Advanced Search (OLGA)

Gene: Otp (orthopedia homeobox) Rattus norvegicus

Analyze

Symbol:

Otp

Name:

orthopedia homeobox

RGD ID:

727945

Description:

Predicted to enable DNA-binding transcription repressor activity, RNA polymerase II-specific and RNA polymerase II transcription regulatory region sequence-specific DNA binding activity. Predicted to be involved in negative regulation of transcription by RNA polymerase II and neuron differentiation. Predicted to act upstream of or within nervous system development and positive regulation of neuroblast proliferation. Predicted to be located in fibrillar center and nuclear body. Orthologous to human OTP (orthopedia homeobox); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran; ammonium chloride.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

homeobox protein orthopedia; orthopedia homolog; orthopedia homolog (Drosophila)

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	OTP (orthopedia homeobox)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Otp (orthopedia homeobox)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Otp (orthopedia homeobox)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	OTP (orthopedia homeobox)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	OTP (orthopedia homeobox)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Otp (orthopedia homeobox)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	OTP (orthopedia homeobox)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	OTP (orthopedia homeobox)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Otp (orthopedia homeobox)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	OTP (orthopedia homeobox)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Otp (orthopedia homeobox)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	otpb (orthopedia homeobox b)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	otpb (orthopedia homeobox b)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	otpa (orthopedia homeobox a)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	otpa (orthopedia homeobox a)	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	otp	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	otp	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	27,842,892 - 27,851,093 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	2	27,842,897 - 27,851,093 (+)	Ensembl				GRCr8
mRatBN7.2	2	26,108,158 - 26,116,359 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	26,108,163 - 26,116,359 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	2	33,137,187 - 33,145,388 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	31,237,421 - 31,245,622 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	26,062,387 - 26,070,588 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	24,546,393 - 24,554,953 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	24,546,536 - 24,554,683 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	2	43,712,386 - 43,722,342 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	2	25,176,599 - 25,184,585 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	2	22,179,022 - 22,187,133 (+)	NCBI		Celera
RGSC_v3.1	2	25,098,409 - 25,098,690 (+)	NCBI
Cytogenetic Map	2	q12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Hermansky-Pudlak syndrome 2 (ISO)

Neurodevelopmental Disorders (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-demecolcine (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

3,4-methylenedioxymethamphetamine (ISO)

aflatoxin B1 (ISO)

ammonium chloride (EXP)

amosite asbestos (ISO)

arsenite(3-) (ISO)

benzo[a]pyrene (ISO)

bis(2-chloroethyl) sulfide (ISO)

bisphenol A (EXP,ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

CGP 52608 (ISO)

choline (ISO)

crocidolite asbestos (ISO)

folic acid (ISO)

formaldehyde (ISO)

hydrogen peroxide (ISO)

L-methionine (ISO)

methyl methanesulfonate (ISO)

methylmercury chloride (ISO)

paraquat (ISO)

resveratrol (ISO)

Theaflavin 3,3'-digallate (ISO)

theophylline (ISO)

titanium dioxide (ISO)

valproic acid (ISO)

vincristine (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cell differentiation (IEA)

dopaminergic neuron differentiation (IEA,ISO)

forebrain neuron differentiation (IEA,ISO)

hypothalamus cell differentiation (IEA,ISO)

negative regulation of transcription by RNA polymerase II (IEA,ISO)

nervous system development (IEA)

neuroblast proliferation (IEA,ISO)

neuroendocrine cell differentiation (IEA,ISO)

neurohypophysis development (IEA,ISO)

neuron differentiation (IBA)

positive regulation of neuroblast proliferation (IEA,ISO)

regulation of DNA-templated transcription (IEA)

Cellular Component

fibrillar center (IEA,ISO)

nuclear body (IEA,ISO)

nucleoplasm (IEA,ISO)

nucleus (IEA)

Molecular Function

DNA binding (IBA,IEA)

DNA-binding transcription factor activity, RNA polymerase II-specific (IEA)

DNA-binding transcription repressor activity, RNA polymerase II-specific (IEA,ISO)

protein binding (ISO)

RNA polymerase II transcription regulatory region sequence-specific DNA binding (IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	NCBI rat LocusLink and RefSeq merged data October 15, 2003	NCBI rat LocusLink and RefSeq merged data October 15, 2003
3.	GOA pipeline	RGD automated data pipeline
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:10557207	PMID:17481897

Genomics

Comparative Map Data

Otp
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	27,842,892 - 27,851,093 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	2	27,842,897 - 27,851,093 (+)	Ensembl				GRCr8
mRatBN7.2	2	26,108,158 - 26,116,359 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	26,108,163 - 26,116,359 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	2	33,137,187 - 33,145,388 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	31,237,421 - 31,245,622 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	26,062,387 - 26,070,588 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	24,546,393 - 24,554,953 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	24,546,536 - 24,554,683 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	2	43,712,386 - 43,722,342 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	2	25,176,599 - 25,184,585 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	2	22,179,022 - 22,187,133 (+)	NCBI		Celera
RGSC_v3.1	2	25,098,409 - 25,098,690 (+)	NCBI
Cytogenetic Map	2	q12	NCBI

OTP
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	5	77,628,712 - 77,638,713 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	5	77,628,712 - 77,638,713 (-)	Ensembl			hg38	GRCh38
GRCh37	5	76,924,537 - 76,934,538 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	5	76,960,293 - 76,970,278 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	5	76,960,293 - 76,970,278	NCBI
Celera	5	72,812,592 - 72,829,177 (-)	NCBI		Celera
Cytogenetic Map	5	q14.1	NCBI
HuRef	5	72,131,689 - 72,141,606 (-)	NCBI		HuRef
CHM1_1	5	76,358,684 - 76,368,685 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	5	78,111,295 - 78,121,295 (-)	NCBI		T2T-CHM13v2.0

Otp
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	13	95,012,144 - 95,021,633 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	13	95,012,110 - 95,021,638 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	13	94,875,636 - 94,885,125 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	13	94,875,602 - 94,885,130 (+)	Ensembl			mm10	GRCm38
MGSCv37	13	95,645,582 - 95,653,636 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	13	95,976,326 - 95,984,380 (+)	NCBI		MGSCv36	mm8
Celera	13	98,492,992 - 98,501,046 (+)	NCBI		Celera
Cytogenetic Map	13	C3	NCBI
cM Map	13	49.22	NCBI

Otp
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955425	23,350,449 - 23,358,189 (+)	Ensembl
ChiLan1.0	NW_004955425	23,350,449 - 23,358,189 (+)	NCBI	ChiLan1.0	ChiLan1.0

OTP
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	4	37,663,671 - 37,674,402 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	5	35,817,298 - 35,828,029 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	5	37,667,070 - 37,677,802 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	5	38,196,327 - 38,206,313 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	5	38,196,327 - 38,206,313 (+)	Ensembl			panPan2	panpan1.1

OTP
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	3	29,063,359 - 29,071,533 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	3	29,064,681 - 29,071,509 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	3	30,303,340 - 30,311,360 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	3	28,984,638 - 28,992,657 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	3	28,984,577 - 28,992,657 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	3	28,921,217 - 28,929,236 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	3	28,899,793 - 28,907,811 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	3	29,230,596 - 29,238,610 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Otp
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024407213	185,222,332 - 185,232,174 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936549	5,626,799 - 5,636,556 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936549	5,626,799 - 5,636,556 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

OTP
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	2	86,528,348 - 86,537,527 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	2	86,529,293 - 86,566,414 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	2	88,136,843 - 88,145,104 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

OTP
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	4	71,861,857 - 71,877,994 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	4	71,863,413 - 71,871,769 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666049	20,700,702 - 20,709,787 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Otp
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624869	2,089,873 - 2,098,064 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624869	2,089,886 - 2,098,061 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Variants

Variants in Otp
74 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	122
Count of miRNA genes:	74
Interacting mature miRNAs:	76
Transcripts:	ENSRNOT00000014036
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
10755430	Coatc6	Coat color QTL 6		0.02576	coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	2	13325041	58325041	Rat
7387318	Stl32	Serum triglyceride level QTL 32	3.2	0.0003	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	2	24117813	69117813	Rat
10755499	Bp389	Blood pressure QTL 389	2.61		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	20695736	231474293	Rat
738010	Lnnr3	Liver neoplastic nodule remodeling QTL 3	2.94		liver integrity trait (VT:0010547)	liver remodeling tumorous lesion number (CMO:0001461)	2	1	42977529	Rat
1358917	Cm42	Cardiac mass QTL 42	2.82		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	27148328	206613235	Rat
9590080	Insglur4	Insulin/glucose ratio QTL 4	28.7	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	2	6152767	51152767	Rat
1579916	Bp270	Blood pressure QTL 270		0.003	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	16051883	61051883	Rat
731167	Glom4	Glomerulus QTL 4	2.4	0.0082	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002)	2	22038044	67038044	Rat
731166	Mamtr2	Mammary tumor resistance QTL 2		0.0001	mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	2	9623581	54623581	Rat
1358913	Cm41	Cardiac mass QTL 41	2.73		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	27148328	206613235	Rat
1302794	Stl27	Serum triglyceride level QTL 27	4.4	0.0001	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	2	27148328	145807373	Rat
1331764	Bp205	Blood pressure QTL 205	3.476		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	14368707	59368707	Rat
1358901	Cm38	Cardiac mass QTL 38	2		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	27148328	159440891	Rat
1600379	Mcs18	Mammary carcinoma susceptibility QTL 18	2.6		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	2	9623581	44538110	Rat
1331760	Bp206	Blood pressure QTL 206	3.62454		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	4265106	205135428	Rat
1358899	Kidm23	Kidney mass QTL 23	3.88		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	27148328	159440891	Rat
1358908	Bw49	Body weight QTL 49	3.36		body mass (VT:0001259)	body weight (CMO:0000012)	2	27148557	159440760	Rat
1358910	Kidm27	Kidney mass QTL 27	5.77		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	27148328	159440891	Rat
61355	Bp36	Blood pressure QTL 36	2.9		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	2	7605533	104774005	Rat
1358911	Kidm28	Kidney mass QTL 28	5.42		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	27148328	159440891	Rat
1358904	Cm39	Cardiac mass QTL 39	2.26		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	27148328	159440891	Rat
1578664	Bmd9	Bone mineral QTL density 9	5		femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	2	5736325	50736325	Rat
1358887	Bw50	Body weight QTL 50	2.39		body mass (VT:0001259)	body weight (CMO:0000012)	2	27148557	159440760	Rat
1358894	Kidm24	Kidney mass QTL 24	4.03		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	27148328	159440891	Rat
731184	Mamtr4	Mammary tumor resistance QTL 4		0.0003	mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	2	18227137	63227137	Rat

Markers in Region

bnlg1246b

Rat Assembly	Chr	Position (strand)	Source	JBrowse
Rnor_5.0	3	11,030,918 - 11,031,390	NCBI	Rnor5.0
RGSC_v3.4	3	6,015,696 - 6,016,167	UniSTS	RGSC3.4
Celera	3	5,243,893 - 5,244,364	UniSTS
Cytogenetic Map	3	p12	UniSTS
Cytogenetic Map	2	q12	UniSTS

D13Mit258

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	26,106,538 - 26,106,651 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	24,544,774 - 24,544,886	NCBI	Rnor6.0
Rnor_5.0	2	43,710,767 - 43,710,879	UniSTS	Rnor5.0
RGSC_v3.4	2	25,174,980 - 25,175,092	UniSTS	RGSC3.4
Celera	2	22,177,403 - 22,177,515	UniSTS
Cytogenetic Map	2	q12	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
1	1	71	2	2	1	1	1	6	2	71	2	20	1

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001100523	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AY169319	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473955	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000002	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000014036 ⟹ ENSRNOP00000014036

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	2	27,842,897 - 27,851,093 (+)	Ensembl
mRatBN7.2 Ensembl	2	26,108,163 - 26,116,359 (+)	Ensembl
Rnor_6.0 Ensembl	2	24,546,536 - 24,554,683 (+)	Ensembl

RefSeq Acc Id:

NM_001100523 ⟹ NP_001093993

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	27,842,892 - 27,851,093 (+)	NCBI
mRatBN7.2	2	26,108,158 - 26,116,359 (+)	NCBI
Rnor_6.0	2	24,546,393 - 24,554,953 (+)	NCBI
Rnor_5.0	2	43,712,386 - 43,722,342 (+)	NCBI
Celera	2	22,179,022 - 22,187,133 (+)	NCBI

Sequence:

show sequence

TTTTTAACCACAAACCGAATTTTCTTTCATTTAGGTGATCTATATATATCTATATCGTATAGCT
TATAGCTTATATCTATTTTAAATAACTTAAAGCCGCTAAAATTTGGGGGGGAACAGCTTTCGCC
CTGGAGCGGTGCGCGATGCTGTCTCACGCCGACCTCCTGGACGCCAGGCTAGGTATGAAAGATG
CCGCCGAGCTTCTGGGCCACCGGGAGGCGGTGAAGTGTAGGCTGGGCGTGGGGGGCTCTGACCC
TGGGGGCCATCCAGGGGACCTGGCGCCCAACTCCGACCCAGTCGAAGGAGCCACTCTGCTGCCG
GGCGAGGACATCACCACCGTGGGCTCTACTCCTGCTTCGCTGGCGGTGAGCGCCAAAGACCCAG
ACAAGCAGCCGGGGCCCCAGGGCGGCCCCAACCCCAGCCAAGCCGGCCAGCAGCAGGGCCAACA
GAAACAGAAGCGCCACCGGACACGCTTCACCCCAGCGCAGCTCAACGAATTGGAGAGGAGCTTC
GCCAAGACTCACTACCCCGACATCTTTATGCGTGAGGAGCTAGCGCTGCGTATCGGGCTGACCG
AATCGCGAGTGCAGGTCTGGTTCCAGAATCGCCGCGCCAAGTGGAAGAAGCGCAAGAAGACCAC
CAACGTGTTCCGCGCGCCCGGCACGCTGCTGCCCACGCCGGGGCTGCCCCAGTTCCCGTCGGCC
GCCGCCGCCGCGGCCGCCGCCATGGGCGACAGCCTGTGCTCTTTCCACGCCAACGACACCCGCT
GGGCGGCGGCCGCCATGCCCGGGGTGTCCCAGCTCCCTCTGCCGCCTGCGCTCGGCCGCCAGCA
GGCCATGGCGCAGTCGCTGTCCCAGTGCAGCCTGGCGGCGGGGCCACCGCCCAACTCCATGGGT
TTGTCCAACAGCCTGGCGGGCTCCAACGGAGCGGGGCTGCAGTCGCACCTCTACCAGCCCGCCT
TCCCCGGCATGGTGCCCGCTTCCCTCCCCGGCCCCAGCAACGTCTCCGGCTCGCCCCAGCTCTG
CAGCTCTCCGGACAGCAGCGACGTGTGGCGGGGCACGAGCATCGCCTCCCTGCGCCGCAAGGCG
CTCGAGCACACAGTCTCCATGAGCTTCACCTAATGCCGCCGCGCGCCGCCCGCTGCGCCCGGGC
GCCGCCCCCGTCCCCTCCCCCAGAACCCCGGCCGCGCGCGCCGGGATGCCAGCCCCTCCCCTTC
CCCGGTGTCCTCCGTCCTTCCCGAGCCCCGGCGAGGTCGCCTCCCGAGTTCCCTCCCCGAGCCC
GGCTCCCCTCGCCCCGTGCTGCCCGCCGCCTCGGCCTCCCGCTCGCCCAGGTCGTGCTCGCGCC
CTCCTCCCGGCCTCTGCCAGGCGGCGACCCGGGCCACACTTCGGTCA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001093993	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAO17710	(Get FASTA)	NCBI Sequence Viewer
	EDM10081	(Get FASTA)	NCBI Sequence Viewer
	EDM10082	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000014036
	ENSRNOP00000014036.3

RefSeq Acc Id:

NP_001093993 ⟸ NM_001100523

- UniProtKB:

G3V7E0 (UniProtKB/TrEMBL), A6I4X3 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MLSHADLLDARLGMKDAAELLGHREAVKCRLGVGGSDPGGHPGDLAPNSDPVEGATLLPGEDIT
TVGSTPASLAVSAKDPDKQPGPQGGPNPSQAGQQQGQQKQKRHRTRFTPAQLNELERSFAKTHY
PDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKKTTNVFRAPGTLLPTPGLPQFPSAAAAAA
AAMGDSLCSFHANDTRWAAAAMPGVSQLPLPPALGRQQAMAQSLSQCSLAAGPPPNSMGLSNSL
AGSNGAGLQSHLYQPAFPGMVPASLPGPSNVSGSPQLCSSPDSSDVWRGTSIASLRRKALEHTV
SMSFT

hide sequence

Ensembl Acc Id:

ENSRNOP00000014036 ⟸ ENSRNOT00000014036

Protein Domains

Homeobox OAR

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-G3V7E0-F1-model_v2	AlphaFold	G3V7E0	1-325	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:727945	AgrOrtholog
BioCyc Gene	G2FUF-54826	BioCyc
Ensembl Genes	ENSRNOG00000010560	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000014036	ENTREZGENE
	ENSRNOT00000014036.6	UniProtKB/TrEMBL
Gene3D-CATH	Homeodomain-like	UniProtKB/TrEMBL
InterPro	Homeobox_CS	UniProtKB/TrEMBL
	Homeodomain	UniProtKB/TrEMBL
	Homeodomain-like	UniProtKB/TrEMBL
	HTH_motif	UniProtKB/TrEMBL
	OAR_dom	UniProtKB/TrEMBL
	OTP_Homeobox	UniProtKB/TrEMBL
KEGG Report	rno:294640	UniProtKB/TrEMBL
NCBI Gene	294640	ENTREZGENE
PANTHER	HOMEOBOX PROTEIN ORTHOPEDIA	UniProtKB/TrEMBL
	HOMEOBOX PROTEIN ORTHOPEDIA	UniProtKB/TrEMBL
Pfam	Homeobox	UniProtKB/TrEMBL
	OAR	UniProtKB/TrEMBL
PhenoGen	Otp	PhenoGen
PRINTS	HTHREPRESSR	UniProtKB/TrEMBL
PROSITE	HOMEOBOX_1	UniProtKB/TrEMBL
	HOMEOBOX_2	UniProtKB/TrEMBL
	OAR	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000010560	RatGTEx
SMART	HOX	UniProtKB/TrEMBL
Superfamily-SCOP	Homeodomain_like	UniProtKB/TrEMBL
UniProt	A6I4X3	ENTREZGENE, UniProtKB/TrEMBL
	A6I4X4_RAT	UniProtKB/TrEMBL
	G3V7E0	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-09-24	Otp	orthopedia homeobox	Otp	orthopedia homolog (Drosophila)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-09-10	Otp	orthopedia homolog (Drosophila)			Symbol and Name status set to approved	1299863	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar