17502353	PMID:17660823	PMID:17785812	PMID:18192506	PMID:18252714	PMID:18583339	PMID:18606643	PMID:18799693	PMID:18829987
PMID:18941215	PMID:19112107	PMID:19139169	PMID:19412180	PMID:19454668	PMID:19897484	PMID:19915568	PMID:19917778	PMID:19950170	PMID:20082358	PMID:20466000	PMID:20538615
PMID:20605784	PMID:21041303	PMID:21267068	PMID:21873635	PMID:21896478	PMID:21954216	PMID:22265677	PMID:22323537	PMID:22411628	PMID:22658522	PMID:22708078	PMID:22880103
PMID:23087406	PMID:23153494	PMID:23677497	PMID:23706741	PMID:23766559	PMID:24443940	PMID:24777530	PMID:24792914	PMID:24825920	PMID:24917592	PMID:25185127	PMID:25202022
PMID:25267792	PMID:25365219	PMID:25456129	PMID:26668357	PMID:26936881	PMID:27032818	PMID:28158919	PMID:28658621	PMID:29649481	PMID:31092922	PMID:31138793	PMID:31241148
PMID:32005751	PMID:32325033	PMID:32768663	PMID:33941870	PMID:34014917	PMID:34826258	PMID:35263589	PMID:36115893	PMID:36524339

Genomics

Comparative Map Data

Bcl10
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	3	145,630,017 - 145,640,121 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	3	145,628,559 - 145,640,111 (+)	Ensembl		GRCm39 Ensembl
GRCm38	3	145,924,262 - 145,934,366 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	3	145,922,804 - 145,934,356 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	3	145,587,342 - 145,597,247 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	3	145,861,764 - 145,871,669 (+)	NCBI		MGSCv36	mm8
Celera	3	152,377,901 - 152,387,817 (+)	NCBI		Celera
Cytogenetic Map	3	H2	NCBI

BCL10
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	85,265,776 - 85,276,632 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	1	85,265,776 - 85,276,632 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	1	85,731,459 - 85,742,315 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	85,504,047 - 85,516,171 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	1	85,443,952 - 85,455,604	NCBI
Celera	1	83,975,888 - 83,987,016 (-)	NCBI		Celera
Cytogenetic Map	1	p22.3	NCBI
HuRef	1	83,842,452 - 83,853,578 (-)	NCBI		HuRef
CHM1_1	1	85,847,075 - 85,858,194 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	1	85,106,896 - 85,117,748 (-)	NCBI		T2T-CHM13v2.0

Bcl10
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	2	234,840,880 - 234,850,520 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	234,840,858 - 234,850,523 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	242,633,160 - 242,642,800 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	2	240,523,460 - 240,533,107 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	2	235,390,779 - 235,400,419 (+)	NCBI	Rnor_WKY
Rnor_6.0	2	251,805,392 - 251,814,957 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	251,805,392 - 251,814,957 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	270,330,540 - 270,340,105 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	244,116,880 - 244,126,393 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	2	244,103,619 - 244,113,130 (+)	NCBI
Celera	2	226,822,923 - 226,832,565 (+)	NCBI		Celera
Cytogenetic Map	2	q44	NCBI

Bcl10
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955423	8,709,890 - 8,722,050 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955423	8,710,231 - 8,720,530 (+)	NCBI	ChiLan1.0	ChiLan1.0

BCL10
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
PanPan1.1	1	86,679,646 - 86,690,841 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
Mhudiblu_PPA_v0	1	117,823,388 - 117,834,314 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3

BCL10
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	6	62,712,937 - 62,723,852 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	6	62,712,971 - 62,722,368 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	6	65,361,863 - 65,372,548 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	6	63,252,846 - 63,263,759 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	6	63,252,838 - 63,263,752 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	6	62,780,042 - 62,790,957 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	6	62,750,582 - 62,761,263 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	6	63,258,042 - 63,268,727 (+)	NCBI		UU_Cfam_GSD_1.0

Bcl10
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	95,863,804 - 95,871,302 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936608	434,978 - 442,391 (+)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936608	434,740 - 442,162 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

BCL10
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	4	130,645,216 - 130,657,995 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	4	130,645,427 - 130,653,317 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	4	143,237,003 - 143,244,894 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

BCL10
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	48,073,489 - 48,084,635 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	20	48,073,800 - 48,085,136 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666033	69,724,709 - 69,736,042 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Bcl10
(Heterocephalus glaber - naked mole-rat)

Naked Mole-rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624742	12,210,360 - 12,221,759 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624742	12,210,333 - 12,222,533 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	230
Count of miRNA genes:	182
Interacting mature miRNAs:	195
Transcripts:	ENSMUST00000029842
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCm39)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1302056	Orgwq4_m	organ weight QTL 4 (mouse)			Not determined		3	30067588	147304689	Mouse
27226732	Tibmd3_m	tibia midshaft diameter 3, 10 week (mouse)					3	96607316	147805636	Mouse
1300752	Ap6q_m	alcohol preference 6 QTL (mouse)			Not determined		3	100372912	147045722	Mouse
27226733	Tibmd6_m	tibia midshaft diameter 6, 16 week (mouse)					3	101307316	149805637	Mouse
1302093	Orgwq5_m	organ weight QTL 5 (mouse)			Not determined		3	107376936	147304689	Mouse
1301100	Bdt2_m	bone density traits 2 (mouse)			Not determined		3	114736617	148736784	Mouse
10043919	Afpq8_m	abdominal fat percent QTL 8 (mouse)			Not determined		3	119057332	153057456	Mouse
1558868	Ses9_m	salmonella enteritidis susceptibility 9 (mouse)			Not determined		3	119057332	153057456	Mouse
4141935	Tgq15_m	triglyceride QTL 15 (mouse)			Not determined			119318586	153318586	Mouse
4142449	Tgq14_m	triglyceride QTL 14 (mouse)			Not determined			119318586	153318586	Mouse
1302151	Lprm2_m	lymphoproliferation modifier 2 (mouse)			Not determined		3	119778857	153779044	Mouse
10412240	Alpq6_m	alcohol preference QTL 6 (mouse)			Not determined		3	120772078	154772078	Mouse
4142245	Pstc1_m	periosteal circumference 1 (mouse)			Not determined		3	126270248	159745316	Mouse
1301218	Letohc1_m	low ethanol consumption 1 (mouse)			Not determined		3	126352986	159745316	Mouse
1301347	Fpli_m	fasting plasma insulin (mouse)			Not determined		3	126460514	159745316	Mouse
1301563	Alcp3_m	alcohol preference locus 3 (mouse)			Not determined		3	130736935	159745316	Mouse
11039523	Tbbr1_m	Trypanosoma brucei brucei response 1 (mouse)					3	130849375	159745316	Mouse
1300753	Eae10_m	susceptibility to experimental allergic encephalomyelitis 10 (mouse)			Not determined		3	131736617	148451178	Mouse
10412120	Ccs3_m	colon cancer susceptibility 3 (mouse)			Not determined		3	131754536	146017669	Mouse
1301528	Loco1_m	locomotor activity 1 (mouse)			Not determined		3	133461893	159745316	Mouse
1301221	Hrtfm2_m	heart failure modifier 2 (mouse)			Not determined		3	143270248	147045722	Mouse
1301222	Scc7_m	colon tumor susceptibility 7 (mouse)			Not determined		3	143352986	156364108	Mouse

Markers in Region

RH127072

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	3	145,933,943 - 145,934,153	UniSTS	GRCm38
MGSCv37	3	145,596,907 - 145,597,117	UniSTS	GRCm37
Celera	3	152,387,477 - 152,387,687	UniSTS
Cytogenetic Map	3	H3	UniSTS
Whitehead/MRC_RH	3	1602.34	UniSTS

AI132454

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	3	145,933,914 - 145,934,120	UniSTS	GRCm38
MGSCv37	3	145,596,878 - 145,597,084	UniSTS	GRCm37
Celera	3	152,387,448 - 152,387,654	UniSTS
Cytogenetic Map	3	H3	UniSTS
Whitehead/MRC_RH	3	1605.75	UniSTS

Expression

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_009740	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC123684	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF057701	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF100339	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF127387	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF134396	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AJ006289	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK076082	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK080820	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK140179	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK146236	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK150883	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK152563	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK152847	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK156890	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK168084	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK169126	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK171687	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK172158	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK207365	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK217362	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC003703	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC024379	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC172007	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC172009	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BU707261	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH466532	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSMUST00000029842 ⟹ ENSMUSP00000029842

RefSeq Status:

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	3	145,630,017 - 145,640,111 (+)	Ensembl
GRCm38.p6 Ensembl	3	145,924,262 - 145,934,356 (+)	Ensembl

RefSeq Acc Id:

ENSMUST00000197842

RefSeq Status:

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	3	145,628,559 - 145,630,926 (+)	Ensembl
GRCm38.p6 Ensembl	3	145,922,804 - 145,925,171 (+)	Ensembl

RefSeq Acc Id:

ENSMUST00000198122

RefSeq Status:

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	3	145,630,112 - 145,633,686 (+)	Ensembl
GRCm38.p6 Ensembl	3	145,924,357 - 145,927,931 (+)	Ensembl

RefSeq Acc Id:

NM_009740 ⟹ NP_033870

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39	3	145,630,017 - 145,640,121 (+)	NCBI
GRCm38	3	145,924,262 - 145,934,366 (+)	NCBI
MGSCv37	3	145,587,342 - 145,597,247 (+)	RGD
Celera	3	152,377,785 - 152,387,900 (+)	NCBI
cM Map	3		ENTREZGENE

Sequence:

show sequence

GCTGAGCGCGGCACCGCTGGCCCCAGGGGCGGAGCCGGAAGTGGGGCGTTGAGGTCTCCACCTC
CTCGTCCGTGAGCCGGCCGTTCCCCCGCTTCTGTTCCTAGTCCCCCCGAAGTCACAGCCTGATT
CCCGGAGGCCCGAGCCCTTAGTCTGGGCGGGGTGGCGCGGGCCGGAAGGACGCCATCCCGGCCT
GGGCCATGGAGGCTCCCGCACCGTCCCTCACGGAGGAGGATTTGACTGAAGTGAAGAAGGACGC
TTTAGAGAATTTACGTGTTTACCTGTGTGAGAAAATCATAGCTGAGAGACATTTTGATCATCTA
CGTGCAAAAAAAATACTAAGTAGAGAAGACACAGAAGAAATTTCTTGCCGAACTTCAAGTAGAA
AACGGGCTGGGAAGTTGTTAGACTACTTACAGGAGAACCCCAGGGGCCTGGACACCCTGGTGGA
ATCCATCCGCAGGGAGAAAACACAGAGCTTCCTGATTCAGAAGATAACGGATGAGGTGCTAAAG
CTTCGGAATATAAAACTGGAGCACCTCAAAGGCCTGAAGTGCAGCAGCTGTGAGCCCTTTGCAG
CCGGAGCCACCAACAACCTCTCTAGGTGCAATTCCGATGAGAGCAATCTCTCTGAGAAACAGAG
AGCATCCACTGTCATGTACCACCCGGAGGGAGAGTCCAGCACGGCTCCCTTCTTCTCTATGGCG
TCGTCCCTGAACTTGCCAGTCCTGGAAGTTGGCAGGACTGAAAACAGCAGCTTCTCTTCAGCCA
CTCTTCCTCGACCTGGGGACCCTGGGGCTCCCCCTTTGCCCCCAGACCTTCGGTTGGAAGAGGG
GGGAAGTTGTGGAAACTCAAGTGAGATGTTTCTCCCCTTACGGTCACGGGCTCTTTCACGCCAA
TGATACATCACCGCCTAGTTGTTTTACTAGTGATGCAAAATGCTGTGAAGGAGGCCATCTTTCT
ATACAAACCACGGTGACAGGTCACTCACATTCGATGCGTGCCTTTAAAATCAGTGTACACATTC
TCTGTAAATAGGATTTGTTAGGGTAAAGAAGCGCTCTGGGGCGGCGTGGTGTAAATCATGGTGG
TCGTGACTTTTCCATAATGTCCTTTCTTTTTTATTATTTTTAGGTGTTTGCGTATTTTGAACTT
TTCATAAGATTAATTTTATCGGAATATTTCTCAATTTGAGAAAACAACTTGTGGATTGGGAATA
ATGTTTTTAGCACATTTATGCTACAAATTTTCAGTCTGATTGTTTTTCCCACTGATCTGGCAGT
ATATTTTAGCAGTAAGCTGTTGTGTTTCAGGAAAGCTGGACACGGGAAAGCTGCCGACACACTC
AGCAGTGTCCCACTCCTTAGTTCTGAGAAGCCGTCGGGTTCTGAGGAGACACCTGGTGGCACTG
AGCCTGGTGACCTCAGTGGGCCAAAATTTGTTTTATACTCACCCTGCCAGCGTGAGTGTCTTAC
TTTCACAGGCCTTGTGTCCTCAGTCTTATCTTAAAGGATGTTATCTTGGCAGGGCATCACTTGT
AATTAATGGATGATACTTGTAATTGACTAAAGTCCTCGCTCTGAGCCGTTTGTTCTGGCTCCGA
GAGCGCTGACATGTGAAGCATGGTGAGCAGCGAGGGAACTGACAGGATGTGGCCGTGGCCAGTG
TGGCTTTAGTGTTTGCATCAGGCAGCCACCAGCTCCATCCGTGTTCTTACTGCTTTACAAAGTT
TGACTAACTTTACACATTTTAAAAATGCTGATTGTCTTCGTTTAAATTATAATTTTACCTATTT
CTTGACATCTAACTCCTATTCATTTCTATTATTTAAAAATTAAGAAATGAAAATTTGCTATTAA
CAATAAAGTTTTTTTAATGTAGTGATGTGTCTGAGTCAGAAATTCAAAATGTCTGATTTTCAAA
TGTCTAACGCTTTTTAATATACTGGTTTTAAAAAGAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_033870	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAD15801	(Get FASTA)	NCBI Sequence Viewer
	AAD16429	(Get FASTA)	NCBI Sequence Viewer
	AAD32598	(Get FASTA)	NCBI Sequence Viewer
	AAD39148	(Get FASTA)	NCBI Sequence Viewer
	AAH24379	(Get FASTA)	NCBI Sequence Viewer
	AAI72007	(Get FASTA)	NCBI Sequence Viewer
	AAI72009	(Get FASTA)	NCBI Sequence Viewer
	BAC36168	(Get FASTA)	NCBI Sequence Viewer
	BAE24267	(Get FASTA)	NCBI Sequence Viewer
	BAE27001	(Get FASTA)	NCBI Sequence Viewer
	BAE29930	(Get FASTA)	NCBI Sequence Viewer
	BAE31316	(Get FASTA)	NCBI Sequence Viewer
	BAE31540	(Get FASTA)	NCBI Sequence Viewer
	BAE33885	(Get FASTA)	NCBI Sequence Viewer
	BAE40057	(Get FASTA)	NCBI Sequence Viewer
	BAE40905	(Get FASTA)	NCBI Sequence Viewer
	BAE42852	(Get FASTA)	NCBI Sequence Viewer
	CAA06956	(Get FASTA)	NCBI Sequence Viewer
	EDL11992	(Get FASTA)	NCBI Sequence Viewer
	Q9Z0H7	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:

NP_033870 ⟸ NM_009740

- UniProtKB:

Q3UBN4 (UniProtKB/Swiss-Prot), Q9Z0H7 (UniProtKB/Swiss-Prot), B7ZWE5 (UniProtKB/TrEMBL), A0A8C6GL72 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MEAPAPSLTEEDLTEVKKDALENLRVYLCEKIIAERHFDHLRAKKILSREDTEEISCRTSSRKR
AGKLLDYLQENPRGLDTLVESIRREKTQSFLIQKITDEVLKLRNIKLEHLKGLKCSSCEPFAAG
ATNNLSRCNSDESNLSEKQRASTVMYHPEGESSTAPFFSMASSLNLPVLEVGRTENSSFSSATL
PRPGDPGAPPLPPDLRLEEGGSCGNSSEMFLPLRSRALSRQ

hide sequence

RefSeq Acc Id:

ENSMUSP00000029842 ⟸ ENSMUST00000029842

Protein Domains

CARD

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q9Z0H7-F1-model_v2	AlphaFold	Q9Z0H7	1-233	view protein structure

Promoters

RGD ID:

6833499

Promoter ID:

MM_KWN:36346

Type:

CpG-Island

SO ACC ID:

SO:0000170

Source:

MPROMDB

Tissues & Cell Lines:

3T3L1_Day0, 3T3L1_Day1, 3T3L1_Day2, 3T3L1_Day3, 3T3L1_Day4, 3T3L1_Day6, BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, Brain, ES_Cell, Kidney, Liver, Lung, MEF_B4, MEF_B6, Spleen

Transcripts:

ENSMUST00000029842

Position:

Mouse Assembly	Chr	Position (strand)	Source
MGSCv36	3	145,586,881 - 145,587,712 (+)	MPROMDB

RGD ID:

6882580

Promoter ID:

EPDNEW_M4741

Type:

initiation region

Name:

Bcl10_1

Description:

Mus musculus B cell leukemia/lymphoma 10 , mRNA.

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm38	3	145,924,352 - 145,924,412	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	MGI:1337994	AgrOrtholog
Ensembl Genes	ENSMUSG00000028191	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Protein	ENSMUSP00000029842	ENTREZGENE
	ENSMUSP00000029842.8	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSMUST00000029842	ENTREZGENE
	ENSMUST00000029842.9	UniProtKB/Swiss-Prot
Gene3D-CATH	1.10.533.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	BCL10/E10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	CARD	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	CARD_BCL10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	DEATH-like_dom_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	mmu:12042	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGD	MGI:1337994	ENTREZGENE
NCBI Gene	12042	ENTREZGENE
PANTHER	B-CELL LYMPHOMA/LEUKEMIA 10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR34920	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	CARD	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Bcl10	PhenoGen
PROSITE	CARD	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF47986	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A8C6GL72	ENTREZGENE
	B7ZWE5	ENTREZGENE, UniProtKB/TrEMBL
	BCL10_MOUSE	UniProtKB/Swiss-Prot
	Q3THY9_MOUSE	UniProtKB/TrEMBL
	Q3UBN4	ENTREZGENE
	Q9Z0H7	ENTREZGENE
UniProt Secondary	Q3UBN4	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2012-02-07	Bcl10	B cell leukemia/lymphoma 10	Bcl10	B-cell leukemia/lymphoma 10	Symbol and/or name change	5135510	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)

Mammalian Phenotype

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)

Mammalian Phenotype