Advanced Search (OLGA)

Gene: Ppp2r2d (protein phosphatase 2, regulatory subunit B, delta) Rattus norvegicus

Analyze

Symbol:

Ppp2r2d

Name:

protein phosphatase 2, regulatory subunit B, delta

RGD ID:

708356

Description:

Predicted to enable enzyme-substrate adaptor activity and protein phosphatase regulator activity. Predicted to be involved in exit from mitosis and regulation of chromosome segregation. Predicted to be located in nucleoplasm. Predicted to be part of protein phosphatase type 2A complex. Predicted to be active in cytosol. Orthologous to human PPP2R2D (protein phosphatase 2 regulatory subunit Bdelta); PARTICIPATES IN Chagas disease pathway; hepatitis C pathway; mRNA decay pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,6-dinitrotoluene; ammonium chloride.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

LOC246255; MGC93154; PP2A subunit B isoform B55-delta; PP2A subunit B isoform delta; PP2A subunit B isoform PR55-delta; PP2A subunit B isoform R2-delta; PP2A, subunit B, B-delta isoform; PP2A, subunit B, B55-delta isoform; PP2A, subunit B, PR55-delta isoform; PP2A, subunit B, R2-delta isoform; protein phosphatase 2, regulatory subunit B, delta isoform; protein phosphatase 2A B regulatory subunit delta isoform; serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B delta isoform

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	203,095,536 - 203,129,895 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	1	203,095,531 - 203,129,893 (+)	Ensembl				GRCr8
mRatBN7.2	1	193,665,918 - 193,700,277 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	193,665,855 - 193,700,274 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	1	202,036,415 - 202,070,486 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	209,171,502 - 209,205,573 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	201,844,985 - 201,879,055 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	211,205,903 - 211,240,216 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	211,205,903 - 211,239,888 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	1	218,132,463 - 218,166,450 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	1	198,640,771 - 198,674,758 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	1	191,357,924 - 191,391,726 (+)	NCBI		Celera
RGSC_v3.1	1	198,790,763 - 198,825,066 (+)	NCBI
Cytogenetic Map	1	q41	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,6-dinitrotoluene (EXP)

3,4-methylenedioxymethamphetamine (ISO)

4,4'-sulfonyldiphenol (ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

ammonium chloride (EXP)

antirheumatic drug (ISO)

arsane (ISO)

arsenic atom (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

CGP 52608 (ISO)

ciguatoxin CTX1B (ISO)

clofibrate (ISO)

copper atom (ISO)

copper(0) (ISO)

crocidolite asbestos (ISO)

decabromodiphenyl ether (EXP)

dichloroacetic acid (ISO)

disodium selenite (ISO)

dorsomorphin (ISO)

entinostat (ISO)

ethanol (ISO)

fenthion (ISO)

finasteride (EXP)

flavonoids (EXP)

folic acid (ISO)

gentamycin (EXP)

hexadecanoic acid (ISO)

methidathion (ISO)

methyl methanesulfonate (ISO)

mono(2-ethylhexyl) phthalate (ISO)

N,N,N',N'-tetrakis(2-pyridylmethyl)ethylenediamine (ISO)

N,N-diethyl-m-toluamide (EXP)

nefazodone (EXP)

ozone (ISO)

paracetamol (ISO)

permethrin (EXP)

pirinixic acid (ISO)

quercetin (ISO)

resveratrol (ISO)

SB 431542 (ISO)

sodium arsenite (ISO)

tetrachloroethene (ISO)

thapsigargin (EXP)

thioacetamide (EXP)

thiram (ISO)

titanium dioxide (ISO)

trichloroethene (ISO)

triphenyl phosphate (ISO)

triptonide (ISO)

valproic acid (ISO)

vorinostat (ISO)

zinc sulfate (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cell division (IEA)

exit from mitosis (ISS)

mitotic cell cycle (ISS)

regulation of chromosome segregation (IEA,ISO,ISS)

Cellular Component

cytoplasm (IEA)

cytosol (IBA,TAS)

nucleoplasm (TAS)

protein phosphatase type 2A complex (IBA,IEA,ISO,ISS)

Molecular Function

enzyme-substrate adaptor activity (IEA,ISO,ISS)

protein binding (ISO)

protein phosphatase regulator activity (IBA,IEA,ISO,ISS)

Molecular Pathway Annotations Click to see Annotation Detail View

Chagas disease pathway (IEA)

hepatitis C pathway (IEA)

mRNA decay pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
3.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
4.	GOA pipeline	RGD automated data pipeline
5.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
6.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
7.	Cloning and characterization of B delta, a novel regulatory subunit of protein phosphatase 2A.	Strack S, etal., FEBS Lett 1999 Nov 5;460(3):462-6.
8.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Additional References at PubMed

PMID:12684532	PMID:15489334	PMID:19029245

Genomics

Comparative Map Data

Ppp2r2d
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	203,095,536 - 203,129,895 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	1	203,095,531 - 203,129,893 (+)	Ensembl				GRCr8
mRatBN7.2	1	193,665,918 - 193,700,277 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	193,665,855 - 193,700,274 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	1	202,036,415 - 202,070,486 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	209,171,502 - 209,205,573 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	201,844,985 - 201,879,055 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	211,205,903 - 211,240,216 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	211,205,903 - 211,239,888 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	1	218,132,463 - 218,166,450 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	1	198,640,771 - 198,674,758 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	1	191,357,924 - 191,391,726 (+)	NCBI		Celera
RGSC_v3.1	1	198,790,763 - 198,825,066 (+)	NCBI
Cytogenetic Map	1	q41	NCBI

PPP2R2D
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	10	131,901,008 - 131,971,533 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	10	131,900,977 - 131,959,834 (+)	Ensembl			hg38	GRCh38
GRCh37	10	133,747,955 - 133,773,338 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	10	133,597,950 - 133,620,044 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Celera	10	127,392,198 - 127,414,138 (+)	NCBI		Celera
Cytogenetic Map	10	q26.3	NCBI
HuRef	10	127,299,151 - 127,320,948 (+)	NCBI		HuRef
CHM1_1	10	134,029,386 - 134,051,138 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	10	132,840,100 - 132,911,782 (+)	NCBI		T2T-CHM13v2.0

Ppp2r2d
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	7	138,448,073 - 138,484,786 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	7	138,447,808 - 138,484,786 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	7	138,846,350 - 138,883,057 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	7	138,846,079 - 138,883,057 (+)	Ensembl			mm10	GRCm38
MGSCv37	7	146,038,069 - 146,074,740 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	7	138,684,729 - 138,721,400 (+)	NCBI		MGSCv36	mm8
Celera	7	138,663,564 - 138,700,226 (+)	NCBI		Celera
Cytogenetic Map	7	F4	NCBI
cM Map	7	82.95	NCBI

Ppp2r2d
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955477	9,571,974 - 9,613,498 (+)	Ensembl
ChiLan1.0	NW_004955477	9,571,974 - 9,611,076 (+)	NCBI	ChiLan1.0	ChiLan1.0

PPP2R2D
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	8	143,853,967 - 143,916,635 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	10	143,859,327 - 143,921,992 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	10	128,602,457 - 128,663,706 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	10	132,794,414 - 132,846,602 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2

PPP2R2D
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	28	40,008,764 - 40,030,811 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	28	39,987,019 - 40,030,382 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	28	40,045,944 - 40,093,979 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	28	40,626,539 - 40,674,546 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	28	40,624,994 - 40,671,146 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	28	40,111,215 - 40,159,202 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	28	40,098,988 - 40,147,189 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	28	40,498,145 - 40,546,204 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Ppp2r2d
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024407213	7,116,672 - 7,140,534 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936486	18,420,764 - 18,443,485 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936486	18,424,336 - 18,443,485 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

PPP2R2D
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	9	124,510,800 - 124,560,872 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666048	85,946,198 - 85,999,269 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Ppp2r2d
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624737	14,873,129 - 14,920,804 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624737	14,873,129 - 14,920,886 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Ppp2r2d
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	2	62,938,272 - 62,973,101 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Ppp2r2d
334 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	244
Count of miRNA genes:	160
Interacting mature miRNAs:	177
Transcripts:	ENSRNOT00000023139, ENSRNOT00000058482
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1578778	Pur4	Proteinuria QTL 4	3.3	0.003	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	1	160111531	262090437	Rat
1354646	Kidm18	Kidney mass QTL 18	5.7		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	160573753	266453731	Rat
1354652	Kidm20	Kidney mass QTL 20	4.3		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	186658830	266453731	Rat
1354653	Despr9	Despair related QTL 9		0.00019	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	1	177339686	222339686	Rat
2293673	Bss27	Bone structure and strength QTL 27	18.63	0.0001	femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	1	181059071	226059071	Rat
2293677	Bss41	Bone structure and strength QTL 41	9.38	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra cross-sectional area (CMO:0001689)	1	181059071	226059071	Rat
70160	Bw18	Body weight QTL 18	5.7		body mass (VT:0001259)	body weight (CMO:0000012)	1	153679879	205813246	Rat
1549830	Bss1	Bone structure and strength QTL 1	4.8		femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	1	182039247	227039247	Rat
70163	Bw20	Body weight QTL 20	5.1		body mass (VT:0001259)	body weight (CMO:0000012)	1	183564652	228564652	Rat
1354624	Cm35	Cardiac mass QTL35	5.7		heart left ventricle mass (VT:0007031)	calculated heart weight (CMO:0000073)	1	186658830	266453731	Rat
1600397	Edcs4	Endometrial carcinoma susceptibility QTL 4	2.2		uterus morphology trait (VT:0001120)	percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759)	1	176288899	270518180	Rat
631838	Niddm36	Non-insulin dependent diabetes mellitus QTL 36		0.01	insulin secretion trait (VT:0003564)	calculated pancreatic islet insulin release measurement (CMO:0001217)	1	193964073	238964073	Rat
1354636	Lmblg1	Limb length QTL 1	6.4		tibia length (VT:0004357)	tibia length (CMO:0000450)	1	160573753	210707719	Rat
1549837	Hcar15	Hepatocarcinoma resistance QTL 15		0.05	liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	162548015	270518180	Rat
2293689	Bss47	Bone structure and strength QTL 47	7.25	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra trabecular cross-sectional area (CMO:0001692)	1	181059071	226059071	Rat
152025235	Bw194	Body weight QTL 194	4.86		body mass (VT:0001259)		1	132966869	252856240	Rat
61341	Bp26	Blood pressure QTL 26			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	139442053	223964440	Rat
1598853	Memor3	Memory QTL 3	4.5		exploratory behavior trait (VT:0010471)	total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443)	1	152919152	268496042	Rat
1354634	Kidm12	Kidney mass QTL 12	3.9		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	1	160573753	210707719	Rat
4889428	Stresp24	Stress response QTL 24		0.05	heart pumping trait (VT:2000009)	absolute change in electrocardiographic low frequency R-R spectral component to high frequency R-R spectral component ratio (CMO:0002162)	1	165278545	210278545	Rat
152025232	Bw192	Body weight QTL 192	3.93		body mass (VT:0001259)		1	127329268	206393015	Rat
1578759	Uae30	Urinary albumin excretion QTL 30	3.3	0.003	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	160111531	262090437	Rat
61343	Bp28	Blood pressure QTL 28			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	161077990	206077990	Rat
2293693	Bss22	Bone structure and strength QTL 22	33.52	0.0001	femur morphology trait (VT:0000559)	femur cross-sectional area (CMO:0001661)	1	181059071	226059071	Rat
1358902	Bw47	Body weight QTL 47	1.67		body mass (VT:0001259)	body weight (CMO:0000012)	1	99645382	221502378	Rat
2300161	Bmd43	Bone mineral density QTL 43	8.4	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	1	181059071	226059071	Rat
1300145	Rf7	Renal function QTL 7	2.96		urine creatinine amount (VT:0010540)	urine creatinine level (CMO:0000125)	1	194575422	239575422	Rat
61347	Bp197	Blood pressure QTL 197	4.2		arterial blood pressure trait (VT:2000000)	blood pressure measurement (CMO:0000003)	1	168063662	213063662	Rat
8655655	Arrd2	Age-related retinal degeneration QTL 2	7.79		retinal layer morphology trait (VT:0003727)	percentage of study population developing retinopathy during a period of time (CMO:0002453)	1	193400541	238400541	Rat
61348	Bp30	Blood pressure QTL 30	2.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	159894717	207261263	Rat
2303622	Vencon6	Ventilatory control QTL 6		0.001	respiration trait (VT:0001943)	respiration rate (CMO:0000289)	1	163992710	208992710	Rat
1358898	Bp255	Blood pressure QTL 255	3.6		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	200449456	256003563	Rat
631214	Bw61	Body weight QTL61	3.4	0.0001	intramuscular adipose amount (VT:0010044)	intramuscular fat area (CMO:0001162)	1	182535316	227535316	Rat
7771612	Cm80	Cardiac mass QTL 80	8.4		heart left ventricle mass (VT:0007031)	heart left ventricle weight (CMO:0000776)	1	146080545	243492863	Rat
731168	Bp154	Blood pressure QTL 154	3.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	103779152	223964440	Rat
631205	Bp196	Blood pressure QTL 196	4	0.0001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	98879955	208479939	Rat
2300174	Bmd42	Bone mineral density QTL 42	8.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	bone mineral density (CMO:0001226)	1	181059071	226059071	Rat
737828	Hcas3	Hepatocarcinoma susceptibility QTL 3	4.9		liver integrity trait (VT:0010547)	liver tumorous lesion volume to total liver volume ratio (CMO:0001082)	1	153679879	232414077	Rat
1354661	Bw33	Body weight QTL 33	5.2		body mass (VT:0001259)	body weight (CMO:0000012)	1	160573753	266453731	Rat
1358886	Bp260	Blood pressure QTL 260	3.67		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	160574007	235238518	Rat
2293654	Bss30	Bone structure and strength QTL 30	32.65	0.0001	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	1	181059071	226059071	Rat
724531	Uae5	Urinary albumin excretion QTL 5	4		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	1	160111426	262090599	Rat
2300187	Bmd41	Bone mineral density QTL 41	8.9	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	1	181059071	226059071	Rat
8552891	Epfw5	Epididymal fat weight QTL 5	4.4		epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	1	202543537	247543537	Rat
1359018	Hrtrt20	Heart rate QTL 20	3.08		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	1	194786607	207590403	Rat
1354580	Scort1	Serum corticosterone level QTL 1	3.4		blood corticosterone amount (VT:0005345)	blood corticosterone level (CMO:0001172)	1	154961463	266453731	Rat
70209	Niddm23	Non-insulin dependent diabetes mellitus QTL 23	2.82		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	162753891	207753891	Rat
1358294	Bw37	Body weight QTL 37	5	0.000011	body mass (VT:0001259)	body weight (CMO:0000012)	1	180739993	225739993	Rat
61378	Bp43	Blood pressure QTL 43	22.6		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	191177449	205813246	Rat
634314	Niddm44	Non-insulin dependent diabetes mellitus QTL 44			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	51941022	208479811	Rat
724559	Pancm1	Pancreatic morphology QTL 1	7.1		islet of Langerhans morphology trait (VT:0005215)	pancreatic islet damage composite score (CMO:0001156)	1	191190115	223964326	Rat
2312420	Pur17	Proteinuria QTL 17	7.1	0.0001	urine protein amount (VT:0005160)	urine total protein excretion rate (CMO:0000756)	1	172718770	228180370	Rat
10059600	Bp378	Blood pressure QTL 378	3.08	0.05	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	186298393	231298393	Rat
1354591	Cm36	Cardiac mass QTL 36	4.1		heart left ventricle mass (VT:0007031)	calculated heart weight (CMO:0000073)	1	111949780	210707719	Rat
10059597	Bp377	Blood pressure QTL 377	3.42	0.025	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	34565911	208798288	Rat
631260	Tcas2	Tongue tumor susceptibility QTL 2	4.93		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	1	201915593	208479939	Rat
619614	Bp78	Blood pressure QTL 78		0.001	arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	178547286	206690557	Rat
2312564	Glom18	Glomerulus QTL 18	2.4	0.003	kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	1	194786607	262083703	Rat
634321	Hc1	Hypercalciuria QTL 1	2.91		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	1	188241285	250779312	Rat
724562	Rends1	Renal damage susceptibility QTL 1		0.05	kidney glomerulus integrity trait (VT:0010546)	index of glomerular damage (CMO:0001135)	1	139442053	223964440	Rat
1300168	Bp170	Blood pressure QTL 170	2.76		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	192995199	237995199	Rat
61403	Niddm4	Non-insulin dependent diabetes mellitus QTL 4			blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	1	201464383	246464383	Rat
2292222	Bp307	Blood pressure QTL 307	3.06	0.0014	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	186298393	231298393	Rat
2292220	Bp306	Blood pressure QTL 306	3.47	0.00087	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	186298393	231298393	Rat
1354615	Cm32	Cardiac mass QTL 32	5.2		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	1	111949780	210707719	Rat
1600380	Niddm70	Non-insulin dependent diabetes mellitus QTL 70	3.1	0.0008	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	1	185979875	230979875	Rat
1354610	Bw34	Body weight QTL 34	4.1		body mass (VT:0001259)	body weight (CMO:0000012)	1	160573753	266453731	Rat
1582206	Kidm33	Kidney mass QTL 33	6.9		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	1	197807365	233480676	Rat
1354620	Kidm19	Kidney mass QTL 19	4		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	160573753	210707719	Rat
8655855	Arrd3	Age-related retinal degeneration QTL 3	3.07		lens clarity trait (VT:0001304)	cataract incidence/prevalence measurement (CMO:0001585)	1	193400541	238400541	Rat
634338	Hcar4	Hepatocarcinoma resistance QTL 4	4.6		liver integrity trait (VT:0010547)	liver tumorous lesion number to liver area ratio (CMO:0001210)	1	202851915	223964440	Rat
1354618	Kidm15	Kidney mass QTL 15	5		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	1	165707719	210707719	Rat
6903303	Scl34	Serum cholesterol QTL 34	2.5	0.0033	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	1	173363824	227535316	Rat
152025212	Bw190	Body weight QTL 190	5.7		body mass (VT:0001259)		1	132966869	206393015	Rat
2293083	Iddm25	Insulin dependent diabetes mellitus QTL 25	4.18		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	191260175	236260175	Rat
1354606	Bp246	Blood pressure QTL 246	3.6		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	1	111949780	228180370	Rat
738032	Hcas5	Hepatocarcinoma susceptibility QTL 5	3.12		liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	185857683	270518180	Rat
2325727	Pia41	Pristane induced arthritis QTL 41			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	1	188241285	233241285	Rat
1354602	Bw35	Body weight QTL 35	12.2		body mass (VT:0001259)	body weight (CMO:0000012)	1	160573753	210707719	Rat
631670	Iddm10	Insulin dependent diabetes mellitus QTL 10	1.9		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	1	183564652	205813246	Rat

Markers in Region

RH144155

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	193,700,418 - 193,700,541 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	211,240,358 - 211,240,480	NCBI	Rnor6.0
Rnor_5.0	1	218,166,919 - 218,167,041	UniSTS	Rnor5.0
RGSC_v3.4	1	198,675,227 - 198,675,349	UniSTS	RGSC3.4
Celera	1	191,392,195 - 191,392,317	UniSTS
RH 3.4 Map	1	1436.9	UniSTS
Cytogenetic Map	1	q41	UniSTS

BF398286

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	193,678,597 - 193,678,831 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	211,218,537 - 211,218,770	NCBI	Rnor6.0
Rnor_5.0	1	218,145,098 - 218,145,331	UniSTS	Rnor5.0
RGSC_v3.4	1	198,653,406 - 198,653,639	UniSTS	RGSC3.4
Celera	1	191,370,374 - 191,370,607	UniSTS
RH 3.4 Map	1	1414.8	UniSTS
Cytogenetic Map	1	q41	UniSTS

D7Ertd753e

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	193,699,674 - 193,699,920 (+)	MAPPER	mRatBN7.2
mRatBN7.2	18	33,768,355 - 33,768,601 (-)	MAPPER	mRatBN7.2
mRatBN7.2	18	33,768,355 - 33,768,601 (+)	MAPPER	mRatBN7.2
mRatBN7.2	1	193,699,674 - 193,699,920 (-)	MAPPER	mRatBN7.2
Rnor_6.0	18	36,091,814 - 36,092,059	NCBI	Rnor6.0
Rnor_6.0	1	211,239,614 - 211,239,859	NCBI	Rnor6.0
Rnor_5.0	18	35,760,213 - 35,760,458	UniSTS	Rnor5.0
Rnor_5.0	1	218,166,175 - 218,166,420	UniSTS	Rnor5.0
RGSC_v3.4	1	198,674,483 - 198,674,728	UniSTS	RGSC3.4
RGSC_v3.4	18	34,950,686 - 34,950,931	UniSTS	RGSC3.4
Celera	1	191,391,451 - 191,391,696	UniSTS
Celera	18	33,367,059 - 33,367,304	UniSTS
Cytogenetic Map	1	q41	UniSTS

RH129075

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	18	33,768,354 - 33,768,537 (+)	MAPPER	mRatBN7.2
mRatBN7.2	1	193,699,738 - 193,699,921 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	211,239,678 - 211,239,860	NCBI	Rnor6.0
Rnor_6.0	18	36,091,813 - 36,091,995	NCBI	Rnor6.0
Rnor_5.0	18	35,760,212 - 35,760,394	UniSTS	Rnor5.0
Rnor_5.0	1	218,166,239 - 218,166,421	UniSTS	Rnor5.0
RGSC_v3.4	1	198,674,547 - 198,674,729	UniSTS	RGSC3.4
RGSC_v3.4	18	34,950,685 - 34,950,867	UniSTS	RGSC3.4
Celera	18	33,367,058 - 33,367,240	UniSTS
Celera	1	191,391,515 - 191,391,697	UniSTS
Cytogenetic Map	1	q41	UniSTS

BF404454

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	193,696,230 - 193,696,435 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	211,236,170 - 211,236,374	NCBI	Rnor6.0
Rnor_5.0	1	218,162,731 - 218,162,935	UniSTS	Rnor5.0
RGSC_v3.4	1	198,671,039 - 198,671,243	UniSTS	RGSC3.4
Celera	1	191,388,007 - 191,388,211	UniSTS
RH 3.4 Map	1	1434.29	UniSTS
Cytogenetic Map	1	q41	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	165	91	90	59	92	59	6	356	192	11	144	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_144746	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017588785	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039100105	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039100143	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC131400	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF180350	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC081720	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473953	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000023139 ⟹ ENSRNOP00000023139

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	1	203,095,531 - 203,129,893 (+)	Ensembl
mRatBN7.2 Ensembl	1	193,665,983 - 193,700,268 (+)	Ensembl
Rnor_6.0 Ensembl	1	211,205,903 - 211,239,888 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000101983 ⟹ ENSRNOP00000096699

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	1	203,114,720 - 203,129,893 (+)	Ensembl
mRatBN7.2 Ensembl	1	193,685,102 - 193,700,274 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000103932 ⟹ ENSRNOP00000090325

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	193,685,153 - 193,700,268 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000105579 ⟹ ENSRNOP00000090324

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	1	203,095,535 - 203,129,893 (+)	Ensembl
mRatBN7.2 Ensembl	1	193,665,855 - 193,700,268 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000119288 ⟹ ENSRNOP00000092862

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	1	203,114,338 - 203,129,893 (+)	Ensembl
mRatBN7.2 Ensembl	1	193,684,720 - 193,700,274 (+)	Ensembl

RefSeq Acc Id:

NM_144746 ⟹ NP_653347

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	203,095,582 - 203,129,568 (+)	NCBI
mRatBN7.2	1	193,665,963 - 193,699,950 (+)	NCBI
Rnor_6.0	1	211,205,903 - 211,239,889 (+)	NCBI
Rnor_5.0	1	218,132,463 - 218,166,450 (+)	NCBI
RGSC_v3.4	1	198,640,771 - 198,674,758 (+)	RGD
Celera	1	191,357,924 - 191,391,726 (+)	RGD

Sequence:

show sequence

CGGCGGCGGCGGCGGTGGCGGCAGCGGCAGCGGCGGTGGCGGCCGGGGCTGAGCGCTCGGAGCG
CCTCGGTCGGCCGCGCTCAGCTGGGCGCGTCCCGCCCGCGCCATGGCAGGAGCCGGAGGTGGCG
GCTGCCCGACGGGCGGCAACGACTTCCAGTGGTGCTTCTCGCAGGTGAAGGGCGCTGTCGACGA
GGACGTGGCGGAAGCCGACATCATCTCCACCGTTGAGTTTAACTACTCTGGAGACCTTCTTGCA
ACAGGAGACAAAGGTGGCAGAGTTGTTATTTTCCAACGGGAACAAGAGAATAAAGGCCGCGCTC
ACTCTAGGGGAGAGTACAATGTTTACAGTACCTTTCAGAGTCATGAGCCAGAGTTTGACTATTT
GAAAAGTCTAGAAATTGAAGAAAAAATTAATAAAATCAGGTGGTTACCGCAACAGAATGCTGCT
CATTTTCTACTCTCTACAAATGATAAAACTATTAAATTATGGAAAATAAGTGAACGAGATAAAA
GAGCAGAAGGTTATAACTTGAAAGATGAAGATGGACGACTTCGAGACCCATTTAGAATTACGGC
ACTACGGGTTCCAATATTGAAGCCCATGGACCTTATGGTAGAAGCAAGTCCACGACGAATTTTT
GCAAATGCTCATACATATCACATAAATTCCATTTCAGTAAATAGTGATCATGAAACATATCTCT
CTGCAGATGATCTGAGAATTAACCTATGGCATTTAGAAATCACAGATAGAAGCTTCAACATTGT
GGACATCAAGCCTGCTAACATGGAGGAGCTGACAGAAGTCATCACTGCCGCGGAGTTCCACCCA
CACCAGTGCAATGTATTCGTCTACAGCAGCAGCAAGGGGACCATCAGGCTGTGTGACATGCGTT
CTTCTGCCCTCTGTGATAGGCATGCCAAGTTTTTTGAAGAGCCAGAAGATCCCAGCAGTAGATC
CTTTTTCTCAGAAATAATCTCATCTATATCTGATGTCAAGTTCAGCCACAGTGGTCGATACATG
ATGACCAGAGACTATCTGTCGGTGAAGGTATGGGACCTCAACATGGAGGGCAGGCCTGTCGAGA
CCCACCAGGTACATGAGTACCTACGAAGCAAGCTCTGCTCCTTGTATGAGAATGACTGCATCTT
TGACAAGTTCGAGTGCTGCTGGAATGGTTCAGACAGTGCCATTATGACGGGGTCCTACAACAAC
TTCTTTAGAATGTTTGATAGAAACACTCGGAGGGATGTTACACTGGAAGCCTCAAGAGAGAACA
GCAAGCCCCGAGCCAGCCTGAAGCCCCGGAAAGTGTGTTCAGGGGGTAAGAGGAAGAAGGATGA
GATTAGCGTGGACAGTTTGGACTTCAATAAGAAGATCCTTCACACAGCCTGGCACCCCATGGAG
AGCATTATTGCTGTAGCTGCCACCAATAACTTGTATATATTCCAGGACAAAATTAATTAAGGAA
CTGACTGGAGGACCAAGTGTTGTCTTGCATACATACATAAGCCGGTCGTTTTCCTGTCCAAAAA
AGGCATTGTCCTCTCCATTGAGAATAGTGACGCACTTCTACTTCCCTCATAGACACAGGAGAAG
AAGGGGTCTCAGCTGGAGCCTTGGGAGAGATGAGTGCTGCTGCTGAAGGGAAAACCTACTTGAA
GCTGAATTGGTGGACTCTGCTCAATAAAGGCCATTACTCAAATGTAAAAAAAAAAAAAAAAAAA
AAAAAA

hide sequence

RefSeq Acc Id:

XM_039100105 ⟹ XP_038956033

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	203,095,858 - 203,129,895 (+)	NCBI
mRatBN7.2	1	193,666,238 - 193,700,277 (+)	NCBI

RefSeq Acc Id:

XM_039100143 ⟹ XP_038956071

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	203,095,536 - 203,129,895 (+)	NCBI
mRatBN7.2	1	193,665,918 - 193,700,277 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_653347	(Get FASTA)	NCBI Sequence Viewer
	XP_038956033	(Get FASTA)	NCBI Sequence Viewer
	XP_038956071	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAF08536	(Get FASTA)	NCBI Sequence Viewer
	AAH81720	(Get FASTA)	NCBI Sequence Viewer
	EDM11826	(Get FASTA)	NCBI Sequence Viewer
	EDM11827	(Get FASTA)	NCBI Sequence Viewer
	EDM11828	(Get FASTA)	NCBI Sequence Viewer
	EDM11829	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000023139
GenBank Protein	P56932	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_653347 ⟸ NM_144746

- UniProtKB:

Q66HR7 (UniProtKB/Swiss-Prot), P56932 (UniProtKB/Swiss-Prot), A0A0G2JSQ0 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MAGAGGGGCPTGGNDFQWCFSQVKGAVDEDVAEADIISTVEFNYSGDLLATGDKGGRVVIFQRE
QENKGRAHSRGEYNVYSTFQSHEPEFDYLKSLEIEEKINKIRWLPQQNAAHFLLSTNDKTIKLW
KISERDKRAEGYNLKDEDGRLRDPFRITALRVPILKPMDLMVEASPRRIFANAHTYHINSISVN
SDHETYLSADDLRINLWHLEITDRSFNIVDIKPANMEELTEVITAAEFHPHQCNVFVYSSSKGT
IRLCDMRSSALCDRHAKFFEEPEDPSSRSFFSEIISSISDVKFSHSGRYMMTRDYLSVKVWDLN
MEGRPVETHQVHEYLRSKLCSLYENDCIFDKFECCWNGSDSAIMTGSYNNFFRMFDRNTRRDVT
LEASRENSKPRASLKPRKVCSGGKRKKDEISVDSLDFNKKILHTAWHPMESIIAVAATNNLYIF
QDKIN

hide sequence

Ensembl Acc Id:

ENSRNOP00000023139 ⟸ ENSRNOT00000023139

RefSeq Acc Id:	XP_038956071 ⟸ XM_039100143
- Peptide Label:	isoform X2

RefSeq Acc Id:	XP_038956033 ⟸ XM_039100105
- Peptide Label:	isoform X1
- UniProtKB:	A6HX96 (UniProtKB/TrEMBL), A6K6P2 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000090325 ⟸ ENSRNOT00000103932

Ensembl Acc Id:

ENSRNOP00000092862 ⟸ ENSRNOT00000119288

Ensembl Acc Id:

ENSRNOP00000096699 ⟸ ENSRNOT00000101983

Ensembl Acc Id:

ENSRNOP00000090324 ⟸ ENSRNOT00000105579

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P56932-F1-model_v2	AlphaFold	P56932	1-453	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13690499

Promoter ID:

EPDNEW_R1024

Type:

initiation region

Name:

Ppp2r2d_1

Description:

protein phosphatase 2, regulatory subunit B, delta

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	1	211,205,852 - 211,205,912	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:708356	AgrOrtholog
BioCyc Gene	G2FUF-57104	BioCyc
Ensembl Genes	ENSRNOG00000016940	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000023139	ENTREZGENE
Gene3D-CATH	2.130.10.10	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7112646	IMAGE-MGC_LOAD
InterPro	PP2A_PR55	UniProtKB/Swiss-Prot
	PP2A_PR55_CS	UniProtKB/Swiss-Prot
	WD40/YVTN_repeat-like_dom_sf	UniProtKB/Swiss-Prot
	WD40_repeat	UniProtKB/Swiss-Prot
	WD40_repeat_dom_sf	UniProtKB/Swiss-Prot
KEGG Report	rno:246255	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:93154	IMAGE-MGC_LOAD
NCBI Gene	246255	ENTREZGENE
PANTHER	PTHR11871	UniProtKB/Swiss-Prot
PhenoGen	Ppp2r2d	PhenoGen
PIRSF	PP2A_PR55	UniProtKB/Swiss-Prot
PRINTS	PP2APR55	UniProtKB/Swiss-Prot
PROSITE	PR55_1	UniProtKB/Swiss-Prot
	PR55_2	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000016940	RatGTEx
SMART	WD40	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF50978	UniProtKB/Swiss-Prot
UniProt	2ABD_RAT	UniProtKB/Swiss-Prot
	A0A0G2JSQ0	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6AVG4_RAT	UniProtKB/TrEMBL
	A0A8I6GIT0_RAT	UniProtKB/TrEMBL
	A0A8I6GJZ8_RAT	UniProtKB/TrEMBL
	A6HX96	ENTREZGENE, UniProtKB/TrEMBL
	A6HX98_RAT	UniProtKB/TrEMBL
	A6K6P2	ENTREZGENE, UniProtKB/TrEMBL
	P56932	ENTREZGENE
	Q66HR7	ENTREZGENE
UniProt Secondary	Q66HR7	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2011-08-02	Ppp2r2d	protein phosphatase 2, regulatory subunit B, delta	Ppp2r2d	protein phosphatase 2, regulatory subunit B, delta isoform	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-09-10	Ppp2r2d	protein phosphatase 2, regulatory subunit B, delta isoform	LOC246255	protein phosphatase 2A B regulatory subunit delta isoform	Symbol and Name updated	1299863	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Annotations - KEGG (archival)