A1bg (alpha-1-B glycoprotein) - Rat Genome Database

Name: A1bg
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: A1bg (alpha-1-B glycoprotein) Rattus norvegicus

Analyze

Symbol:

A1bg

Name:

alpha-1-B glycoprotein

RGD ID:

69417

Description:

Predicted to be located in extracellular region. Predicted to be active in plasma membrane. Orthologous to human A1BG (alpha-1-B glycoprotein); INTERACTS WITH 17alpha-ethynylestradiol; 2,2',4,4'-Tetrabromodiphenyl ether; acetamide.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

alpha-1B-glycoprotein; C44; liver regeneration-related protein 1

RGD Orthologs

Human

Mouse

Chinchilla

Bonobo

Dog

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	A1BG (alpha-1-B glycoprotein)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, OMA, OrthoDB, OrthoMCL, PhylomeDB, Treefam
Mus musculus (house mouse):	A1bg (alpha-1-B glycoprotein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	A1bg (alpha-1-B glycoprotein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	A1BG (alpha-1-B glycoprotein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	A1BG (alpha-1-B glycoprotein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	A1BG (alpha-1-B glycoprotein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	A1BG (alpha-1-B glycoprotein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	A1bg (alpha-1-B glycoprotein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	A1BG (alpha-1-B glycoprotein)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	A1bg (alpha-1-B glycoprotein)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	7	92,493,934 - 92,498,460 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	92,494,372 - 92,498,097 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	7	94,334,395 - 94,338,558 (-)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	7	96,535,568 - 96,539,731 (-)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	7	96,423,846 - 96,428,009 (-)	NCBI	Rnor_WKY
Rnor_6.0	7	102,294,805 - 102,298,522 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	102,294,797 - 102,298,522 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	7	102,865,631 - 102,869,723 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	7	97,799,125 - 97,802,842 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	7	97,833,354 - 97,837,072 (-)	NCBI
Celera	7	89,209,243 - 89,212,960 (-)	NCBI		Celera
Cytogenetic Map	7	q33	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

genetic disease (ISO)

Hepatomegaly (ISO)

schizophrenia (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

17alpha-ethynylestradiol (EXP)

2,2',4,4'-Tetrabromodiphenyl ether (EXP)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

4,4'-sulfonyldiphenol (ISO)

acetamide (EXP)

aflatoxin B1 (EXP,ISO)

all-trans-retinoic acid (ISO)

ammonium chloride (EXP)

beta-naphthoflavone (EXP)

bexarotene (EXP)

bisphenol A (EXP,ISO)

butanal (ISO)

cadmium atom (ISO)

carbon nanotube (ISO)

clofibrate (EXP)

copper atom (ISO)

copper(0) (ISO)

copper(II) sulfate (ISO)

cyclosporin A (ISO)

dibutyl phthalate (ISO)

dicrotophos (ISO)

dorsomorphin (ISO)

entinostat (ISO)

fenofibrate (EXP)

fructose (EXP)

indole-3-methanol (EXP)

inulin (ISO)

mercury atom (ISO)

mercury dibromide (ISO)

mercury dichloride (ISO)

mercury(0) (ISO)

N-acetyl-L-cysteine (EXP)

N-nitrosodiethylamine (EXP)

nickel atom (ISO)

olanzapine (ISO)

ozone (EXP)

pentanal (ISO)

perfluorooctane-1-sulfonic acid (ISO)

phenylmercury acetate (ISO)

pirinixic acid (ISO)

propanal (ISO)

quercetin (ISO)

SB 431542 (ISO)

sodium arsenite (ISO)

sunitinib (ISO)

tamoxifen (EXP,ISO)

tetrachloromethane (EXP)

tributylstannane (ISO)

valproic acid (ISO)

zinc atom (ISO)

zinc(0) (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

biological_process (ND)

Cellular Component

cellular anatomical entity (IEA)

extracellular region (ISO,ISS)

plasma membrane (IBA)

Molecular Function

molecular_function (ND)

References

References - curated

#	Reference Title	Reference Citation
1.	Cloning of a novel growth hormone-regulated rat complementary deoxyribonucleic acid with homology to the human alpha1B-glycoprotein, characterizing a new protein family.	Gardmo C, etal., Endocrinology 2001 Jun;142(6):2695-701.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
4.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
6.	Tentative Sequence Identification Numbers	Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
7.	Identification and characterization of differentially expressed genes in the early response phase during liver regeneration.	Xu W, etal., Biochem Biophys Res Commun 2000 Nov 19;278(2):318-25.

Additional References at PubMed

PMID:3458201	PMID:12477932	PMID:15489334	PMID:16502470	PMID:19056867	PMID:22516433	PMID:23376485	PMID:23533145	PMID:27068509	PMID:27559042

Genomics

Comparative Map Data

A1bg
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	7	92,493,934 - 92,498,460 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	92,494,372 - 92,498,097 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	7	94,334,395 - 94,338,558 (-)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	7	96,535,568 - 96,539,731 (-)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	7	96,423,846 - 96,428,009 (-)	NCBI	Rnor_WKY
Rnor_6.0	7	102,294,805 - 102,298,522 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	102,294,797 - 102,298,522 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	7	102,865,631 - 102,869,723 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	7	97,799,125 - 97,802,842 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	7	97,833,354 - 97,837,072 (-)	NCBI
Celera	7	89,209,243 - 89,212,960 (-)	NCBI		Celera
Cytogenetic Map	7	q33	NCBI

A1BG
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	19	58,345,183 - 58,353,492 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	19	58,345,178 - 58,353,492 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	19	58,856,549 - 58,864,858 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	19	63,548,356 - 63,556,669 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	19	63,548,355 - 63,556,669	NCBI
Celera	19	55,902,160 - 55,908,858 (-)	NCBI		Celera
Cytogenetic Map	19	q13.43	NCBI
HuRef	19	55,167,316 - 55,174,020 (-)	NCBI		HuRef
CHM1_1	19	58,852,105 - 58,858,795 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	19	61,441,599 - 61,449,907 (-)	NCBI		T2T-CHM13v2.0

A1bg
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	15	60,789,438 - 60,793,119 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	15	60,768,708 - 60,794,861 (-)	Ensembl		GRCm39 Ensembl
GRCm38	15	60,917,589 - 60,921,270 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	15	60,896,859 - 60,923,012 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	15	60,749,144 - 60,752,825 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	15	60,747,270 - 60,752,700 (-)	NCBI		MGSCv36	mm8
Celera	15	62,426,399 - 62,430,080 (-)	NCBI		Celera
Cytogenetic Map	15	D1	NCBI

A1bg
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955584	1,025,588 - 1,028,459 (-)	NCBI	ChiLan1.0	ChiLan1.0

A1BG
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	19	66,411,670 - 66,419,688 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	19	55,356,023 - 55,362,854 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	19	64,180,817 - 64,187,423 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	19	64,180,985 - 64,187,324 (-)	Ensembl	panpan1.1		panPan2

A1BG
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	1	99,593,654 - 99,607,125 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	1	99,590,051 - 99,607,106 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	1	99,988,667 - 100,002,163 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	1	100,234,344 - 100,247,840 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	1	100,230,261 - 100,248,034 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	1	99,879,817 - 99,893,314 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	1	99,592,169 - 99,605,662 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	1	100,347,319 - 100,360,815 (+)	NCBI		UU_Cfam_GSD_1.0

A1BG
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1	6	62,935,419 - 62,939,622 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	57,653,277 - 57,657,392 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

A1BG
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	6	50,621,794 - 50,629,057 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	6	50,621,508 - 50,628,347 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666045	3,920,280 - 3,926,560 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

A1bg
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624832	197,728 - 204,180 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624832	197,537 - 200,537 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in A1bg
34 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	119
Count of miRNA genes:	107
Interacting mature miRNAs:	112
Transcripts:	ENSRNOT00000006273
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
634336	Anxrr17	Anxiety related response QTL 17	3.66		locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	7	924703	115097879	Rat
1643004	Pain2	Pain QTL 2	1		mechanical nociception trait (VT:0002734)	self mutilation severity score (CMO:0002145)	7	9462246	98011544	Rat
61357	Bp38	Blood pressure QTL 38	1.6	0.052	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	41333674	119109060	Rat
1358361	Sradr5	Stress Responsive Adrenal Weight QTL 5	5.55		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	7	43747012	108555253	Rat
1300179	Kidm5	Kidney mass QTL 5	3.51		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	7	43747012	135012528	Rat
1300149	Cm6	Cardiac mass QTL 6	4.09		heart mass (VT:0007028)	heart left ventricle weight to body weight ratio (CMO:0000530)	7	43747099	102228765	Rat
631504	Cm27	Cardiac mass QTL 27	3.45		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	7	44421311	118198041	Rat
2293696	Bmd32	Bone mineral density QTL 32	5.1	0.0001	femur strength trait (VT:0010010)	femoral neck polar moment of inertia (CMO:0001670)	7	47651439	92651439	Rat
2293707	Bss32	Bone structure and strength QTL 32	7.64	0.0001	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	7	47651439	92651439	Rat
2300178	Bmd54	Bone mineral density QTL 54	5.3	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	7	47651439	92651439	Rat
2293644	Bmd29	Bone mineral density QTL 29	5.4	0.0001	femur size trait (VT:1000369)	femoral neck cross-sectional area (CMO:0001697)	7	47651439	92651439	Rat
2293667	Bss42	Bone structure and strength QTL 42	7.25	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra cross-sectional area (CMO:0001689)	7	47651439	92651439	Rat
2293678	Bss24	Bone structure and strength QTL 24	6.71	0.0001	femur morphology trait (VT:0000559)	femur cross-sectional area (CMO:0001661)	7	47651439	92651439	Rat
2293685	Bmd21	Bone mineral density QTL 21	4.2	0.0003	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	7	47651439	92651439	Rat
1300151	Bp181	Blood pressure QTL 181	3.36		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	7	53612714	103945643	Rat
2317035	Aia16	Adjuvant induced arthritis QTL 16	2.71		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	7	59238038	104238038	Rat
1298528	Bp169	Blood pressure QTL 169		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	61074194	106074194	Rat
1559283	Emca4	Estrogen-induced mammary cancer QTL 4	3.7		mammary gland integrity trait (VT:0010552)	percentage of study population developing mammary tumors during a period of time (CMO:0000948)	7	62004452	101773158	Rat
1576303	Ept7	Estrogen-induced pituitary tumorigenesis QTL 7	3.7		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	7	62004452	101773158	Rat
70173	Niddm19	Non-insulin dependent diabetes mellitus QTL 19	4.33	0.00005	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	7	64002457	135012528	Rat
2316947	Rf58	Renal function QTL 58	7.8		kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	7	68938720	113886318	Rat
2316952	Pur22	Proteinuria QTL 22	5.2		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	7	68938720	113886318	Rat
2316955	Stl24	Serum triglyceride level QTL 24	7.1		blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	7	68938720	113886318	Rat
631540	Bw9	Body weight QTL 9	4.5		body mass (VT:0001259)	body weight (CMO:0000012)	7	69736226	117455174	Rat
1357338	Stl17	Serum triglyceride level QTL 17	3.23		blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	7	69736356	112729554	Rat
634331	Pia17	Pristane induced arthritis QTL 17	4.7		joint integrity trait (VT:0010548)	arthritic paw count (CMO:0001460)	7	73829340	130221005	Rat
7411654	Foco25	Food consumption QTL 25	9.3	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	7	75918751	120918751	Rat
7411607	Foco15	Food consumption QTL 15		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	7	75918751	120918751	Rat
724537	Niddm52	Non-insulin dependent diabetes mellitus QTL 52		0.02	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	7	80221299	93595843	Rat
1641908	Teswt1	Testicular weight QTL 1	3.28		testis mass (VT:1000644)	both testes wet weight (CMO:0000175)	7	80221299	94811326	Rat
631529	Tls2	T-lymphoma susceptibility QTL 2	0	0.001	thymus integrity trait (VT:0010555)	percentage of study population developing T-cell lymphomas during a period of time (CMO:0001911)	7	80221299	109401111	Rat
1331746	Kidm9	Kidney mass QTL 9	3.934		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	7	80221299	112308525	Rat
1331728	Bp214	Blood pressure QTL 214	2.825		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	80221299	124373579	Rat
1331768	Kidm10	Kidney mass QTL 10	4.62096		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	7	80221299	125221299	Rat
2317052	Aia17	Adjuvant induced arthritis QTL 17	2.13		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	7	81737938	126737938	Rat
634322	Bw12	Body weight QTL 12	0		body mass (VT:0001259)	body weight (CMO:0000012)	7	83153392	128153392	Rat
1358891	Bp265	Blood pressure QTL 265	2.21		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	83591953	134666232	Rat
1358914	Bp266	Blood pressure QTL 266			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	83591953	134666232	Rat
71114	Niddm14	Non-insulin dependent diabetes mellitus QTL 14	4.5		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	7	84257275	129257275	Rat
2298475	Eau6	Experimental allergic uveoretinitis QTL 6		0.0029	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	7	84257275	129257275	Rat
1558655	Swd4	Spike wave discharge measurement QTL 4	3.68	0.0002	brain electrophysiology trait (VT:0010557)	brain spike-and-wave discharge severity grade (CMO:0001988)	7	86983365	131983365	Rat
10450828	Scl79	Serum cholesterol level QTL 79	3.5	0.001	blood HDL cholesterol amount (VT:0000184)	blood low density lipoprotein cholesterol level (CMO:0000053)	7	89867376	101773158	Rat
1549899	Stresp8	Stress response QTL 8	4.37	0.0008	stress-related behavior trait (VT:0010451)	defensive burying duration (CMO:0001961)	7	90482196	135012528	Rat
2299163	Iddm34	Insulin dependent diabetes mellitus QTL 34	2.71		blood glucose amount (VT:0000188)	age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140)	7	91281130	135012528	Rat
631687	Hcas1	Hepatocarcinoma susceptibility QTL 1	3.9	0.001	liver integrity trait (VT:0010547)	liver tumorous lesion volume to total liver volume ratio (CMO:0001082)	7	91412594	129807172	Rat

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High		4	4		4
Medium		5	5		5
Low		12	7	4	7	3	3	2		5	3	3
Below cutoff	4	15	11	10	11	1	1	30	3	23	4	1

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_022258	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039078317	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF236054	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AJ302031	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC089771	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473950	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000185	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSRNOT00000006273 ⟹ ENSRNOP00000006273

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	7	92,494,372 - 92,498,097 (-)	Ensembl
Rnor_6.0 Ensembl	7	102,294,797 - 102,298,522 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000092777

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	7	92,494,781 - 92,498,097 (-)	Ensembl
Rnor_6.0 Ensembl	7	102,295,214 - 102,297,137 (-)	Ensembl

RefSeq Acc Id:

NM_022258 ⟹ NP_071594

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	7	92,494,380 - 92,498,097 (-)	NCBI
Rnor_6.0	7	102,294,805 - 102,298,522 (-)	NCBI
Rnor_5.0	7	102,865,631 - 102,869,723 (-)	NCBI
RGSC_v3.4	7	97,799,125 - 97,802,842 (-)	RGD
Celera	7	89,209,243 - 89,212,960 (-)	RGD

Sequence:

show sequence

AGACACTCCTGCTGGACTGAAGACCCACCATGTCTCTGTTGACTACTGTACTACTTCTCTGGGG
TTTCACTCTGGGCCCAGGAAATGCTCTTTGGCTTAATTCTGGCAGTGAACCTGAACTACGGGCA
GAGCCTCAATCCTTGCTGGAACCCTGGGCAAACCTCACACTGGTCTGCGCAGTTGATTTGCCTA
CCAAGGTCTTCGAGCTGATCATGAATGGGTGGTTCCTGAGTCAAGTCCGACTGGAGACACCGGT
GTTGTCATATCGCTTTTCCCTGGGGGCCATTACAAGTAACAACAGTGGCGTCTACCGCTGCCGA
TGTGGCGTGGAACCCCCTGTTGACATTCAACTGCCAGCGCTGAGCAAGTGGACAATGCTAAGCA
ATGCTTTGGAGGTGACAGGGAAAGAGCCCTTGCCTCCACCCTCAGCTCACGCTGATCCAGTCTC
CTGGATCACACCTGGTGGCCTGCCTGTCTACATCATGTGCCGGGTTGCCATGCGAGGTGTAACC
TACCTGCTGAGGAAGGAAGGGGTGGATGGTACCCAGAAACCTGATGTCCAGCACAAGGGAACGG
CTGGCTTTCTAATCTACAAGCCTGGTAACTACAGCTGCAGCTACCTAACCCATGCAGGAGGCGA
ACCCTCTGAGCCCAGTGCTATTGTGACCATCAAGATGTCTGCCACACAGCTTCCACCCAGTCTG
TGTTTAATGGGAAGTTACCTAACGATCTACCCCCAGAAGACACATGAGACGCTTGCTTGCAAAG
CTCCTCGGAATGCAGCCGAATTCCAACTCAGACAAGGAGAGAGGGTGCTGAATATTCAAGGGTT
CAGCCCCACCAGAGATGCTACCATATACTATGTGAACTTGAAGGAACTGGATAACCAAAGTCCT
TTTACCTGCCGCTACCGTATGCACAAATACATGCATGTTTGGTCGGAGGACAGCAAGCCCGTAG
AGCTGATGTGGAGTGACGAGAAACTACCAGCCCCGGTACTCACTGCAGAGCCATCAAGTCACAA
CCTGGAGCCTGGTTCAACAGTGCAGCTTCGATGTACTGCACACAAGGCTGGCCTGCGCTTTGGC
CTGCAACGCCAGGGCAAACCAGATTTAGTTGTGGTGCAGATGCTGAATTCGTCTGGGACCGAAG
CTGTCTTTGAGCTGCACAATATCTCAACAATCGACTCTGGCAACTACAGTTGTATCTACATGGA
ACAAGCACCACCCTTCTCAGGATCTGCTTCCAGTGAGCCCTTAGAGCTGCGGATAAATGGGCCA
GCACCCAAGCCAAGGCTGGAAGCTCTGTGGAAAGGCAAGGTTCCTCTGGGCCATGAAGCCATCT
TTCAATGCCATGGCCATGTGCCCAGGGTCAGCATGGAGCTGGTACGTGAGGGCTTTAAAACACC
CTTCTGGATGGCTTCAACAACAAGCACCTCAGCTTTTCTGAAGCTGTCCTTCGTCGGTCCCCAA
CATACAGGCAACTACAGCTGCCGCTATACTGCCCTGTCACCCTTCACATTTGAATCAGGGATCA
GTGACCCTGTGGAAGTTGTAGTAGAAGGTAGCTAACATCGCTGCAGACACAGGAAAGTGCCCTT
GGAAAGGGTTGGAGACAGACATAATACACATTCTTCGTGTAAGATGACTTCATTTTCTCAGGAC
TTAATAAAGGTCAAGTAAATTGTTGTGTAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039078317 ⟹ XP_038934245

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	7	92,493,934 - 92,498,460 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_071594	(Get FASTA)	NCBI Sequence Viewer
	XP_038934245	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAF68963	(Get FASTA)	NCBI Sequence Viewer
	AAH89771	(Get FASTA)	NCBI Sequence Viewer
	CAC19029	(Get FASTA)	NCBI Sequence Viewer
	EDM16186	(Get FASTA)	NCBI Sequence Viewer
	EDM16187	(Get FASTA)	NCBI Sequence Viewer
	Q9EPH1	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:	NP_071594 ⟸ NM_022258
- Peptide Label:	precursor
- UniProtKB:	Q9JKL2 (UniProtKB/Swiss-Prot)
- Sequence:	show sequence MSLLTTVLLLWGFTLGPGNALWLNSGSEPELRAEPQSLLEPWANLTLVCAVDLPTKVFELIMNG WFLSQVRLETPVLSYRFSLGAITSNNSGVYRCRCGVEPPVDIQLPALSKWTMLSNALEVTGKEP LPPPSAHADPVSWITPGGLPVYIMCRVAMRGVTYLLRKEGVDGTQKPDVQHKGTAGFLIYKPGN YSCSYLTHAGGEPSEPSAIVTIKMSATQLPPSLCLMGSYLTIYPQKTHETLACKAPRNAAEFQL RQGERVLNIQGFSPTRDATIYYVNLKELDNQSPFTCRYRMHKYMHVWSEDSKPVELMWSDEKLP APVLTAEPSSHNLEPGSTVQLRCTAHKAGLRFGLQRQGKPDLVVVQMLNSSGTEAVFELHNIST IDSGNYSCIYMEQAPPFSGSASSEPLELRINGPAPKPRLEALWKGKVPLGHEAIFQCHGHVPRV SMELVREGFKTPFWMASTTSTSAFLKLSFVGPQHTGNYSCRYTALSPFTFESGISDPVEVVVEG S hide sequence

RefSeq Acc Id:

ENSRNOP00000006273 ⟸ ENSRNOT00000006273

RefSeq Acc Id:	XP_038934245 ⟸ XM_039078317
- Peptide Label:	isoform X1

Protein Domains

Ig-like Ig-like V-type

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q9EPH1-F1-model_v2	AlphaFold	Q9EPH1	1-513	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13695362

Promoter ID:

EPDNEW_R5886

Type:

initiation region

Name:

A1bg_1

Description:

alpha-1-B glycoprotein

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	7	102,298,522 - 102,298,582	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:69417	AgrOrtholog
BioCyc Gene	G2FUF-33244	BioCyc
Ensembl Genes	ENSRNOG00000004692	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000006273	ENTREZGENE
	ENSRNOP00000006273.4	UniProtKB/Swiss-Prot
	ENSRNOP00000086160.1	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000006273	ENTREZGENE
	ENSRNOT00000006273.7	UniProtKB/Swiss-Prot
	ENSRNOT00000092777.2	UniProtKB/TrEMBL
Gene3D-CATH	2.60.40.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7326280	IMAGE-MGC_LOAD
InterPro	A1B_glyco/leuk_Ig-like_rcpt	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Ig-like_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Ig-like_dom_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Ig-like_fold	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Ig_sub	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:140656	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:108566	IMAGE-MGC_LOAD
NCBI Gene	140656	ENTREZGENE
PANTHER	ALPHA-1B-GLYCOPROTEIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	MHC CLASS I NK CELL RECEPTOR	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Ig_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	A1bg	PhenoGen
PIRSF	Alpha_1B_glycoprot_prd	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	IG_LIKE	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
SMART	SM00409	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF48726	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
TIGR	TC202782
UniProt	A0A8I6A5Z6_RAT	UniProtKB/TrEMBL
	A1BG_RAT	UniProtKB/Swiss-Prot, ENTREZGENE
	Q9JKL2	ENTREZGENE
UniProt Secondary	Q5EBD6	UniProtKB/Swiss-Prot
	Q9JKL2	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2002-06-10	A1bg	alpha-1-B glycoprotein			Symbol and Name status set to approved	70586	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_domains	contains concensus carbohydrate attachment sites and five putative immunoglobin-like domians	68729
gene_expression	highy expressed in regenerating liver after 70% hepatectomy	631955
gene_expression	expression specific to female liver and dependent on continuous growth hormone (GH)	68729
gene_expression	highly expressed exclusively in liver after hepatectomy	631979
gene_expression	highly expressed exclusively in liver after hepatectomy	631980
gene_protein	predicted 131 amino acid protein	68729
gene_regulation	regulated by female-specific growth hormone secretion	631979
gene_regulation	regulated by female-specific growth hormone secretion	631980

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD