Advanced Search (OLGA)

Gene: Cldn11 (claudin 11) Rattus norvegicus

Analyze

Symbol:

Cldn11

Name:

claudin 11

RGD ID:

71081

Description:

Predicted to enable identical protein binding activity. Predicted to be involved in bicellular tight junction assembly and calcium-independent cell-cell adhesion via plasma membrane cell-adhesion molecules. Predicted to act upstream of or within axon ensheathment and spermatogenesis. Predicted to be located in several cellular components, including lipid droplet; neurofilament; and tight junction. Predicted to be active in bicellular tight junction and plasma membrane. Human ortholog(s) of this gene implicated in hypomyelinating leukodystrophy 22. Orthologous to human CLDN11 (claudin 11); PARTICIPATES IN hepatitis C pathway; INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

claudin-11

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	CLDN11 (claudin 11)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Cldn11 (claudin 11)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Cldn11 (claudin 11)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	CLDN11 (claudin 11)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	CLDN11 (claudin 11)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Cldn11 (claudin 11)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	CLDN11 (claudin 11)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	CLDN11 (claudin 11)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Cldn11 (claudin 11)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	CLDN11 (claudin 11)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Cldn11 (claudin 11)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	cldn11b (claudin 11b)	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Danio rerio (zebrafish):	cldn11a (claudin 11a)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	cldn11a (claudin 11a)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	cldn11	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	cldn11	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	114,136,234 - 114,149,539 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	2	114,136,234 - 114,149,539 (-)	Ensembl				GRCr8
mRatBN7.2	2	112,207,745 - 112,221,050 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	112,207,745 - 112,221,050 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	2	118,854,213 - 118,867,509 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	116,966,771 - 116,980,065 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	111,676,502 - 111,689,756 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	115,823,541 - 115,836,846 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	115,823,538 - 115,836,846 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	2	135,520,050 - 135,533,355 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	2	116,626,427 - 116,639,732 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	2	107,394,882 - 107,408,187 (-)	NCBI		Celera
RGSC_v3.1	2	116,571,388 - 116,584,694 (-)	NCBI
Cytogenetic Map	2	q24	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Animal Disease Models (ISO)

Fanconi-Bickel syndrome (ISO)

hypomyelinating leukodystrophy 22 (ISO)

Marfanoid Mental Retardation Syndrome, Autosomal (ISO)

multiple sclerosis (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

17beta-estradiol (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

2-palmitoylglycerol (ISO)

3,4-dichloroaniline (ISO)

4,4'-sulfonyldiphenol (ISO)

4-hydroxynon-2-enal (ISO)

4-phenylbutyric acid (ISO)

6-propyl-2-thiouracil (EXP)

acrolein (ISO)

all-trans-retinoic acid (ISO)

alpha-pinene (ISO)

amitrole (EXP)

ammonium chloride (EXP)

aristolochic acid A (ISO)

arsane (EXP,ISO)

arsenic atom (EXP,ISO)

arsenite(3-) (ISO)

arsenous acid (ISO)

Azoxymethane (ISO)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

busulfan (ISO)

cadmium dichloride (ISO)

caffeine (ISO)

calcitriol (ISO)

carbendazim (EXP)

CGP 52608 (ISO)

chromium(6+) (EXP,ISO)

cobalt dichloride (ISO)

cocaine (ISO)

coenzyme Q10 (EXP)

copper atom (EXP,ISO)

copper(0) (EXP,ISO)

crocidolite asbestos (ISO)

Cuprizon (EXP)

cyclosporin A (ISO)

decabromodiphenyl ether (EXP)

dexamethasone (ISO)

dextran sulfate (ISO)

diarsenic trioxide (ISO)

dibutyl phthalate (EXP)

dicrotophos (ISO)

diethylstilbestrol (ISO)

diuron (ISO)

dorsomorphin (ISO)

entinostat (ISO)

flavonoids (EXP)

fulvestrant (ISO)

furan (EXP)

genistein (ISO)

gentamycin (EXP)

GW 4064 (ISO)

haloperidol (ISO)

hydrogen sulfide (ISO)

iprodione (EXP)

ivermectin (ISO)

ketamine (EXP)

lead diacetate (EXP)

lead(0) (ISO)

lycopene (ISO)

mercury dibromide (ISO)

methimazole (EXP)

methylmercury chloride (ISO)

mifepristone (EXP)

Mitoquinone (ISO)

mono(2-ethylhexyl) phthalate (ISO)

nickel atom (ISO)

nickel sulfate (ISO)

oxybenzone (ISO)

ozone (ISO)

paraquat (EXP)

perfluorohexanesulfonic acid (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (ISO)

phenylmercury acetate (ISO)

potassium dichromate (EXP,ISO)

quercetin (ISO)

resveratrol (ISO)

rotenone (EXP)

Salidroside (ISO)

SB 203580 (ISO)

SB 431542 (ISO)

serpentine asbestos (ISO)

silicon dioxide (EXP)

sodium arsenite (ISO)

sodium fluoride (ISO)

sodium sulfide (anhydrous) (ISO)

stigmasterol (ISO)

streptozocin (ISO)

sulfur dioxide (ISO)

Sunset Yellow FCF (EXP)

tetracycline (ISO)

titanium dioxide (ISO)

trichostatin A (ISO)

trimellitic anhydride (ISO)

Triptolide (ISO)

trovafloxacin (ISO)

valproic acid (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

axon ensheathment (IEA,ISO)

bicellular tight junction assembly (IBA)

calcium-independent cell-cell adhesion via plasma membrane cell-adhesion molecules (ISS)

cell adhesion (IBA,IEA,ISO)

spermatogenesis (IEA,ISO)

tight junction assembly (IEA,ISO)

Cellular Component

anchoring junction (IEA)

axon (IEA,ISO)

basal part of cell (IEA,ISO)

bicellular tight junction (IBA,IEA,ISO,ISS,TAS)

cell junction (IEA,ISO)

lipid droplet (IEA,ISO)

membrane (IEA)

neurofilament (IEA,ISO)

plasma membrane (IBA,IEA,ISO)

tight junction (IEA,ISO)

Molecular Function

identical protein binding (IEA,ISO,ISS)

protein binding (ISO)

structural molecule activity (IEA)

Molecular Pathway Annotations Click to see Annotation Detail View

hepatitis C pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Transforming growth factor-beta3 perturbs the inter-Sertoli tight junction permeability barrier in vitro possibly mediated via its effects on occludin, zonula occludens-1, and claudin-11.	Lui WY, etal., Endocrinology 2001 May;142(5):1865-77.
3.	Gene Data Set	MGD Curation, June 12, 2002
4.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
5.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
6.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
7.	GOA pipeline	RGD automated data pipeline
8.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:10612400	PMID:12477932	PMID:15591150	PMID:17634366	PMID:18036336	PMID:18308723	PMID:20375010	PMID:22871113	PMID:23376485	PMID:23789093	PMID:25666991	PMID:26060893
PMID:26585695	PMID:27164517	PMID:29476059	PMID:30734065	PMID:32196966

Genomics

Comparative Map Data

Cldn11
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	114,136,234 - 114,149,539 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	2	114,136,234 - 114,149,539 (-)	Ensembl				GRCr8
mRatBN7.2	2	112,207,745 - 112,221,050 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	112,207,745 - 112,221,050 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	2	118,854,213 - 118,867,509 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	116,966,771 - 116,980,065 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	111,676,502 - 111,689,756 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	115,823,541 - 115,836,846 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	115,823,538 - 115,836,846 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	2	135,520,050 - 135,533,355 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	2	116,626,427 - 116,639,732 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	2	107,394,882 - 107,408,187 (-)	NCBI		Celera
RGSC_v3.1	2	116,571,388 - 116,584,694 (-)	NCBI
Cytogenetic Map	2	q24	NCBI

CLDN11
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	3	170,418,868 - 170,434,691 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	3	170,418,868 - 170,454,733 (+)	Ensembl			hg38	GRCh38
GRCh37	3	170,136,656 - 170,152,479 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	3	171,619,359 - 171,634,581 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	3	171,619,366 - 171,634,585	NCBI
Celera	3	168,535,836 - 168,551,662 (+)	NCBI		Celera
Cytogenetic Map	3	q26.2	NCBI
HuRef	3	167,506,076 - 167,521,977 (+)	NCBI		HuRef
CHM1_1	3	170,099,809 - 170,115,631 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	3	173,203,212 - 173,219,032 (+)	NCBI		T2T-CHM13v2.0

Cldn11
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	3	31,204,069 - 31,218,475 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	3	31,204,069 - 31,218,473 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	3	31,149,920 - 31,164,326 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	3	31,149,920 - 31,164,324 (+)	Ensembl			mm10	GRCm38
MGSCv37	3	31,048,913 - 31,063,240 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	3	31,340,869 - 31,355,196 (+)	NCBI		MGSCv36	mm8
Celera	3	31,063,978 - 31,078,367 (+)	NCBI		Celera
Cytogenetic Map	3	A3	NCBI
cM Map	3	15.14	NCBI

Cldn11
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955420	580,588 - 595,116 (+)	Ensembl
ChiLan1.0	NW_004955420	580,588 - 595,052 (+)	NCBI	ChiLan1.0	ChiLan1.0

CLDN11
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	2	168,313,680 - 168,328,673 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	3	168,318,403 - 168,333,400 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	3	167,432,856 - 167,448,053 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	3	175,621,472 - 175,636,782 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	3	175,621,472 - 175,908,350 (+)	Ensembl			panPan2	panpan1.1

CLDN11
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	34	34,912,903 - 34,929,441 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	34	34,912,449 - 34,928,433 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	34	43,924,891 - 43,941,855 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	34	34,994,383 - 35,011,477 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	34	34,994,046 - 35,011,477 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	34	34,937,785 - 34,954,501 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	34	34,907,493 - 34,924,620 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	34	35,171,151 - 35,187,831 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Cldn11
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405602	101,534,109 - 101,549,597 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936593	2,071,882 - 2,087,877 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936593	2,072,368 - 2,087,820 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CLDN11
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	13	109,075,452 - 109,090,111 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	13	109,075,672 - 109,089,097 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	13	117,956,912 - 117,970,337 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

CLDN11
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	15	18,991,734 - 19,006,902 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	15	18,991,042 - 19,006,866 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666063	27,767,141 - 27,782,304 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Cldn11
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624730	48,458,512 - 48,474,734 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624730	48,458,593 - 48,473,463 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Variants

Variants in Cldn11
76 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	397
Count of miRNA genes:	226
Interacting mature miRNAs:	270
Transcripts:	ENSRNOT00000014359
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2293671	Bss44	Bone structure and strength QTL 44	10.97	0.0001	lumbar vertebra morphology trait (VT:0010494)	lumbar vertebra cortical cross-sectional area (CMO:0001690)	2	43162366	148478373	Rat
631566	Bp90	Blood pressure QTL 90		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	102803808	147803808	Rat
1298074	Bp164	Blood pressure QTL 164		0.003	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	42804607	202447032	Rat
1598865	Bp296	Blood pressure QTL 296	2.1		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	81018907	126018907	Rat
1354648	Bp239	Blood pressure QTL 239		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	66118463	226797303	Rat
1578772	Stresp14	Stress response QTL 14	5	0.001	blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	2	82345893	130923501	Rat
1354649	Kidm17	Kidney mass QTL 17	2.9		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	2	81754530	227146641	Rat
10755499	Bp389	Blood pressure QTL 389	2.61		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	18960362	228801039	Rat
152025242	Bw191	Body weight QTL 191	3.62		body mass (VT:0001259)		2	38573329	122609194	Rat
1598862	Glom9	Glomerulus QTL 9	3.5		kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	2	92337601	137337601	Rat
631198	Cm22	Cardiac mass QTL 22	4.3	0.0008	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	2	76539322	150540526	Rat
1598863	Cm65	Cardiac mass QTL 65	2.3		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	92337601	137337601	Rat
1302794	Stl27	Serum triglyceride level QTL 27	4.4	0.0001	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	2	25413423	143657569	Rat
1581569	Uae32	Urinary albumin excretion QTL 32		0.0001	urine protein amount (VT:0005160)	urine albumin excretion rate (CMO:0000757)	2	78665619	219826953	Rat
61467	Bp14	Blood pressure QTL 14	2.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	43154682	202446871	Rat
1358901	Cm38	Cardiac mass QTL 38	2		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	157142209	Rat
1331760	Bp206	Blood pressure QTL 206	3.62454		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	56043031	202447032	Rat
2300165	Bmd49	Bone mineral density QTL 49	4.8	0.0001	lumbar vertebra mineral mass (VT:0010511)	bone mineral density (CMO:0001226)	2	88862519	133862519	Rat
1358899	Kidm23	Kidney mass QTL 23	3.88		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	25413423	157142209	Rat
1358908	Bw49	Body weight QTL 49	3.36		body mass (VT:0001259)	body weight (CMO:0000012)	2	25413652	157142078	Rat
2300170	Bmd45	Bone mineral density QTL 45	12.1	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	2	88862519	133862519	Rat
1358910	Kidm27	Kidney mass QTL 27	5.77		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	25413423	157142209	Rat
1358911	Kidm28	Kidney mass QTL 28	5.42		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	25413423	157142209	Rat
1358904	Cm39	Cardiac mass QTL 39	2.26		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	157142209	Rat
7411551	Bw131	Body weight QTL 131	29.6	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	2	67942638	112942638	Rat
8662836	Vetf8	Vascular elastic tissue fragility QTL 8	0.66		thoracic aorta molecular composition trait (VT:0010568)	aorta wall extracellular elastin dry weight to aorta wall extracellular collagen weight ratio (CMO:0002003)	2	104559726	149559726	Rat
1358887	Bw50	Body weight QTL 50	2.39		body mass (VT:0001259)	body weight (CMO:0000012)	2	25413652	157142078	Rat
1298080	Bp163	Blood pressure QTL 163		0.02	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	66118275	202447032	Rat
8662832	Vetf7	Vascular elastic tissue fragility QTL 7	3.5		aorta elastin amount (VT:0003905)	aorta wall extracellular elastin dry weight to aorta wall dry weight ratio (CMO:0002002)	2	81689826	221035911	Rat
1298085	Bp165	Blood pressure QTL 165		0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	42804607	202447032	Rat
2290453	Scl55	Serum cholesterol level QTL 55	2.83		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	2	26917817	136917119	Rat
2299162	Iddm32	Insulin dependent diabetes mellitus QTL 32	2.36		blood glucose amount (VT:0000188)	age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140)	2	78665616	143657569	Rat
1358894	Kidm24	Kidney mass QTL 24	4.03		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	25413423	157142209	Rat
2300185	Bmd46	Bone mineral density QTL 46	8.4	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	2	88862519	133862519	Rat
724534	Uae6	Urinary albumin excretion QTL 6	10		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	2	78665619	249053267	Rat
61374	Edpm2	Estrogen-dependent pituitary mass QTL 2	4.42	0.86	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	2	76539322	202447032	Rat
61392	Bp6	Blood pressure QTL 6	7		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	2	80270434	125270434	Rat
1358917	Cm42	Cardiac mass QTL 42	2.82		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	203928301	Rat
1358913	Cm41	Cardiac mass QTL 41	2.73		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	203928301	Rat
2293835	Kiddil5	Kidney dilation QTL 5	3.8		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	2	42804607	157142209	Rat
1581552	Pur12	Proteinuria QTL 12	5.19	0.0009	urine total protein amount (VT:0000032)	urine protein excretion rate (CMO:0000759)	2	112103657	148076632	Rat
1558653	Prcr1	Prostate cancer resistance QTL 1	5		prostate integrity trait (VT:0010571)	area of ventral prostate occupied by tumorous lesions to total ventral prostate area ratio (CMO:0000899)	2	72532993	157142209	Rat
1354622	Kidm16	Kidney mass QTL 16	3		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	2	81754530	222436696	Rat
631266	Bp132	Blood pressure QTL 132		0.0005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	46123260	202447032	Rat
7207808	Bmd89	Bone mineral density QTL 89	4.1		femur strength trait (VT:0010010)	femoral neck ultimate force (CMO:0001703)	2	88862519	133862519	Rat
1558648	Smcn1	Smooth muscle cell number QTL 1		0.039	blood vessel smooth muscle cell quantity (VT:0010525)	aorta smooth muscle cell count per unit vessel length (CMO:0001646)	2	59134147	127460910	Rat
2293843	Kiddil6	Kidney dilation QTL 6	3.1		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	2	42804607	182042367	Rat
152025206	Hrtrt23	Heart rate QTL 23	5.98		heart pumping trait (VT:2000009)		2	28484589	169504100	Rat
1354605	Rf48	Renal function QTL 48	2.9		blood creatinine amount (VT:0005328)	plasma creatinine level (CMO:0000537)	2	74786664	206665859	Rat
152025204	Hrtrt22	Heart rate QTL 22	5.6		heart pumping trait (VT:2000009)		2	28484589	169504100	Rat
1354601	Slep1	Serum leptin concentration QTL 1	5.39		blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	2	43171017	184114403	Rat
61438	Cia7	Collagen induced arthritis QTL 7	4.6	0.0001	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	2	59324377	141596857	Rat
1354603	Bp243	Blood pressure QTL 243	3.9		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	26917817	127469484	Rat

Markers in Region

RH128644

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	112,207,883 - 112,208,091 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	115,823,680 - 115,823,887	NCBI	Rnor6.0
Rnor_5.0	2	135,520,189 - 135,520,396	UniSTS	Rnor5.0
RGSC_v3.4	2	116,626,566 - 116,626,773	UniSTS	RGSC3.4
Celera	2	107,395,021 - 107,395,228	UniSTS
RH 3.4 Map	2	718.1	UniSTS
Cytogenetic Map	2	q24	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	10	66	150	72	71	40	58	40	6	293	151	7	133	78	92	31	8	8

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_053457	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF324043	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY032974	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC070927	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473961	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000002	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000014359 ⟹ ENSRNOP00000014359

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	2	114,136,234 - 114,149,539 (-)	Ensembl
mRatBN7.2 Ensembl	2	112,207,745 - 112,221,050 (-)	Ensembl
Rnor_6.0 Ensembl	2	115,823,538 - 115,836,846 (-)	Ensembl

RefSeq Acc Id:

NM_053457 ⟹ NP_445909

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	114,136,234 - 114,149,539 (-)	NCBI
mRatBN7.2	2	112,207,745 - 112,221,050 (-)	NCBI
Rnor_6.0	2	115,823,541 - 115,836,846 (-)	NCBI
Rnor_5.0	2	135,520,050 - 135,533,355 (-)	NCBI
RGSC_v3.4	2	116,626,427 - 116,639,732 (-)	RGD
Celera	2	107,394,882 - 107,408,187 (-)	RGD

Sequence:

show sequence

GTCCCCGCCAGGCGCACCTGTCCCCGCTGCACGCCGTCGCAGCAGCGCTCGCAGCCTCTCCTCT
CCACTCGGAGTATCCCGGAGCCAGCGGCTTGCGAGGGCGGGAGAGAGCAAGCCTAGGGAAGGCT
CTGTCCAGGCCGGCGCAGGGGGCACAGTCCGTGTGGGTCGAGCTGCGTGGACGTCGCTGCGGCC
ACCATGGTAGCCACTTGCCTGCAGGTGGTGGGCTTCGTCACTAGCTTCGTGGGTTGGATTGGCA
TCATCGTCACAACGTCCACCAATGACTGGGTGGTGACCTGCAGCTACACCATCCCCACCTGCCG
CAAAATGGACGAACTGGGCTCCAAGGGGCTGTGGGCCGACTGCGTCATGGCCACTGGTCTCTAC
CACTGCAAGCCCCTGGTGGACATCCTCATCCTCCCTGGTTACGTGCAGGCTTGTAGAGCCCTCA
TGATTGCTGCCTCAGTTCTGGGCCTGCCGGCCATCTTGCTGCTGTTAACAGTTCTCCCCTGTAT
CCGAATGGGCCACGAGCCTGGAGTGGCCAAGTACAGGCGAGCCCAGCTGGCTGGGGTGCTCCTT
ATTCTGCTGGCTCTCTGCGCCATTGTCGCCACCATCTGGTTTCCTGTATGCGCCCACCGCGAGA
TCACCATCGTGAGCTTTGGCTACTCGCTGTATGCGGGCTGGATCGGTGCTGTGATGTGCCTGGT
GGGTGGCTGTGTCATCGTCTGCTGCTCCGGGGATGCACAGTCGTTTGGAGAAAACCGTTTCTAT
TACTCTTCTGGCTCCAGCTCACCAACGCACGCCAAGAGTGCCCATGTCTAAGAGGGCTGCTCCA
CTGCCCACCGAGGTGCTGTAAATGCTGGGCCTGGGCCCTGGGTTTGCTTGCCACAGTGGGGAGA
AGCCCACTTCCCTGCCAGGCACTAAAGCCAAAGTTCTAGAAAGTATCCTGCCTGGCATTTTGCA
GTCATAACACCCCACCCATCCACCCACCCACCCACCCACCACCTCTTGGTTGCCTTAAAAGAAA
TCTCCAGCTCAGATAATGCCCACATAGTTTTCTCCTGGAGTTGCAGGCTGTTCGCTCCTTTCCT
CGGGCGTTCCATTGTTGTTGATTAAAAAAATATTGTGTTTCTCTCTTAAATCCAAATGTCTTGG
GAACATTGCTGACTTGGGTGTGGGTTGGGAGAGAAATAAAAGATGCTTTTCAAAGGGTTACCAG
CGACAATGGAAGCCTCGTAGAGACAGCGCTCTTCTCTCTTTCGGCTTAGTTTCAAGGTCACTTA
CATATAAGAGATAGAAACGGATAGACTTGGAACACGGGTGGGAGGGGAACTCGGGGCATTCCCT
CCGTGGGAAAGAAGCTTCTCTTTTATAAGTTGAGGGGTTGGGTCTCTCTCTCTCTTTTTTTTTT
TTTAGTTTGTGATTTTACATTTTTCTGTATATACTTTTTCAAGATCGATCGTTTTTATAACCAC
GGGTTTCCTGAAATTCTCAATTCACCAATATGAAGGAAATGAACCAAGCAGACGTTAATATGCA
ATAAGTAATAGTACGGAGATTATAACTTTAACTGACCACCCCCAGTTTCCAGGTTTGTATGCTG
TAGTTTTTAATTCTACGGTTGCGTATGCTTTGAATTAACACATTTAAAAACCCTTTCTCCCCTT
CTATCTCTGTCTCCATTCTGTTAGCGATCTTGAAGCAGTGCTGTTTAGCATAAGTTGTACTGTT
GAATTTGGCTTCATGGGTGTAAACACCGATGGTCTGTCAGTGTCTAAGATTCTGGGCACTGCAA
GCTCGGCTCGGTGCATTTGTTTCAGGTAAAATCTGTGCAATAAAATAACAAACTGTCAAAAAAA
AAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_445909	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAG50277	(Get FASTA)	NCBI Sequence Viewer
	AAH70927	(Get FASTA)	NCBI Sequence Viewer
	AAK52076	(Get FASTA)	NCBI Sequence Viewer
	EDM01147	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000014359
GenBank Protein	Q99P82	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_445909 ⟸ NM_053457

- UniProtKB:

Q99P82 (UniProtKB/Swiss-Prot), Q6IRG7 (UniProtKB/TrEMBL), F7FQF2 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MVATCLQVVGFVTSFVGWIGIIVTTSTNDWVVTCSYTIPTCRKMDELGSKGLWADCVMATGLYH
CKPLVDILILPGYVQACRALMIAASVLGLPAILLLLTVLPCIRMGHEPGVAKYRRAQLAGVLLI
LLALCAIVATIWFPVCAHREITIVSFGYSLYAGWIGAVMCLVGGCVIVCCSGDAQSFGENRFYY
SSGSSSPTHAKSAHV

hide sequence

Ensembl Acc Id:

ENSRNOP00000014359 ⟸ ENSRNOT00000014359

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q99P82-F1-model_v2	AlphaFold	Q99P82	1-207	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13691271

Promoter ID:

EPDNEW_R1796

Type:

initiation region

Name:

Cldn11_1

Description:

claudin 11

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	2	115,836,855 - 115,836,915	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:71081	AgrOrtholog
BioCyc Gene	G2FUF-53478	BioCyc
Ensembl Genes	ENSRNOG00000010263	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000014359	ENTREZGENE
Gene3D-CATH	1.20.140.150	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7096642	IMAGE-MGC_LOAD
InterPro	Claudin	UniProtKB/Swiss-Prot
	Claudin11	UniProtKB/Swiss-Prot
	Claudin_CS	UniProtKB/Swiss-Prot
	PMP22/EMP/MP20/Claudin	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:91580	IMAGE-MGC_LOAD
NCBI Gene	84588	ENTREZGENE
PANTHER	PTHR12002	UniProtKB/Swiss-Prot
Pfam	PMP22_Claudin	UniProtKB/Swiss-Prot
PhenoGen	Cldn11	PhenoGen
PRINTS	CLAUDIN	UniProtKB/Swiss-Prot
	CLAUDIN11	UniProtKB/Swiss-Prot
PROSITE	CLAUDIN	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000010263	RatGTEx
UniProt	CLD11_RAT	UniProtKB/Swiss-Prot
	F7FQF2	ENTREZGENE, UniProtKB/TrEMBL
	Q6IRG7	ENTREZGENE, UniProtKB/TrEMBL
	Q99P82	ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2002-07-09	Cldn11	claudin 11			Symbol and Name updated to reflect Human and Mouse nomenclature	70877	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_regulation	expression decreases in response to TGF-beta3	70685

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)