Advanced Search (OLGA)

Gene: Phax (phosphorylated adaptor for RNA export) Rattus norvegicus

Analyze

Symbol:

Phax

Name:

phosphorylated adaptor for RNA export

RGD ID:

708448

Description:

Enables toxic substance binding activity. Predicted to be involved in RNA stabilization and snRNA export from nucleus. Located in neuronal cell body. Orthologous to human PHAX (phosphorylated adaptor for RNA export); PARTICIPATES IN RNA transport pathway; INTERACTS WITH 2,4-dinitrotoluene; 2,6-dinitrotoluene; ammonium chloride.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

26 kDa resiniferatoxin-binding protein; cytosolic resiniferatoxin-binding protein; LOC286917; phosphorylated adapter RNA export protein; RBP-2; RBP-26; resiniferatoxin-binding protein 2; RNA U small nuclear RNA export adapter protein; RNA U, small nuclear RNA export adaptor; Rnuxa; RTX-42

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	PHAX (phosphorylated adaptor for RNA export)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Phax (phosphorylated adaptor for RNA export)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Phax (phosphorylated adaptor for RNA export)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	PHAX (phosphorylated adaptor for RNA export)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	LOC611908 (phosphorylated adapter RNA export protein-like)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Phax (phosphorylated adaptor for RNA export)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	PHAX (phosphorylated adaptor for RNA export)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	PHAX (phosphorylated adaptor for RNA export)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Phax (phosphorylated adaptor for RNA export)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	PHAX (phosphorylated adaptor for RNA export)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Phax (phosphorylated adaptor for RNA export)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	phax (phosphorylated adaptor for RNA export)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	Y71H2B.2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Phax	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	phax	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	18	52,251,231 - 52,267,916 (+)	NCBI		GRCr8
mRatBN7.2	18	50,053,133 - 50,069,823 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	18	50,053,023 - 50,069,823 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	18	52,091,311 - 52,108,152 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	18	52,799,358 - 52,816,201 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	18	50,597,179 - 50,614,024 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	18	51,662,294 - 51,678,981 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	18	51,662,294 - 51,678,980 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	18	50,857,303 - 50,873,990 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	18	52,344,828 - 52,361,518 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	18	52,390,322 - 52,406,983 (+)	NCBI
Celera	18	48,198,291 - 48,214,972 (+)	NCBI		Celera
Cytogenetic Map	18	q12.1	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

adult onset demyelinating leukodystrophy (ISO)

familial adenomatous polyposis 1 (ISO)

Hereditary Neoplastic Syndromes (ISO)

Hirschsprung's disease (ISO)

Neurodevelopmental Disorders (ISO)

pyridoxine-dependent epilepsy (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2,4-dinitrotoluene (EXP)

2,6-dinitrotoluene (EXP)

actinomycin D (ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

ammonium chloride (EXP)

Aroclor 1254 (ISO)

arsenite(3-) (ISO)

atrazine (ISO)

benzo[a]pyrene (ISO)

beta-lapachone (ISO)

bisphenol A (EXP,ISO)

cadmium dichloride (ISO)

chlorpyrifos (EXP)

copper(II) sulfate (ISO)

coumarin (ISO)

crocidolite asbestos (ISO)

cylindrospermopsin (ISO)

deoxynivalenol (ISO)

Dibutyl phosphate (ISO)

dicrotophos (ISO)

disodium selenite (ISO)

enzyme inhibitor (ISO)

fenthion (ISO)

flutamide (EXP)

FR900359 (ISO)

gentamycin (EXP)

hydrogen peroxide (ISO)

ivermectin (ISO)

lead(0) (ISO)

methidathion (ISO)

nitrates (ISO)

Nutlin-3 (ISO)

paracetamol (EXP)

perfluorooctane-1-sulfonic acid (ISO)

phenobarbital (ISO)

quercetin (ISO)

rotenone (EXP)

SB 431542 (ISO)

thimerosal (ISO)

titanium dioxide (ISO)

triphenyl phosphate (ISO)

valproic acid (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

protein transport (IEA)

RNA stabilization (ISO)

snRNA export from nucleus (IBA,IEA,ISO)

Cellular Component

Cajal body (IEA)

cytoplasm (IEA,ISO)

neuronal cell body (IDA)

nucleoplasm (ISO)

nucleus (IBA,IEA,ISO)

ribonucleoprotein complex (ISO)

Molecular Function

mRNA cap binding complex binding (ISO)

protein binding (ISO)

RNA binding (IEA)

toxic substance binding (IPI)

Molecular Pathway Annotations Click to see Annotation Detail View

RNA transport pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Molecular cloning of a resiniferatoxin-binding protein.	Ninkina NN, etal., Brain Res Mol Brain Res 1994 Mar;22(1-4):39-48.
3.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
4.	GOA pipeline	RGD automated data pipeline
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:8889548	PMID:10786834	PMID:12477932	PMID:15489334	PMID:15574332	PMID:25931508

Genomics

Comparative Map Data

Phax
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	18	52,251,231 - 52,267,916 (+)	NCBI		GRCr8
mRatBN7.2	18	50,053,133 - 50,069,823 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	18	50,053,023 - 50,069,823 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	18	52,091,311 - 52,108,152 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	18	52,799,358 - 52,816,201 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	18	50,597,179 - 50,614,024 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	18	51,662,294 - 51,678,981 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	18	51,662,294 - 51,678,980 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	18	50,857,303 - 50,873,990 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	18	52,344,828 - 52,361,518 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	18	52,390,322 - 52,406,983 (+)	NCBI
Celera	18	48,198,291 - 48,214,972 (+)	NCBI		Celera
Cytogenetic Map	18	q12.1	NCBI

PHAX
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	5	126,600,947 - 126,627,252 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	5	126,600,925 - 126,627,252 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	5	125,936,639 - 125,962,944 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	5	125,964,532 - 125,988,979 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	5	121,893,253 - 121,919,561 (+)	NCBI		Celera
Cytogenetic Map	5	q23.2	NCBI
HuRef	5	121,127,851 - 121,154,385 (+)	NCBI		HuRef
CHM1_1	5	125,369,204 - 125,395,562 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	5	127,117,809 - 127,144,117 (+)	NCBI		T2T-CHM13v2.0

Phax
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	18	56,695,641 - 56,720,784 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	18	56,695,515 - 56,720,784 (+)	Ensembl		GRCm39 Ensembl
GRCm38	18	56,562,569 - 56,587,712 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	18	56,562,443 - 56,587,712 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	18	56,722,223 - 56,747,366 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	18	56,698,383 - 56,712,872 (+)	NCBI		MGSCv36	mm8
Celera	18	57,865,507 - 57,892,723 (+)	NCBI		Celera
Cytogenetic Map	18	D3	NCBI
cM Map	18	30.63	NCBI

Phax
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955521	4,425,426 - 4,443,082 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955521	4,425,382 - 4,442,668 (+)	NCBI	ChiLan1.0	ChiLan1.0

PHAX
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	4	121,915,810 - 121,942,809 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	5	120,055,373 - 120,082,372 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	5	122,005,976 - 122,032,326 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	5	127,776,529 - 127,803,619 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	5	127,776,529 - 127,803,619 (+)	Ensembl	panpan1.1		panPan2

LOC611908
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	4	49,155,408 - 49,157,318 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	4	49,046,782 - 49,048,688 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	4	49,587,183 - 49,589,088 (-)	NCBI		ROS_Cfam_1.0
UMICH_Zoey_3.1	4	49,394,584 - 49,396,488 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	4	49,527,597 - 49,529,503 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	4	50,050,867 - 50,052,773 (-)	NCBI		UU_Cfam_GSD_1.0

Phax
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024407213	138,427,612 - 138,440,624 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936504	1,639 - 14,031 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936504	1,585 - 14,592 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

PHAX
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	2	129,713,643 - 129,724,535 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	2	129,713,643 - 129,724,524 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	2	135,012,350 - 135,022,884 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

PHAX
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	23	29,594,021 - 29,618,189 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	23	29,594,165 - 29,619,830 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666034	48,456,138 - 48,481,962 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Phax
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624774	15,006,852 - 15,029,177 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624774	15,006,115 - 15,029,252 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Phax
132 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	43
Count of miRNA genes:	36
Interacting mature miRNAs:	41
Transcripts:	ENSRNOT00000019627
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1331733	Bp233	Blood pressure QTL 233	3.97196		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	25071126	83910656	Rat
1358358	Sradr6	Stress Responsive Adrenal Weight QTL 6	2.49		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	18	22015562	61600538	Rat
1331741	Bp232	Blood pressure QTL 232	3.59112		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	18	23494057	85487725	Rat
1331742	Bp228	Blood pressure QTL 228	3.88752		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	31610505	77371277	Rat
1331736	Bp227	Blood pressure QTL 227	2.791		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	18	48917054	60064728	Rat
631834	Sach3	Saccharin preference QTL 3	3.9	0.01	consumption behavior trait (VT:0002069)	calculated saccharin drink intake volume (CMO:0001600)	18	38575919	83575919	Rat
12904668	Bw188	Body weight QTL 188		0.03	body mass (VT:0001259)	body weight (CMO:0000012)	18	26822186	71822186	Rat
12904669	Cm125	Cardiac mass QTL 125		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	18	26822186	71822186	Rat
12904670	Cm126	Cardiac mass QTL 126		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	18	26822186	71822186	Rat
6893683	Bw110	Body weight QTL 110	2.7	0.002	body mass (VT:0001259)	body weight (CMO:0000012)	18	45620306	86134022	Rat
1331727	Bp237	Blood pressure QTL 237	3.053		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	31610505	63968306	Rat
12904677	Kidm72	Kidney mass QTL 72		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	18	26822186	71822186	Rat
9589041	Epfw12	Epididymal fat weight QTL 12	17.08	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	18	48915737	86134022	Rat
8694432	Bw165	Body weight QTL 165	3.81	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	18	48915737	86134022	Rat
12904673	Cm127	Cardiac mass QTL 127		0.005	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	18	26822186	71822186	Rat
12904675	Am19	Aortic mass QTL 19		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	18	26822186	71822186	Rat
1331774	Bp226	Blood pressure QTL 226	4.41065		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	31610505	77371277	Rat
9589816	Gluco68	Glucose level QTL 68	7.25	0.001	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	18	31990891	76990891	Rat
1331770	Bp234	Blood pressure QTL 234	3.807		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	45620306	86134022	Rat
61360	Eaey	Experimental allergic encephalomyelitis QTL y	3		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis duration (CMO:0001424)	18	49187226	62647720	Rat
1578667	Bss21	Bone structure and strength QTL 21	3.5		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	18	12066482	85493247	Rat
2303120	Mamtr8	Mammary tumor resistance QTL 8		0.001	mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	18	31610505	85493247	Rat
12880368	Bw187	Body weight QTL 187		0.045	body mass (VT:0001259)	body weight (CMO:0000012)	18	33379158	78379158	Rat
61367	Iddm4	Insulin dependent diabetes mellitus QTL 4	2.33	0.0074	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	18	40462383	85462383	Rat
9590318	Scort22	Serum corticosterone level QTL 22	7.64	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	18	31990891	76990891	Rat
1331753	Bp231	Blood pressure QTL 231	3.643		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	18	1	54490981	Rat
1578661	Bss20	Bone structure and strength QTL 20	3.7		femur morphology trait (VT:0000559)	femoral neck cross-sectional area (CMO:0001697)	18	12066482	85493247	Rat
1331754	Bp230	Blood pressure QTL 230	4.61609		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	15642280	86134022	Rat
12904069	Cm123	Cardiac mass QTL 123		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	18	33379158	78379158	Rat
1331798	Bp224	Blood pressure QTL 224	3.53873		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	31610505	77371277	Rat
12904070	Cm124	Cardiac mass QTL 124		0.01	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	18	33379158	78379158	Rat
12904071	Am18	Aortic mass QTL 18		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	18	33379158	78379158	Rat
2303584	Gluco55	Glucose level QTL 55	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	18	50795212	86134022	Rat
2301413	Bp318	Blood pressure QTL 318		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	26822186	71822186	Rat
61383	Bp47	Blood pressure QTL 47	17.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	18	31522783	76522783	Rat
12904067	Cm122	Cardiac mass QTL 122		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	18	33379158	78379158	Rat
2301417	Bp319	Blood pressure QTL 319		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	33379158	78379158	Rat
1331806	Bp229	Blood pressure QTL 229	4.36484		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	48917054	60064728	Rat
12904073	Kidm71	Kidney mass QTL 71		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	18	33379158	78379158	Rat
1331780	Bp238	Blood pressure QTL 238	3.269		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	48917054	60064728	Rat
1331776	Bp225	Blood pressure QTL 225	2.829		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	18	31610505	77371277	Rat
631518	Bw11	Body weight QTL 11	2.8		body mass (VT:0001259)	body weight (CMO:0000012)	18	36121626	81121626	Rat
1641923	Colcr8	Colorectal carcinoma resistance QTL 8	3.1	0.0014	intestine integrity trait (VT:0010554)	poorly differentiated malignant colorectal tumor number (CMO:0002076)	18	31990891	76990891	Rat
8694366	Abfw8	Abdominal fat weight QTL 8	6.38	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	18	48915737	86134022	Rat
631509	Sald2	Serum aldosterone level QTL 2	2.9		blood aldosterone amount (VT:0005346)	serum aldosterone level (CMO:0000487)	18	26415821	71415821	Rat
631274	Sprol1	Serum protein level QTL 1	5.3		blood total protein amount (VT:0005567)	serum total protein level (CMO:0000661)	18	31644508	79484311	Rat
1600373	Mamtr6	Mammary tumor resistance QTL 6			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	18	19553532	85493247	Rat
2293708	Bss46	Bone structure and strength QTL 46	8.8	0.0001	lumbar vertebra morphology trait (VT:0010494)	lumbar vertebra cortical cross-sectional area (CMO:0001690)	18	12066482	57066482	Rat
8694378	Bw157	Body weight QTL 157	3.59	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	18	31990891	76990891	Rat
2303571	Bw92	Body weight QTL 92	3		body mass (VT:0001259)	body weight (CMO:0000012)	18	50795212	86134022	Rat
61429	Cia17	Collagen induced arthritis QTL 17	4.6		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	18	31610505	72538878	Rat
7411719	Strs5	Sensitivity to stroke QTL 5	9.4		cerebrum integrity trait (VT:0010549)	percentage of study population developing cerebrovascular lesions during a period of time (CMO:0000932)	18	52198059	68120379	Rat

Markers in Region

D18Got50

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	18	52,266,869 - 52,267,023 (+)	Marker Load Pipeline
mRatBN7.2	18	50,068,772 - 50,068,930 (+)	MAPPER	mRatBN7.2
Rnor_6.0	18	51,677,933 - 51,678,088	NCBI	Rnor6.0
Rnor_5.0	18	50,872,942 - 50,873,097	UniSTS	Rnor5.0
RGSC_v3.4	18	52,360,470 - 52,360,625	UniSTS	RGSC3.4
RGSC_v3.4	18	52,360,469 - 52,360,623	RGD	RGSC3.4
RGSC_v3.1	18	52,405,964 - 52,406,118	RGD
Celera	18	48,213,932 - 48,214,079	UniSTS
Cytogenetic Map	18	q12.1	UniSTS

RH130750

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	18	50,069,527 - 50,069,708 (+)	MAPPER	mRatBN7.2
Rnor_6.0	18	51,678,686 - 51,678,866	NCBI	Rnor6.0
Rnor_5.0	18	50,873,695 - 50,873,875	UniSTS	Rnor5.0
RGSC_v3.4	18	52,361,223 - 52,361,403	UniSTS	RGSC3.4
Celera	18	48,214,677 - 48,214,857	UniSTS
Cytogenetic Map	18	q12.1	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_173133	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC098078	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AI044239	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC086410	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC097932	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CB706455	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473971	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ226770	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000018	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X67877	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000019627 ⟹ ENSRNOP00000019627

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	18	50,053,023 - 50,069,823 (+)	Ensembl
Rnor_6.0 Ensembl	18	51,662,294 - 51,678,980 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000111687 ⟹ ENSRNOP00000081594

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	18	50,054,900 - 50,069,823 (+)	Ensembl

RefSeq Acc Id:

NM_173133 ⟹ NP_775156

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	18	52,251,231 - 52,267,916 (+)	NCBI
mRatBN7.2	18	50,053,133 - 50,069,823 (+)	NCBI
Rnor_6.0	18	51,662,294 - 51,678,981 (+)	NCBI
Rnor_5.0	18	50,857,303 - 50,873,990 (+)	NCBI
RGSC_v3.4	18	52,344,828 - 52,361,518 (+)	RGD
Celera	18	48,198,291 - 48,214,972 (+)	RGD

Sequence:

show sequence

CTCTCCTGACCCTGCGCGCCGCGGGAAGATGGCGCTTGAAGCTGGCGATATGGAAGAGGGACAG
CTTTCCGACTCGGATTCCGACATGACGGTCGTCCCCAGCGATAGGCCTCTGCAAATGGCGAAAG
TACTAGGTGGGGGCGGTGCTGCATGCGCACCAGTGTCAAACTATCGGACTGTTAAACATGTGGA
CTCCAGTGAGGAGAGTCTGGATTCCGATGACGATTGCTCTCTTTGGAAACGTAAGCGGCAGAAA
TGTCACAGTCCTCCTCCCAAGCCAGAGCCTTTCCCATTTGGACAGAGCGGTCAGAAACCAGCTC
TCAACGGTGGGAAGAAGGTGAACAACATCTGGGGTGCTGTGCTACAGGAACAGAACCAAGATGC
TGTGGCCACTGAGCTCGGCATCTTGGGAATGGAAGGCACCATCGACAGAAGCAGGCAGTCTGAG
ACCTATAATTATTTGCTTGCTAAGAAACTTGCTAAGAAGGAATCTCAAGAGTATACAAAAGAAT
TAGACAAAGATCTGGATGAGTATATGCATGGCGACAAAAAACCTGGGTCAAAGGAAGAGGAGAA
TGGGCAAGGTCATCTCAAACGGAAACGGCCTGTCCGAGACAGACTGGGTAACAGAGTAGAAATG
AACTACAAAGGCCGCTACGACATCACAGAGGAGGATTCTCCCGAGAAAGTGGCTGATGAGATTG
CCTTCAGGTTACAGGAACCGAAGAAGGACCTGATAGCCCGAGTAGTGACGATACTTGGGAACAA
AAAGGCCATTGAACTTCTGATGGAGACGGCTGAGGTTGAGCAAAATGGTGGCCTTTTCATAATG
AATGGAAGCCGAAGGAGAACGCCGGGTGGGGTTTTCCTCAATCTCCTGAAGAACACGCCCAGCA
TCAGCGAAGAGCAGATCAAGGATATTTTCTACATTGAAAATCAAAAAGAATATGAAAATAAAAA
AGCTGCTAGAAAAAGAAGAACACAACTATTGGGGAAGAAAATGAAAGAAGCTATTAAAAGTCTA
AATTTCCAGGAAGATGATGACACATCTCGAGAAACGTTTGCAAGTGACACTAATGAGGCCCTGG
CCTCTCTTGACGAAGCCCAGGAAGGACCCGGTGAAACCAAGCTGGATGCTGAGGACGCCATCGA
GGTGGACCACCCTCAGGATTTGGACATCTTTTAAGCACACTTTGGACATTTTGAAGAATAAACC
TTTGTTTTTTAAAAAAGGTGTTACCATTTCTACTGAGGTTGCTTTACTGTGCACCGACACTGAG
GCGGGAGAGCTGTGTCTGCTCCCGTGAAGTAGTAATGTATGTGGTAGTCGTGCCGTCGGCCGCA
GTGTGGAAGGTGGCTGCATCTGACGGCTGCTGTACAGCACGGGCTAATTTCTCACTCTGCATGT
GCTGACTGTTAGCCTACGTGGAGCTGTGTCCTCTCTGTCCAGCTCACTGTTTCATGCCAGTAAG
ACATTTTGGTTTTCTCATTCATCTTTGTGGTGAACTATGCTTTGGTTTTAACACATTCCATTAA
AATACCTGTAACATGTAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_775156	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH86410	(Get FASTA)	NCBI Sequence Viewer
	AAH97932	(Get FASTA)	NCBI Sequence Viewer
	CAA48076	(Get FASTA)	NCBI Sequence Viewer
	EDM14494	(Get FASTA)	NCBI Sequence Viewer
	EDM14495	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000019627.3
	ENSRNOP00000081594.1
GenBank Protein	Q63068	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_775156 ⟸ NM_173133

- UniProtKB:

Q4QQW9 (UniProtKB/Swiss-Prot), Q5RJZ7 (UniProtKB/Swiss-Prot), Q63068 (UniProtKB/Swiss-Prot), A6IX64 (UniProtKB/TrEMBL), A6IX63 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MALEAGDMEEGQLSDSDSDMTVVPSDRPLQMAKVLGGGGAACAPVSNYRTVKHVDSSEESLDSD
DDCSLWKRKRQKCHSPPPKPEPFPFGQSGQKPALNGGKKVNNIWGAVLQEQNQDAVATELGILG
MEGTIDRSRQSETYNYLLAKKLAKKESQEYTKELDKDLDEYMHGDKKPGSKEEENGQGHLKRKR
PVRDRLGNRVEMNYKGRYDITEEDSPEKVADEIAFRLQEPKKDLIARVVTILGNKKAIELLMET
AEVEQNGGLFIMNGSRRRTPGGVFLNLLKNTPSISEEQIKDIFYIENQKEYENKKAARKRRTQL
LGKKMKEAIKSLNFQEDDDTSRETFASDTNEALASLDEAQEGPGETKLDAEDAIEVDHPQDLDI
F

hide sequence

Ensembl Acc Id:

ENSRNOP00000019627 ⟸ ENSRNOT00000019627

Ensembl Acc Id:

ENSRNOP00000081594 ⟸ ENSRNOT00000111687

Protein Domains

Phosphorylated adapter RNA export protein RNA-

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q63068-F1-model_v2	AlphaFold	Q63068	1-385	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13700790

Promoter ID:

EPDNEW_R11314

Type:

multiple initiation site

Name:

Phax_1

Description:

phosphorylated adaptor for RNA export

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	18	51,662,301 - 51,662,361	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:708448	AgrOrtholog
BioCyc Gene	G2FUF-7444	BioCyc
Ensembl Genes	ENSRNOG00000014459	Ensembl, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000019627.5	UniProtKB/Swiss-Prot
	ENSRNOT00000111687.1	UniProtKB/TrEMBL
Gene3D-CATH	1.10.10.1440	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7305411	IMAGE-MGC_LOAD
	IMAGE:7386998	IMAGE-MGC_LOAD
InterPro	PHAX	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PHAX_RNA-binding_domain	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PHAX_RNA-binding_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:286917	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGC_CLONE	MGC:105296	IMAGE-MGC_LOAD
	MGC:116045	IMAGE-MGC_LOAD
NCBI Gene	286917	ENTREZGENE
PANTHER	PHOSPHORYLATED ADAPTER RNA EXPORT PROTEIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR13135	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	RNA_GG_bind	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Phax	PhenoGen
RatGTEx	ENSRNOG00000014459	RatGTEx
UniProt	A0A8I5ZSJ4_RAT	UniProtKB/TrEMBL
	A6IX63	ENTREZGENE, UniProtKB/TrEMBL
	A6IX64	ENTREZGENE, UniProtKB/TrEMBL
	PHAX_RAT	UniProtKB/Swiss-Prot
	Q4QQW9	ENTREZGENE
	Q5RJZ7	ENTREZGENE
	Q63068	ENTREZGENE
UniProt Secondary	Q4QQW9	UniProtKB/Swiss-Prot
	Q5RJZ7	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-11-06	Phax	phosphorylated adaptor for RNA export	Rnuxa	RNA U, small nuclear RNA export adaptor	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-03-06	Rnuxa	RNA U, small nuclear RNA export adaptor	Phax	phosphorylated adaptor for RNA export	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-07-08	Phax	phosphorylated adaptor for RNA export	LOC286917	cytosolic resiniferatoxin-binding protein	Symbol and Name updated	1299863	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Annotations - KEGG (archival)