Fabp5 (fatty acid binding protein 5)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Fabp5 (fatty acid binding protein 5) Rattus norvegicus

Analyze

Symbol:

Fabp5

Name:

fatty acid binding protein 5

RGD ID:

70997

Description:

Enables fatty acid binding activity. Involved in response to wounding. Predicted to be located in cytoplasm; extracellular space; and postsynaptic density. Predicted to be active in cytosol and nucleus. Orthologous to several human genes including FABP5 (fatty acid binding protein 5); PARTICIPATES IN retinoic acid metabolic pathway; eicosanoid signaling pathway via peroxisome proliferator-activated receptor gamma; INTERACTS WITH 1-naphthyl isothiocyanate; 17alpha-ethynylestradiol; 2,2',4,4'-Tetrabromodiphenyl ether.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

C-FABP; cutaneous fatty acid-binding protein; DA11; E-FABP; epidermal-type fatty acid-binding protein; fatty acid binding protein 5, epidermal; fatty acid-binding protein 5; fatty acid-binding protein, epidermal

RGD Orthologs

Human

Mouse

Chinchilla

Bonobo

Dog

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	2	91,765,056 - 91,768,716 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	91,765,056 - 91,853,773 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	98,262,009 - 98,265,679 (-)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	2	96,383,007 - 96,386,677 (-)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	2	91,439,871 - 91,443,541 (-)	NCBI	Rnor_WKY
Rnor_6.0	2	93,981,662 - 93,985,322 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	93,981,656 - 93,985,378 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	113,735,156 - 113,738,856 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
Celera	2	87,366,175 - 87,369,839 (-)	NCBI		Celera
Cytogenetic Map	2	q23	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

genetic disease (ISO)

hepatocellular carcinoma (ISO)

Myocardial Ischemia (ISO)

prostate cancer (ISO)

psoriasis (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dichloroethane (ISO)

1-naphthyl isothiocyanate (EXP)

17alpha-ethynylestradiol (EXP,ISO)

17beta-estradiol (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (EXP,ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

2,4-dinitrotoluene (EXP)

2-butoxyethanol (ISO)

2-hydroxypropanoic acid (ISO)

3,3',4,4',5-pentachlorobiphenyl (EXP)

3,3',5-triiodo-L-thyronine (EXP)

3,4-methylenedioxymethamphetamine (ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

3H-1,2-dithiole-3-thione (EXP)

4,4'-diaminodiphenylmethane (EXP)

4,4'-sulfonyldiphenol (ISO)

5-aza-2'-deoxycytidine (ISO)

6-propyl-2-thiouracil (EXP)

9-cis-retinoic acid (ISO)

aflatoxin B1 (ISO)

all-trans-4-oxoretinoic acid (ISO)

all-trans-retinoic acid (ISO)

ammonium chloride (EXP)

amphetamine (EXP)

antirheumatic drug (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

arsenous acid (ISO)

benzo[a]pyrene (ISO)

benzo[b]fluoranthene (ISO)

Benzo[k]fluoranthene (ISO)

beta-hexachlorocyclohexane (ISO)

bis(2-chloroethyl) sulfide (ISO)

bis(2-ethylhexyl) phthalate (EXP,ISO)

bisphenol A (EXP,ISO)

Brodifacoum (EXP)

buspirone (EXP)

butanal (ISO)

Butylbenzyl phthalate (EXP)

cadmium atom (EXP,ISO)

cadmium dichloride (EXP,ISO)

calciol (ISO)

capsaicin (ISO)

carbon nanotube (ISO)

CGP 52608 (ISO)

chloropicrin (ISO)

choline (EXP,ISO)

ciguatoxin CTX1B (ISO)

cisplatin (EXP)

clofibrate (ISO)

clofibric acid (EXP)

cobalt dichloride (EXP,ISO)

copper atom (ISO)

copper(0) (ISO)

copper(II) sulfate (ISO)

coumestrol (ISO)

cyanocob(III)alamin (ISO)

dexamethasone (ISO)

diarsenic trioxide (ISO)

dibutyl phthalate (EXP)

dichlorine (EXP)

dichloroacetic acid (ISO)

diclofenac (ISO)

diethyl phthalate (EXP)

diethylstilbestrol (ISO)

diisobutyl phthalate (EXP)

diisononyl phthalate (EXP)

dioxygen (EXP)

dipotassium bis[mu-tartrato(4-)]diantimonate(2-) trihydrate (ISO)

diuron (EXP)

dorsomorphin (ISO)

doxorubicin (ISO)

emodin (ISO)

endosulfan (EXP)

enzyme inhibitor (ISO)

epoxiconazole (ISO)

ethanol (EXP,ISO)

ethyl methanesulfonate (ISO)

flutamide (EXP)

folic acid (EXP,ISO)

fonofos (ISO)

fulvestrant (ISO)

furan (EXP)

gentamycin (EXP)

glafenine (EXP)

glycine betaine (ISO)

graphene oxide (ISO)

hydrogen peroxide (ISO)

indometacin (ISO)

isoprenaline (ISO)

isotretinoin (ISO)

ivermectin (ISO)

L-methionine (EXP,ISO)

lead(0) (ISO)

lead(2+) (ISO)

melphalan (ISO)

mercury atom (EXP)

mercury(0) (EXP)

methcathinone (ISO)

methyl methanesulfonate (ISO)

methylisothiazolinone (ISO)

methylmercury chloride (ISO)

microcystin RR (ISO)

monosodium L-glutamate (ISO)

N-methyl-4-phenylpyridinium (EXP)

N-nitrosodiethylamine (EXP,ISO)

nefazodone (EXP)

nickel sulfate (ISO)

nimesulide (EXP)

nitrofen (EXP)

ochratoxin A (EXP)

ozone (EXP,ISO)

paracetamol (EXP,ISO)

paraquat (ISO)

parathion (ISO)

perfluorobutyric acid (ISO)

perfluorooctane-1-sulfonic acid (EXP,ISO)

perfluorooctanoic acid (EXP)

phenacetin (EXP)

phenformin (EXP)

phenobarbital (EXP,ISO)

phenylhydrazine (EXP)

piperonyl butoxide (EXP)

pirinixic acid (ISO)

pravastatin (EXP,ISO)

pregnenolone 16alpha-carbonitrile (EXP,ISO)

progesterone (ISO)

propiconazole (ISO)

protein kinase inhibitor (ISO)

quercetin (ISO)

quinolin-8-ol (ISO)

rac-lactic acid (ISO)

rotenone (EXP)

sarin (EXP)

SB 431542 (ISO)

silicon dioxide (ISO)

sodium arsenate (ISO)

sodium arsenite (ISO)

sodium dichromate (EXP,ISO)

Soman (EXP)

sunitinib (ISO)

terbufos (ISO)

testosterone (ISO)

thalidomide (ISO)

thioacetamide (EXP)

titanium dioxide (EXP)

toluene (EXP)

tributylstannane (ISO)

trichostatin A (ISO)

triphenyl phosphate (EXP,ISO)

Triptolide (ISO)

troglitazone (ISO)

tungsten (ISO)

urethane (ISO)

valdecoxib (EXP)

valproic acid (ISO)

vorinostat (ISO)

zaragozic acid A (EXP,ISO)

zinc atom (ISO)

zinc sulfate (ISO)

zinc(0) (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

fatty acid transport (IBA)

glucose homeostasis (ISO)

glucose metabolic process (ISO)

lipid metabolic process (ISO)

lipid transport across blood-brain barrier (ISO)

long-chain fatty acid transport (ISO)

negative regulation of glucose transmembrane transport (ISO)

phosphatidylcholine biosynthetic process (ISO)

positive regulation of cold-induced thermogenesis (ISO,ISS)

positive regulation of peroxisome proliferator activated receptor signaling pathway (ISO)

regulation of prostaglandin biosynthetic process (ISO)

regulation of retrograde trans-synaptic signaling by endocanabinoid (ISO,ISS)

regulation of sensory perception of pain (ISO)

response to wounding (IEP)

Cellular Component

cytoplasm (ISO)

cytosol (IBA)

extracellular space (ISO,ISS)

nucleus (IBA,ISO)

postsynaptic density (ISO,ISS)

synapse (ISO,ISS)

Molecular Function

fatty acid binding (IBA,IDA,ISO)

identical protein binding (ISO)

lipid binding (IEA)

long-chain fatty acid transporter activity (ISO)

protein binding (ISO)

retinoic acid binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

eicosanoid signaling pathway via peroxisome proliferator-activated receptor gamma (IEA)

retinoic acid metabolic pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Fatty acid binding protein is induced in neurons of the dorsal root ganglia after peripheral nerve injury.	De Leon M, etal., J Neurosci Res 1996 May 1;44(3):283-92.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
4.	Gene expression profiling of Japanese psoriatic skin reveals an increased activity in molecular stress and immune response signals.	Kulski JK, etal., J Mol Med. 2005 Dec;83(12):964-75. Epub 2005 Nov 11.
5.	Gene Data Set	MGD Curation, June 12, 2002
6.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
7.	Physiological insights into all-trans-retinoic acid biosynthesis.	Napoli JL Biochim Biophys Acta. 2012 Jan;1821(1):152-67. Epub 2011 May 19.
8.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
9.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
10.	GOA pipeline	RGD automated data pipeline
11.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
12.	Fatty acid binding protein 4 and 5 play a crucial role in thermogenesis under the conditions of fasting and cold stress.	Syamsunarno MR, etal., PLoS One. 2014 Mar 6;9(6):e90825. doi: 10.1371/journal.pone.0090825. eCollection 2014.
13.	PDLIM4 repression by hypermethylation as a potential biomarker for prostate cancer.	Vanaja DK, etal., Clin Cancer Res. 2006 Feb 15;12(4):1128-36.
14.	Molecular cloning of a cDNA encoding a novel fatty acid-binding protein from rat skin.	Watanabe R, etal., Biochem Biophys Res Commun 1994 Apr 15;200(1):253-9.
15.	Lens epithelial cell mRNA, II. Expression of a mRNA encoding a lipid-binding protein in rat lens epithelial cells.	Wen Y, etal., Gene 1995 Jun 9;158(2):269-74.

Additional References at PubMed

PMID:8092987	PMID:10965032	PMID:12540600	PMID:14676186	PMID:15164767	PMID:17512406	PMID:17898460	PMID:18513372	PMID:20211260	PMID:20458337	PMID:20854474	PMID:21099311
PMID:21395585	PMID:23376485	PMID:23533145	PMID:24531463	PMID:24692551	PMID:29440395	PMID:29531087	PMID:30485159

Genomics

Comparative Map Data

Fabp5
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	2	91,765,056 - 91,768,716 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	91,765,056 - 91,853,773 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	98,262,009 - 98,265,679 (-)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	2	96,383,007 - 96,386,677 (-)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	2	91,439,871 - 91,443,541 (-)	NCBI	Rnor_WKY
Rnor_6.0	2	93,981,662 - 93,985,322 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	93,981,656 - 93,985,378 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	113,735,156 - 113,738,856 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
Celera	2	87,366,175 - 87,369,839 (-)	NCBI		Celera
Cytogenetic Map	2	q23	NCBI

FABP5
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	8	81,280,536 - 81,284,775 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	8	81,280,536 - 81,284,777 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	8	82,192,771 - 82,197,010 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	8	82,355,340 - 82,359,563 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	8	82,355,339 - 82,359,563	NCBI
Celera	8	78,197,737 - 78,201,964 (+)	NCBI		Celera
Cytogenetic Map	8	q21.13	NCBI
HuRef	8	77,682,447 - 77,686,745 (+)	NCBI		HuRef
CHM1_1	8	82,244,290 - 82,248,584 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	8	81,712,114 - 81,716,359 (+)	NCBI		T2T-CHM13v2.0

Fabp5
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	3	10,077,645 - 10,081,670 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	3	10,077,608 - 10,081,667 (+)	Ensembl		GRCm39 Ensembl
GRCm38	3	10,012,585 - 10,016,610 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	3	10,012,548 - 10,016,607 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	3	10,012,606 - 10,016,610 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	3	9,995,138 - 9,999,142 (+)	NCBI		MGSCv36	mm8
Celera	3	10,036,283 - 10,040,303 (+)	NCBI		Celera
Cytogenetic Map	3	A1	NCBI

Fabp5
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955444	325,515 - 331,516 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955444	325,515 - 329,248 (-)	NCBI	ChiLan1.0	ChiLan1.0

FABP5
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
PanPan1.1	8	79,426,678 - 79,430,879 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	8	79,426,684 - 79,430,879 (+)	Ensembl	panpan1.1		panPan2
Mhudiblu_PPA_v0	8	77,803,369 - 77,807,630 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3

LOC102155424
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	X	35,086,820 - 35,087,968 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	X	22,435,088 - 22,436,224 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	X	35,135,219 - 35,136,355 (+)	NCBI		ROS_Cfam_1.0
UMICH_Zoey_3.1	X	35,214,287 - 35,215,423 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	X	35,186,976 - 35,188,112 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	X	35,229,782 - 35,230,918 (+)	NCBI		UU_Cfam_GSD_1.0

Fabp5
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405303	50,691,127 - 50,695,573 (-)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936656	2,881,552 - 2,886,192 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

FABP5
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	4	55,275,205 - 55,282,908 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	4	55,277,831 - 55,282,585 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	4	60,306,428 - 60,311,182 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

FABP5
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	8	76,696,899 - 76,701,459 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666039	64,492,525 - 64,497,788 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Fabp5
(Heterocephalus glaber - naked mole-rat)

Naked Mole-rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624744	10,129,515 - 10,133,700 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Fabp5
7 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	19
Count of miRNA genes:	19
Interacting mature miRNAs:	19
Transcripts:	ENSRNOT00000075493
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
61355	Bp36	Blood pressure QTL 36	2.9		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	2	5873687	102844969	Rat
1302794	Stl27	Serum triglyceride level QTL 27	4.4	0.0001	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	2	25413423	143657569	Rat
1358894	Kidm24	Kidney mass QTL 24	4.03		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	25413423	157142209	Rat
1358899	Kidm23	Kidney mass QTL 23	3.88		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	25413423	157142209	Rat
1358901	Cm38	Cardiac mass QTL 38	2		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	157142209	Rat
1358904	Cm39	Cardiac mass QTL 39	2.26		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	157142209	Rat
1358910	Kidm27	Kidney mass QTL 27	5.77		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	25413423	157142209	Rat
1358911	Kidm28	Kidney mass QTL 28	5.42		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	25413423	157142209	Rat
1358913	Cm41	Cardiac mass QTL 41	2.73		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	203928301	Rat
1358917	Cm42	Cardiac mass QTL 42	2.82		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	203928301	Rat
1358887	Bw50	Body weight QTL 50	2.39		body mass (VT:0001259)	body weight (CMO:0000012)	2	25413652	157142078	Rat
1358908	Bw49	Body weight QTL 49	3.36		body mass (VT:0001259)	body weight (CMO:0000012)	2	25413652	157142078	Rat
1354603	Bp243	Blood pressure QTL 243	3.9		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	26917817	127469484	Rat
2290453	Scl55	Serum cholesterol level QTL 55	2.83		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	2	26917817	136917119	Rat
70174	BpQTLCluster2	Blood pressure QTL cluster 2	4.24		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	40067944	102785628	Rat
70174	BpQTLCluster2	Blood pressure QTL cluster 2	4.24		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	40067944	102785628	Rat
70174	BpQTLCluster2	Blood pressure QTL cluster 2	4.24		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	40067944	102785628	Rat
70174	BpQTLCluster2	Blood pressure QTL cluster 2	4.24		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	2	40067944	102785628	Rat
70174	BpQTLCluster2	Blood pressure QTL cluster 2	4.24		arterial blood pressure trait (VT:2000000)	absolute change in mean arterial blood pressure (CMO:0000533)	2	40067944	102785628	Rat
2293835	Kiddil5	Kidney dilation QTL 5	3.8		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	2	42804607	157142209	Rat
2293843	Kiddil6	Kidney dilation QTL 6	3.1		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	2	42804607	182042367	Rat
1298074	Bp164	Blood pressure QTL 164		0.003	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	42804607	202447032	Rat
1298085	Bp165	Blood pressure QTL 165		0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	42804607	202447032	Rat
61467	Bp14	Blood pressure QTL 14	2.2		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	43154682	202446871	Rat
61467	Bp14	Blood pressure QTL 14	2.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	43154682	202446871	Rat
2293676	Bmd19	Bone mineral density QTL 19	10.7	0.0001	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	2	43162366	111362592	Rat
2293682	Bmd24	Bone mineral density QTL 24	8.9	0.0001	femur mineral mass (VT:0010011)	compact volumetric bone mineral density (CMO:0001730)	2	43162366	111362592	Rat
2293671	Bss44	Bone structure and strength QTL 44	10.97	0.0001	lumbar vertebra morphology trait (VT:0010494)	lumbar vertebra cortical cross-sectional area (CMO:0001690)	2	43162366	148478373	Rat
1354601	Slep1	Serum leptin concentration QTL 1	5.39		blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	2	43171017	184114403	Rat
631266	Bp132	Blood pressure QTL 132		0.0005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	46123260	202447032	Rat
1331760	Bp206	Blood pressure QTL 206	3.62454		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	56043031	202447032	Rat
1558648	Smcn1	Smooth muscle cell number QTL 1		0.039	blood vessel smooth muscle cell quantity (VT:0010525)	aorta smooth muscle cell count per unit vessel length (CMO:0001646)	2	59134147	127460910	Rat
5684990	Bmd82	Bone mineral density QTL 82	2.8		tibia mineral mass (VT:1000283)	bone mineral content (CMO:0001554)	2	59324377	103795077	Rat
5684996	Bmd85	Bone mineral density QTL 85	4.7	0.024	tibia mineral mass (VT:1000283)	bone mineral density (CMO:0001226)	2	59324377	103795077	Rat
61438	Cia7	Collagen induced arthritis QTL 7	4.6	0.0001	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	2	59324377	141596857	Rat
631500	Bp99	Blood pressure QTL 99	2.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	59324719	102755241	Rat
1578777	Stresp15	Stress response QTL 15	2	0.05	blood aldosterone amount (VT:0005346)	plasma aldosterone level (CMO:0000551)	2	59846005	104846005	Rat
2306903	Bp336	Blood pressure QTL 336		0.01	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	64366971	109366971	Rat
1298080	Bp163	Blood pressure QTL 163		0.02	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	66118275	202447032	Rat
1354648	Bp239	Blood pressure QTL 239		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	66118463	226797303	Rat
7411551	Bw131	Body weight QTL 131	29.6	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	2	67942638	112942638	Rat
1558653	Prcr1	Prostate cancer resistance QTL 1	5		prostate integrity trait (VT:0010571)	area of ventral prostate occupied by tumorous lesions to total ventral prostate area ratio (CMO:0000899)	2	72532993	157142209	Rat
1359034	Bp274	Blood pressure QTL 274			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	74786664	94359546	Rat
1359034	Bp274	Blood pressure QTL 274			arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	74786664	94359546	Rat
1354605	Rf48	Renal function QTL 48	2.9		blood creatinine amount (VT:0005328)	plasma creatinine level (CMO:0000537)	2	74786664	206665859	Rat
61465	Bp13	Blood pressure QTL 13	3.3		blood pressure trait (VT:0000183)	diastolic blood pressure (CMO:0000005)	2	76539322	102785628	Rat
61465	Bp13	Blood pressure QTL 13	3.3		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	2	76539322	102785628	Rat
631198	Cm22	Cardiac mass QTL 22	4.3	0.0008	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	2	76539322	150540526	Rat
61374	Edpm2	Estrogen-dependent pituitary mass QTL 2	4.42	0.86	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	2	76539322	202447032	Rat
2299162	Iddm32	Insulin dependent diabetes mellitus QTL 32	2.36		blood glucose amount (VT:0000188)	age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140)	2	78665616	143657569	Rat
1581569	Uae32	Urinary albumin excretion QTL 32		0.0001	urine protein amount (VT:0005160)	urine albumin excretion rate (CMO:0000757)	2	78665619	219826953	Rat
724534	Uae6	Urinary albumin excretion QTL 6	10		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	2	78665619	249053267	Rat
61392	Bp6	Blood pressure QTL 6	7		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	2	80270434	125270434	Rat
1598865	Bp296	Blood pressure QTL 296	2.1		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	81018907	126018907	Rat
8662832	Vetf7	Vascular elastic tissue fragility QTL 7	3.5		aorta elastin amount (VT:0003905)	aorta wall extracellular elastin dry weight to aorta wall dry weight ratio (CMO:0002002)	2	81689826	221035911	Rat
1354622	Kidm16	Kidney mass QTL 16	3		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	2	81754530	222436696	Rat
1354649	Kidm17	Kidney mass QTL 17	2.9		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	2	81754530	227146641	Rat
1578772	Stresp14	Stress response QTL 14	5	0.001	blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	2	82345893	130923501	Rat
7207808	Bmd89	Bone mineral density QTL 89	4.1		femur strength trait (VT:0010010)	femoral neck ultimate force (CMO:0001703)	2	88862519	133862519	Rat
2300165	Bmd49	Bone mineral density QTL 49	4.8	0.0001	lumbar vertebra mineral mass (VT:0010511)	bone mineral density (CMO:0001226)	2	88862519	133862519	Rat
2300170	Bmd45	Bone mineral density QTL 45	12.1	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	2	88862519	133862519	Rat
2300185	Bmd46	Bone mineral density QTL 46	8.4	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	2	88862519	133862519	Rat

Markers in Region

RH128775

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	91,765,101 - 91,765,310 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	93,981,708 - 93,981,916	NCBI	Rnor6.0
Rnor_5.0	2	113,735,205 - 113,735,413	UniSTS	Rnor5.0
Celera	2	87,366,221 - 87,366,429	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High			20	20		20			18
Medium	3	40	31	20	19	20	2	4	56	32	38	11	2
Low		3	6	1		1	6	7		3	3		6
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_145878	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473961	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DQ255913	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ210725	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ228381	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000067	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	S69874	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	S83247	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U13253	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSRNOT00000075493 ⟹ ENSRNOP00000064809

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	91,765,056 - 91,853,773 (-)	Ensembl
Rnor_6.0 Ensembl	2	93,981,656 - 93,985,378 (-)	Ensembl

RefSeq Acc Id:

NM_145878 ⟹ NP_665885

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	2	91,765,056 - 91,768,716 (-)	NCBI
Rnor_6.0	2	93,981,662 - 93,985,322 (-)	NCBI
Rnor_5.0	2	113,735,156 - 113,738,856 (-)	NCBI
Celera	2	87,366,175 - 87,369,839 (-)	RGD

Sequence:

show sequence

GGCACGAGTCTCCTTGCTGCTTTTGTGCTCTCCCGCTCGCCATGGCCAGCCTTAAGGACCTGGA
AGGGAAGTGGCGTCTGGTGGAAAGCCACGGGTTTGAGGACTACATGAAGGAACTAGGAGTAGGG
CTGGCTCTTAGGAAGATGGGTGCCATGGCCAAACCAGACTGCATCATTACCCTCGACAACAACA
ACCTCACCGTCAAAACTGAGAGCACAGTGAAGACGACCGTGTTTTCTTGCACCTTGGGAGAGAA
GTTTGATGAAACCACAGCTGATGGCAGGAAAACTGAGACGGTCTGCACCTTCACAGACGGTGCC
CTGGTCCAGCACCAGAAGTGGGAAGGGAAAGAAAGCACGATAACGAGAAAACTGAAGGACGGGA
AGATGGTGGTGGAGTGCGTCATGAACAATGCCATCTGTACTCGGGTCTATGAGAAGGTACAATG
AGGACTGGCTAACTCGTCATCCTGGACAGCAGTCAGCTGGCTGAGGGAATAGCTCAATTCAATG
AGCAGGTCGTACAGAACCACACTGCTTCACTTCTTTGGTTTTATTTTTCATGACTTTTCATCAT
AGACACTTTACCCGAAACCCATGTCAGACCGTTGGTTTACCCAGGATCATTCCTTTGGTTAGTA
AATAAATGCGTTTGTGCTAATTCA

hide sequence

Protein Sequences


Protein RefSeqs	NP_665885	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA86680	(Get FASTA)	NCBI Sequence Viewer
	AAB30574	(Get FASTA)	NCBI Sequence Viewer
	AAB46848	(Get FASTA)	NCBI Sequence Viewer
	ABB72486	(Get FASTA)	NCBI Sequence Viewer
	EDM00998	(Get FASTA)	NCBI Sequence Viewer
	P55053	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:	NP_665885 ⟸ NM_145878
- UniProtKB:	P97757 (UniProtKB/Swiss-Prot)
- Sequence:	show sequence MASLKDLEGKWRLVESHGFEDYMKELGVGLALRKMGAMAKPDCIITLDNNNLTVKTESTVKTTV FSCTLGEKFDETTADGRKTETVCTFTDGALVQHQKWEGKESTITRKLKDGKMVVECVMNNAICT RVYEKVQ hide sequence

RefSeq Acc Id:

ENSRNOP00000064809 ⟸ ENSRNOT00000075493

Protein Domains

Lipocalin/cytosolic fatty-acid binding

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P55053-F1-model_v2	AlphaFold	P55053	1-135	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13691239

Promoter ID:

EPDNEW_R1763

Type:

multiple initiation site

Name:

Fabp5_1

Description:

fatty acid binding protein 5

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	2	93,985,336 - 93,985,396	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:70997	AgrOrtholog
BioCyc Gene	G2FUF-53742	BioCyc
BioCyc Pathway	PWY-6318 [L-phenylalanine degradation IV (mammalian, via side chain)]	BioCyc
Ensembl Genes	ENSRNOG00000049075	Ensembl, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000064809.2	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000075493.3	UniProtKB/TrEMBL
Gene3D-CATH	2.40.128.20	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	Calycin	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Fatty_acid-bd	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ILBP	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Lipocln_cytosolic_FA-bd_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:140868	UniProtKB/Swiss-Prot
NCBI Gene	140868	ENTREZGENE
PANTHER	FATTY ACID-BINDING PROTEIN 5	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR11955	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Lipocalin	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Fabp5	PhenoGen
PRINTS	FATTYACIDBP	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	FABP	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF50814	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A8L2QXH8_RAT	UniProtKB/TrEMBL
	FABP5_RAT	UniProtKB/Swiss-Prot, ENTREZGENE
	P97757	ENTREZGENE
	Q2XTA4_RAT	UniProtKB/TrEMBL
UniProt Secondary	P97757	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2017-08-18	Fabp5	fatty acid binding protein 5	Fabp5	fatty acid binding protein 5, epidermal	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2002-07-09	Fabp5	fatty acid binding protein 5, epidermal			Symbol and Name updated to reflect Human and Mouse nomenclature	70877	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_expression	mRNA expression in the dorsal root ganglia increases following nerve crush injury	728625

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

RGD Manual Annotations

Imported Annotations - KEGG (archival)