Advanced Search (OLGA)

Gene: Igf2bp1 (insulin-like growth factor 2 mRNA binding protein 1) Rattus norvegicus

Analyze

Symbol:

Igf2bp1

Name:

insulin-like growth factor 2 mRNA binding protein 1

RGD ID:

708580

Description:

Enables mRNA 3'-UTR binding activity. Involved in RNA localization and dendrite arborization. Located in axon; dendritic spine; and neuronal cell body. Orthologous to human IGF2BP1 (insulin like growth factor 2 mRNA binding protein 1); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; ammonium chloride; bis(2-ethylhexyl) phthalate.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

B-actin zipcode-binding protein 1; IGF-II mRNA-binding protein 1; IGF2 mRNA-binding protein 1; IMP-1; Imp1; insulin-like growth factor 2 binding protein 1; insulin-like growth factor 2 mRNA-binding protein 1; insulin-like growth factor 2, binding protein 1; rZBP-1; VICKZ family member 1; ZBP1; zipcode-binding protein-1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	81,405,021 - 81,447,814 (-)	NCBI		GRCr8
mRatBN7.2	10	80,908,300 - 80,951,097 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	80,908,076 - 80,951,129 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	85,857,301 - 85,899,408 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	85,355,335 - 85,397,441 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	80,747,478 - 80,789,863 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	83,774,178 - 83,823,323 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	83,780,203 - 83,822,996 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	83,579,028 - 83,628,914 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	84,671,084 - 84,714,648 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	10	84,685,453 - 84,729,018 (-)	NCBI
Celera	10	79,676,729 - 79,719,122 (-)	NCBI		Celera
Cytogenetic Map	10	q26	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

basal cell carcinoma (ISO)

colon adenoma (ISO)

Experimental Neoplasms (ISO)

hematopoietic system disease (ISO)

hepatocellular carcinoma (ISO)

hereditary breast ovarian cancer syndrome (ISO)

herpes simplex (ISO)

Neoplastic Cell Transformation (ISO)

neuroblastoma (ISO)

trichodontoosseous syndrome (ISO)

Weight Loss (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,4-benzoquinone (ISO)

17beta-estradiol (ISO)

2,3',4,4',5-Pentachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-diaminodiphenylmethane (ISO)

4,4'-sulfonyldiphenol (ISO)

aflatoxin B1 (ISO)

Aflatoxin B2 alpha (ISO)

aldehydo-D-glucose (ISO)

ammonium chloride (EXP)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

benzene (ISO)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (EXP,ISO)

bisphenol A (EXP,ISO)

bisphenol AF (ISO)

bisphenol F (ISO)

buta-1,3-diene (ISO)

butanal (ISO)

caffeine (ISO)

cantharidin (ISO)

cisplatin (ISO)

cobalt dichloride (ISO)

copper(II) sulfate (ISO)

D-glucose (ISO)

dexamethasone (ISO)

diazinon (ISO)

dibutyl phthalate (EXP)

dicrotophos (ISO)

dorsomorphin (ISO)

doxorubicin (ISO)

emetine (ISO)

entinostat (ISO)

enzyme inhibitor (ISO)

fenvalerate (EXP)

fructose (ISO)

fulvestrant (ISO)

gentamycin (EXP)

glucose (ISO)

indometacin (ISO)

ivermectin (ISO)

lead(0) (ISO)

lipopolysaccharide (ISO)

methylmercury chloride (ISO)

mono(2-ethylhexyl) phthalate (ISO)

nickel sulfate (ISO)

ozone (ISO)

paracetamol (EXP,ISO)

paraquat (ISO)

potassium chromate (ISO)

SB 431542 (ISO)

sodium arsenite (ISO)

succimer (ISO)

tert-butyl hydroperoxide (ISO)

titanium dioxide (ISO)

trovafloxacin (ISO)

urethane (ISO)

valproic acid (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

CRD-mediated mRNA stabilization (IBA,ISO,ISS)

dendrite arborization (IMP)

mRNA transport (IEA)

negative regulation of nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay (ISO)

negative regulation of translation (ISO)

nervous system development (IBA)

neuronal stem cell population maintenance (ISO)

pallium cell proliferation in forebrain (ISO)

positive regulation of cytoplasmic translation (ISO)

regulation of mRNA stability involved in response to stress (ISO,ISS)

regulation of translation (IEA)

RNA localization (IMP)

Cellular Component

axon (IDA)

CRD-mediated mRNA stability complex (ISO,ISS)

cytoplasm (IBA,ISO)

cytoplasmic stress granule (IEA,ISO,ISS)

cytosol (IBA,ISO)

dendrite (IDA)

dendritic spine (IDA)

filopodium (IEA)

growth cone (IEA)

lamellipodium (IEA)

neuronal cell body (IDA)

nucleoplasm (IEA,ISO)

nucleus (IBA,IEA)

P-body (IEA,ISO,ISS)

perinuclear region of cytoplasm (IEA)

ribonucleoprotein complex (ISO,ISS)

Molecular Function

mRNA 3'-UTR binding (IBA,IDA,ISO,ISS)

mRNA 5'-UTR binding (ISO)

mRNA binding (ISO,ISS)

N6-methyladenosine-containing RNA reader activity (ISO,ISS)

protein binding (ISO)

RNA binding (IEA)

translation regulator activity (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Localization of a beta-actin messenger ribonucleoprotein complex with zipcode-binding protein modulates the density of dendritic filopodia and filopodial synapses.	Eom T, etal., J Neurosci 2003 Nov 12;23(32):10433-44.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Species-independent contribution of ZBP1/DAI/DLM-1-triggered necroptosis in host defense against HSV1.	Guo H, etal., Cell Death Dis. 2018 Jul 26;9(8):816. doi: 10.1038/s41419-018-0868-3.
4.	Loss of Stromal IMP1 Promotes a Tumorigenic Microenvironment in the Colon.	Hamilton KE, etal., Mol Cancer Res. 2015 Nov;13(11):1478-86. doi: 10.1158/1541-7786.MCR-15-0224. Epub 2015 Jul 20.
5.	Zipcode binding protein 1 regulates the development of dendritic arbors in hippocampal neurons.	Perycz M, etal., J Neurosci. 2011 Apr 6;31(14):5271-85. doi: 10.1523/JNEUROSCI.2387-10.2011.
6.	GOA pipeline	RGD automated data pipeline
7.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
8.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
9.	Activity-dependent trafficking and dynamic localization of zipcode binding protein 1 and beta-actin mRNA in dendrites and spines of hippocampal neurons.	Tiruchinapalli DM, etal., J Neurosci. 2003 Apr 15;23(8):3251-61.

Additional References at PubMed

PMID:9178888	PMID:9891060	PMID:12477932	PMID:15601260	PMID:17101699	PMID:17289661	PMID:17878234	PMID:18490442	PMID:19029303	PMID:20080952	PMID:20631164	PMID:21209918
PMID:22658674	PMID:22681889	PMID:23100434	PMID:23897586	PMID:24192035	PMID:38563050

Genomics

Comparative Map Data

Igf2bp1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	81,405,021 - 81,447,814 (-)	NCBI		GRCr8
mRatBN7.2	10	80,908,300 - 80,951,097 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	80,908,076 - 80,951,129 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	85,857,301 - 85,899,408 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	85,355,335 - 85,397,441 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	80,747,478 - 80,789,863 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	83,774,178 - 83,823,323 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	83,780,203 - 83,822,996 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	83,579,028 - 83,628,914 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	84,671,084 - 84,714,648 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	10	84,685,453 - 84,729,018 (-)	NCBI
Celera	10	79,676,729 - 79,719,122 (-)	NCBI		Celera
Cytogenetic Map	10	q26	NCBI

IGF2BP1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	17	48,996,558 - 49,056,145 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	17	48,997,385 - 49,056,145 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	17	47,074,747 - 47,133,507 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	17	44,429,773 - 44,488,506 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	17	43,529,020 - 43,588,502 (+)	NCBI		Celera
Cytogenetic Map	17	q21.32	NCBI
HuRef	17	42,441,949 - 42,500,581 (+)	NCBI		HuRef
CHM1_1	17	47,140,077 - 47,198,718 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	17	49,859,908 - 49,919,501 (+)	NCBI		T2T-CHM13v2.0

Igf2bp1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	11	95,847,989 - 95,896,770 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	11	95,847,989 - 95,896,766 (-)	Ensembl		GRCm39 Ensembl
GRCm38	11	95,957,163 - 96,005,944 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	11	95,957,163 - 96,005,940 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	11	95,818,477 - 95,867,258 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	11	95,778,822 - 95,822,002 (-)	NCBI		MGSCv36	mm8
Celera	11	105,607,858 - 105,656,580 (-)	NCBI		Celera
Cytogenetic Map	11	D	NCBI
cM Map	11	59.08	NCBI

Igf2bp1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955451	12,312,715 - 12,348,663 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955451	12,312,715 - 12,348,663 (-)	NCBI	ChiLan1.0	ChiLan1.0

IGF2BP1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	19	16,042,863 - 16,101,303 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	17	18,008,913 - 18,067,542 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	17	8,479,806 - 8,538,336 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	17	8,461,552 - 8,519,550 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	17	8,468,240 - 8,519,552 (-)	Ensembl	panpan1.1		panPan2

IGF2BP1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	9	25,199,287 - 25,240,693 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	9	25,198,805 - 25,240,578 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	9	24,660,181 - 24,703,349 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	9	25,994,308 - 26,036,588 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	9	25,993,861 - 26,034,618 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	9	24,762,182 - 24,805,339 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	9	25,020,613 - 25,063,780 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	9	25,149,583 - 25,192,753 (+)	NCBI		UU_Cfam_GSD_1.0

Igf2bp1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405602	24,605,834 - 24,645,145 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936490	12,430,008 - 12,469,083 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936490	12,430,343 - 12,468,794 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

IGF2BP1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	12	25,197,058 - 25,243,272 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	12	25,196,955 - 25,244,660 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	12	25,162,754 - 25,209,240 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

IGF2BP1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	16	69,405,923 - 69,461,613 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	16	69,406,549 - 69,459,175 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666077	40,510,372 - 40,569,936 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Igf2bp1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624795	5,353,005 - 5,385,521 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624795	5,352,932 - 5,391,617 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Igf2bp1
247 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	219
Count of miRNA genes:	153
Interacting mature miRNAs:	164
Transcripts:	ENSRNOT00000008139
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1549846	Scl47	Serum cholesterol level QTL 47	3.6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	10	50574707	95574707	Rat
1298069	Bp168	Blood pressure QTL 168	5.5		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	10	26521957	98003205	Rat
2293669	Bmd33	Bone mineral density QTL 33	4.5	0.0001	femur strength trait (VT:0010010)	femoral neck polar moment of inertia (CMO:0001670)	10	49444551	81709989	Rat
631552	Vetf2	Vascular elastic tissue fragility QTL 2	4.5	0.0002	aorta elastic tissue integrity trait (VT:0010556)	artery internal elastic lamina non-tumorous lesion count (CMO:0001913)	10	41142633	86142633	Rat
61449	Ciaa2	CIA Autoantibody QTL 2	7.1		blood autoantibody amount (VT:0003725)	calculated serum anti-type 2 collagen antibody titer (CMO:0001279)	10	63221094	107211142	Rat
631555	Bp134	Blood pressure QTL 134		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	80515287	91230079	Rat
61325	Aia5	Adjuvant induced arthritis QTL 5		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
1298078	Stresp5	Stress response QTL 5	2.99	0.00025	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	42045676	104670812	Rat
2293679	Bmd30	Bone mineral density QTL 30	3.5	0.0001	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	10	49444551	81709989	Rat
1549831	Bss6	Bone structure and strength QTL 6	4		lumbar vertebra strength trait (VT:0010574)	vertebra ultimate force (CMO:0001678)	10	57576521	102576521	Rat
70164	Bw21	Body weight QTL 21	4.36	0.00005	body mass (VT:0001259)	body weight (CMO:0000012)	10	53797494	98952626	Rat
61463	Bp12	Blood pressure QTL 12	6.3	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	41333258	86333258	Rat
2298548	Neuinf7	Neuroinflammation QTL 7	3.4		nervous system integrity trait (VT:0010566)	spinal cord RT1-B protein level (CMO:0002132)	10	72224939	107211142	Rat
1579919	Bp281	Blood pressure QTL 281		0.01	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	74372084	94965338	Rat
1302404	Cia27	Collagen induced arthritis QTL 27	2.6	0.0045	joint integrity trait (VT:0010548)	experimental arthritis severity measurement (CMO:0001459)	10	76452683	107211142	Rat
1300107	Rf18	Renal function QTL 18	3.41		urine output (VT:0003620)	timed urine volume (CMO:0000260)	10	78775516	98279596	Rat
8694173	Bw149	Body weight QTL 149	4.38	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	10	44441699	89441699	Rat
2300218	Hpcl2	Hepatic cholesterol level QTL 2			liver cholesterol amount (VT:0010498)	liver cholesterol level (CMO:0001597)	10	45029650	95600334	Rat
1554317	Bmd4	Bone mineral density QTL 4	9.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	10	19816042	99406971	Rat
70171	Cari1	Carrageenan-induced inflammation QTL 1	4.9	0.0005	hypodermis integrity trait (VT:0010550)	inflammatory exudate volume (CMO:0001429)	10	53797385	107211142	Rat
10450495	Bp383	Blood pressure QTL 383		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	76246085	94965338	Rat
61354	Pia10	Pristane induced arthritis QTL 10		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
2292617	Ept18	Estrogen-induced pituitary tumorigenesis QTL 18	3.9		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	10	73453136	96120911	Rat
2301967	Cm73	Cardiac mass QTL 73	4.55		heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	10	14487011	89062041	Rat
2313103	Bss80	Bone structure and strength QTL 80	2	0.0001	tibia strength trait (VT:1000284)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	10	62057807	107057807	Rat
2293646	Bss25	Bone structure and strength QTL 25	10.96	0.0001	femur morphology trait (VT:0000559)	femur cross-sectional area (CMO:0001661)	10	69738412	107211142	Rat
2303118	Mamtr7	Mammary tumor resistance QTL 7		0.003	mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	10	9658275	104670812	Rat
70188	BpQTLcluster1	Blood pressure QTL cluster 1	4.864		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	1	42323132	87323132	Rat
2300172	Bmd57	Bone mineral density QTL 57	9.8	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	10	69738412	107211142	Rat
724516	Uae17	Urinary albumin excretion QTL 17	3.6		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	10	78210622	85220348	Rat
70193	Mcs7	Mammary carcinoma susceptibility QTL 7	2.38		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	10	72224939	107211142	Rat
2313105	Bss79	Bone structure and strength QTL 79	1.8	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	10	62057807	107057807	Rat
9589030	Epfw9	Epididymal fat weight QTL 9	19.24	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	10	44441699	89441699	Rat
1357344	Bp249	Blood pressure QTL 249		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	66743655	98003205	Rat
2316949	Gluco60	Glucose level QTL 60	3.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	10	14487011	107057807	Rat
2293652	Bmd22	Bone mineral density QTL 22	4.9	0.0001	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	10	49444551	81709989	Rat
70198	BpQTLcluster9	Blood pressure QTL cluster 9	2.94		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	42323132	87323132	Rat
2306970	Anxrr22	Anxiety related response QTL 22	5.95		fear/anxiety-related behavior trait (VT:1000241)	number of periods of voluntary immobility (CMO:0001045)	10	61345276	98211570	Rat
1359017	Hrtrt21	Heart rate QTL 21	2.4		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	10	51772940	96772940	Rat
2293663	Bss33	Bone structure and strength QTL 33	9.34	0.0001	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	10	69738412	107211142	Rat
7387312	Bw125	Body weight QTL 125	3	0.0047	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight (CMO:0000356)	10	64890616	107211142	Rat
2312672	Insul15	Insulin level QTL 15		0.01	blood insulin amount (VT:0001560)	serum insulin level (CMO:0000358)	10	57134272	102134272	Rat
6893357	Bw102	Body weight QTL 102	0.5	0.36	body mass (VT:0001259)	body weight (CMO:0000012)	10	80515287	101325465	Rat
2317029	Aia19	Adjuvant induced arthritis QTL 19	2.98		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	10	66978955	107211142	Rat
724556	Pur2	Proteinuria QTL 2	5.5		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	10	22427500	90627625	Rat
2306793	Ean5	Experimental allergic neuritis QTL 5	4.7		nervous system integrity trait (VT:0010566)	IFNG-secreting splenocyte count (CMO:0002122)	10	72552416	93995749	Rat
61387	Bp1	Blood pressure QTL 1	5.1		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	10	51770177	107211142	Rat
2317039	Aia6	Adjuvant induced arthritis QTL 6	4.31		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	10	66978955	107211142	Rat
2317043	Aia7	Adjuvant induced arthritis QTL 7	3.82		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	10	37565079	82565079	Rat
2317042	Aia20	Adjuvant induced arthritis QTL 20	3.38		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	10	37565079	82565079	Rat
2298481	Eau9	Experimental allergic uveoretinitis QTL 9		0.0169	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	10	65927233	82565079	Rat
61396	Bp9	Blood pressure QTL 9	4.8	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	68420376	107211142	Rat
1358915	Stresp7	Stress response QTL 7	3.52		blood norepinephrine amount (VT:0005663)	plasma norepinephrine level (CMO:0001010)	10	78899655	87307728	Rat
70363	Bp71	Blood pressure QTL 71		0.04	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	61345276	81714865	Rat
61402	Niddm3	Non-insulin dependent diabetes mellitus QTL 3	4.58		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	10	61345413	82564856	Rat
1331791	Cm31	Cardiac mass QTL 31	3.84606		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	10	29299504	107211142	Rat
70364	Bp72	Blood pressure QTL 72			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	51121100	96121100	Rat
10450498	Bp384	Blood pressure QTL 384		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	67750049	107211142	Rat
4889492	Pancm2	Pancreatic morphology QTL 2	3.2		pancreatic beta cell morphology trait (VT:0005217)	ratio of insulin-positive cell area to total area of splenic region of pancreas (CMO:0001814)	10	76748906	107211142	Rat
6893366	Bw106	Body weight QTL 106	0.3	0.47	body mass (VT:0001259)	body weight (CMO:0000012)	10	70199100	107211142	Rat
2293698	Bss43	Bone structure and strength QTL 43	5.33	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra cross-sectional area (CMO:0001689)	10	59209888	104209888	Rat
631530	Tls3	T-lymphoma susceptibility QTL 3	0	0.0001	thymus integrity trait (VT:0010555)	percentage of study population developing T-cell lymphomas during a period of time (CMO:0001911)	10	51774612	95600334	Rat
1354608	Cm33	Cardiac mass QTL 33	2.8		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	10	54809292	99809292	Rat
1558643	Cm44	Cardiac mass QTL 44	4.8	0.0000368	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	10	61345276	99703528	Rat
631535	Cm51	Cardiac mass QTL 51	3		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	10	51786282	91669536	Rat
631267	Cia20	Collagen induced arthritis QTL 20	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
2293705	Bmd25	Bone mineral density QTL 25	7.1	0.0001	femur mineral mass (VT:0010011)	compact volumetric bone mineral density (CMO:0001730)	10	49444551	81709989	Rat
1576308	Schws1	Schwannoma susceptibility QTL 1		0.0041	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	10	40035094	102359817	Rat
631269	Cia22	Collagen induced arthritis QTL 22	8.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	40035094	104060283	Rat
631268	Cia21	Collagen induced arthritis QTL 21	3.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	14487011	104060283	Rat
7207811	Bmd90	Bone mineral density QTL 90	5.2		femur size trait (VT:1000369)	femoral neck cross-sectional area (CMO:0001697)	10	49444551	81709989	Rat
631270	Cia23	Collagen induced arthritis QTL 23	3.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	40035094	104060283	Rat
7411614	Foco18	Food consumption QTL 18		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	10	44441699	89441699	Rat
2325836	Bp346	Blood pressure QTL 346		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	76246085	84007272	Rat
6893336	Cm75	Cardiac mass QTL 75	0.1	0.87	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	10	61345276	99703528	Rat
12880053	Cm104	Cardiac mass QTL 104		0.009	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	10	73452992	83463334	Rat
631547	Bp87	Blood pressure QTL 87	4.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	47369470	92369470	Rat
61427	Cia16	Collagen induced arthritis QTL 16	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	6357896	96121100	Rat
2292438	Bp311	Blood pressure QTL 311			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	76246085	107211142	Rat
2312662	Slep8	Serum leptin concentration QTL 8		0.05	blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	10	57134272	102134272	Rat
12880050	Am10	Aortic mass QTL 10		0.016	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	10	74372084	84007272	Rat
1358188	Ept9	Estrogen-induced pituitary tumorigenesis QTL 9	3.9		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	10	73453136	96120911	Rat
631537	Oia4	Oil induced arthritis QTL 4			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	75631887	87055282	Rat
634354	Rends3	Renal damage susceptibility QTL 3		0.05	kidney blood vessel morphology trait (VT:0000530)	organ lesion measurement (CMO:0000677)	10	79813789	85160854	Rat
1642980	Bp300	Blood pressure QTL 300			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	68383129	107211142	Rat
631542	Bp82	Blood pressure QTL 82	6.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	26521957	98952741	Rat
2312668	Scl65	Serum cholesterol level QTL 65		0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	10	57134272	102134272	Rat

Markers in Region

BI276370

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	80,908,117 - 80,908,207 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	83,780,021 - 83,780,110	NCBI	Rnor6.0
Rnor_5.0	10	83,584,871 - 83,584,960	UniSTS	Rnor5.0
RGSC_v3.4	10	84,670,902 - 84,670,991	UniSTS	RGSC3.4
Celera	10	79,676,547 - 79,676,636	UniSTS
RH 3.4 Map	10	743.8	UniSTS
Cytogenetic Map	10	q31	UniSTS

UniSTS:498743

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	80,912,390 - 80,913,180 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	83,784,293 - 83,785,082	NCBI	Rnor6.0
Rnor_5.0	10	83,589,142 - 83,589,931	UniSTS	Rnor5.0
RGSC_v3.4	10	84,675,175 - 84,675,964	UniSTS	RGSC3.4
Celera	10	79,680,819 - 79,681,608	UniSTS
Cytogenetic Map	10	q31	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
2	4	30	82	56	64	45	8	45	4	140	44	72	45	54	19

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_175594	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006247193	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC120322	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF541940	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC161831	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473948	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000010	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000008139 ⟹ ENSRNOP00000008139

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	80,908,076 - 80,951,129 (-)	Ensembl
Rnor_6.0 Ensembl	10	83,780,203 - 83,822,996 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000119485 ⟹ ENSRNOP00000095130

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	80,908,076 - 80,951,129 (-)	Ensembl

RefSeq Acc Id:

NM_175594 ⟹ NP_783184

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	81,405,021 - 81,447,814 (-)	NCBI
mRatBN7.2	10	80,908,300 - 80,951,097 (-)	NCBI
Rnor_6.0	10	83,780,203 - 83,822,996 (-)	NCBI
Rnor_5.0	10	83,579,028 - 83,628,914 (-)	NCBI
RGSC_v3.4	10	84,671,084 - 84,714,648 (-)	RGD
Celera	10	79,676,729 - 79,719,122 (-)	RGD

Sequence:

show sequence

GGCGGGCACTTCTCCCGGGCTAACCCGAATTCTCCCGTGACCTCCGCGTGCCCTCAGGCCACCC
ACCGGCCCGGATCTCCGACCAACTTCAGGGGTGGGGTGCGTAGAAAGTTTGCGGCTCCCGCCGC
CCATCTCCACGCCTCTCGGCCTAGGAGGCTCTCCGCCCGCGCCCGCCCCGTTCGGCCTTGCCTG
GGACCGTGTCCTTGCCCCGCCACCGCCACCATGAACAAGCTTTACATCGGCAACCTCAACGAGA
GCGTGACCCCCGCAGACTTGGAGAAAGTATTTGCGGAGCACAAGATCTCCTACAGCGGCCAGTT
CTTGGTCAAATCCGGCTACGCCTTCGTGGACTGCCCCGACGAGCACTGGGCGATGAAGGCCATC
GAAACTTTCTCGGGGAAAGTAGAATTGCAAGGAAAACGCCTAGAGATTGAACACTCGGTACCCA
AAAAACAAAGGAGTCGGAAAATACAGATCCGGAATATTCCACCTCAGCTCCGATGGGAAGTGCT
GGATAGCCTTCTGGCCCAGTACGGCACAGTGGAGAACTGTGAGCAAGTGAACACCGAGAGTGAG
ACGGCGGTGGTCAACGTCACCTACTCTAACCGGGAGCAGACCAGGCAAGCCATCATGAAGCTAA
ATGGCCATCAACTGGAGAACCATGCCCTGAAGGTTTCCTACATACCTGATGAGCAGATAGCACA
AGGTCCTGAGAATGGGCGCCGTGGAGGCTTTGGGTCTCGAGGCCAGCCCAGGCAGGGGTCACCG
GTAGCAGCAGGGGCGCCAGCCAAGCAGCAGCAGGTGGACATCCCTCTCCGGCTCCTGGTGCCCA
CGCAGTATGTAGGCGCCATCATTGGCAAGGAGGGTGCCACCATCCGAAACATCACAAAACAGAC
TCAGTCCAAGATAGACGTGCACAGGAAGGAGAACGCGGGGGCTGCGGAGAAGGCCATCAGTGTG
CACTCGACCCCTGAAGGCTGCTCCTCGGCCTGTAAGATGATCTTGGAGATTATGCACAAGGAGG
CAAAGGACACCAAGACGGCAGACGAAGTTCCCCTGAAGATCCTGGCTCATAATAACTTCGTGGG
GCGACTCATTGGAAAGGAAGGGCGGAACTTGAAGAAAGTGGAGCAGGATACAGAGACTAAGATC
ACCATCTCCTCGCTCCAGGATCTCACGCTCTATAACCCTGAAAGGACCATAACTGTGAAGGGGG
CCATTGAGAACTGCTGCAGGGCTGAGCAGGAGATCATGAAGAAAGTTCGAGAGGCTTACGAGAA
TGACGTGGCTGCCATGAGCTTGCAGTCTCACCTCATCCCTGGTCTCAACCTGGCTGCTGTCGGT
CTCTTCCCAGCTTCTTCTAGTGCCGTTCCGCCTCCTCCCAGCAGCGTCACTGGGGCTGCTCCCT
ATGGCTCCTTCATGCAGGCTCCGGAGCAGGAGATGGTACAGGTGTTCATCCCCGCCCAGGCTGT
GGGCGCCATCATCGGCAAGAAGGGCCAGCACATCAAACAGCTCTCCCGGTTCGCCAGCGCCTCC
ATCAAGATTGCTCCACCAGAAACACCTGACTCCAAAGTTCGAATGGTTGTCATCACTGGACCCC
CAGAGGCTCAGTTCAAGGCTCAGGGAAGAATCTATGGCAAACTAAAAGAAGAGAATTTCTTTGG
TCCCAAGGAGGAAGTAAAGCTGGAGACCCACATCCGGGTCCCAGCTTCAGCAGCTGGCCGGGTC
ATTGGCAAAGGTGGCAAAACGGTGAATGAGCTGCAGAACTTGACCGCAGCCGAGGTGGTCGTGC
CGAGAGACCAGACCCCAGACGAGAACGACCAAGTCATTGTTAAGATCATCGGACATTTCTATGC
CAGCCAGATGGCCCAGCGGAAGATCCGAGACATCCTGGCTCAAGTTAAGCAGCAGCACCAGAAG
GGACAGAGCAACCAGGCCCAGGCACGAAGGAAGTGACCCCGCCCTTTCCTGTCCCATTGGCTCC
AGATCAGCAGGCCGAACACAGGACTGGAGGACGGGTGGAGGGCCGGCGTGCTCCTCCTAGCAGG
CCTGAGAATGAGTGGGAATCAGGGCGTTTGGGTCTGGCTGGAGATCAGGTTTGCACA

hide sequence

Protein Sequences


Protein RefSeqs	NP_783184	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI61831	(Get FASTA)	NCBI Sequence Viewer
	AAO16210	(Get FASTA)	NCBI Sequence Viewer
	EDM05776	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000008139.3
	ENSRNOP00000095130.1
GenBank Protein	Q8CGX0	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_783184 ⟸ NM_175594

- UniProtKB:

Q8CGX0 (UniProtKB/Swiss-Prot), B1WBP3 (UniProtKB/Swiss-Prot), A0A8I6AN86 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MNKLYIGNLNESVTPADLEKVFAEHKISYSGQFLVKSGYAFVDCPDEHWAMKAIETFSGKVELQ
GKRLEIEHSVPKKQRSRKIQIRNIPPQLRWEVLDSLLAQYGTVENCEQVNTESETAVVNVTYSN
REQTRQAIMKLNGHQLENHALKVSYIPDEQIAQGPENGRRGGFGSRGQPRQGSPVAAGAPAKQQ
QVDIPLRLLVPTQYVGAIIGKEGATIRNITKQTQSKIDVHRKENAGAAEKAISVHSTPEGCSSA
CKMILEIMHKEAKDTKTADEVPLKILAHNNFVGRLIGKEGRNLKKVEQDTETKITISSLQDLTL
YNPERTITVKGAIENCCRAEQEIMKKVREAYENDVAAMSLQSHLIPGLNLAAVGLFPASSSAVP
PPPSSVTGAAPYGSFMQAPEQEMVQVFIPAQAVGAIIGKKGQHIKQLSRFASASIKIAPPETPD
SKVRMVVITGPPEAQFKAQGRIYGKLKEENFFGPKEEVKLETHIRVPASAAGRVIGKGGKTVNE
LQNLTAAEVVVPRDQTPDENDQVIVKIIGHFYASQMAQRKIRDILAQVKQQHQKGQSNQAQARR
K

hide sequence

Ensembl Acc Id:

ENSRNOP00000008139 ⟸ ENSRNOT00000008139

Ensembl Acc Id:

ENSRNOP00000095130 ⟸ ENSRNOT00000119485

Protein Domains

KH RRM

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q8CGX0-F1-model_v2	AlphaFold	Q8CGX0	1-577	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:708580	AgrOrtholog
BioCyc Gene	G2FUF-23524	BioCyc
Ensembl Genes	ENSRNOG00000006122	Ensembl, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000008139.6	UniProtKB/Swiss-Prot
	ENSRNOT00000119485.1	UniProtKB/TrEMBL
Gene3D-CATH	3.30.1370.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	3.30.310.210	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	3.30.70.330	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:9023972	IMAGE-MGC_LOAD
InterPro	IGF2BP1_RRM1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	IGF2BP1_RRM2	UniProtKB/Swiss-Prot
	KH_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	KH_dom_type_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	KH_dom_type_1_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Nucleotide-bd_a/b_plait_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	RBD_domain_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	RRM_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:303477	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:187312	IMAGE-MGC_LOAD
NCBI Gene	303477	ENTREZGENE
PANTHER	KH DOMAIN CONTAINING RNA BINDING PROTEIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	KH_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	RRM_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Igf2bp1	PhenoGen
PROSITE	KH_TYPE_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	RRM	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000006122	RatGTEx
	ENSRNOG00055032679	RatGTEx
	ENSRNOG00060025575	RatGTEx
	ENSRNOG00065017872	RatGTEx
SMART	RRM	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SM00322	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF54791	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SSF54928	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A8I6AN86	ENTREZGENE, UniProtKB/TrEMBL
	B1WBP3	ENTREZGENE
	IF2B1_RAT	UniProtKB/Swiss-Prot, ENTREZGENE
UniProt Secondary	B1WBP3	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-03-04	Igf2bp1	insulin-like growth factor 2 mRNA binding protein 1	Igf2bp1	insulin-like growth factor 2, binding protein 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-30	Igf2bp1	insulin-like growth factor 2, binding protein 1	Imp1		Symbol updated	1299863	APPROVED
2004-02-11	Ppil3	insulin-like growth factor 2, binding protein 1	Imp1	IGF-II mRNA-binding protein 1	Name updated to reflect Human and Mouse nomenclature	625702	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD