Advanced Search (OLGA)

Gene: Slc26a5 (solute carrier family 26 member 5) Rattus norvegicus

Analyze

Symbol:

Slc26a5

Name:

solute carrier family 26 member 5

RGD ID:

69334

Description:

Enables chloride:bicarbonate antiporter activity and identical protein binding activity. Involved in several processes, including bicarbonate transport; chloride transmembrane transport; and positive regulation of cell size. Located in basolateral plasma membrane and lateral plasma membrane. Biomarker of hypothyroidism. Human ortholog(s) of this gene implicated in autosomal recessive nonsyndromic deafness 61. Orthologous to human SLC26A5 (solute carrier family 26 member 5); INTERACTS WITH acrylamide; ammonium chloride; bisphenol A.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

Pres; prestin; prestin (motor protein); solute carrier family 26 (anion exchanger), member 5; solute carrier family 26, member 5; solute carrier family 26, member 5 (prestin)

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	SLC26A5 (solute carrier family 26 member 5)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Slc26a5 (solute carrier family 26, member 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Slc26a5 (solute carrier family 26 member 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	SLC26A5 (solute carrier family 26 member 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	SLC26A5 (solute carrier family 26 member 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Slc26a5 (solute carrier family 26 member 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	SLC26A5 (solute carrier family 26 member 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	SLC26A5 (solute carrier family 26 member 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Slc26a5 (solute carrier family 26 member 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	RLN3 (relaxin 3)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	SLC26A5 (solute carrier family 26 member 5)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Slc26a5 (solute carrier family 26, member 5)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	slc26a5 (solute carrier family 26 member 5)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Prestin	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	YPR003C	Alliance	DIOPT (Hieranoid\|InParanoid\|PANTHER)
Caenorhabditis elegans (roundworm):	sulp-1	Alliance	DIOPT (OrthoFinder\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	sulp-4	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	sulp-5	Alliance	DIOPT (Hieranoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	sulp-8	Alliance	DIOPT (Hieranoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	slc26a5	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	14,102,492 - 14,141,520 (+)	NCBI		GRCr8
mRatBN7.2	4	13,210,260 - 13,249,289 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	13,210,260 - 13,249,289 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	4	18,355,676 - 18,394,701 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	14,172,343 - 14,209,428 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	12,541,325 - 12,580,338 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	9,795,811 - 9,860,904 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	9,821,541 - 9,860,571 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	4	9,822,682 - 9,861,708 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	4	8,657,314 - 8,697,539 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	4	8,657,313 - 8,697,539 (+)	NCBI
Celera	4	8,801,513 - 8,840,481 (+)	NCBI		Celera
Cytogenetic Map	4	q11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

autosomal recessive nonsyndromic deafness (ISO)

autosomal recessive nonsyndromic deafness 61 (ISO)

Deafness (ISO)

genetic disease (ISO)

Hearing Loss (ISO)

Hearing Loss, Noise-Induced (ISO)

hypothyroidism (IEP,ISO)

Nonsyndromic Sensorineural Hearing Loss (ISO)

Norman-Roberts syndrome (ISO)

pleomorphic xanthoastrocytoma (ISO)

Presbycusis (IEP)

sensorineural hearing loss (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

2,3',4,4',5-Pentachlorobiphenyl (ISO)

acrylamide (EXP)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

ammonium chloride (EXP)

benzo[a]pyrene (ISO)

bisphenol A (EXP)

butanal (ISO)

cadmium dichloride (EXP,ISO)

CGP 52608 (ISO)

ethylparaben (ISO)

flavonoids (EXP)

gemfibrozil (EXP)

mono(2-ethylhexyl) phthalate (ISO)

potassium chloride (EXP)

sodium arsenite (ISO)

sodium chloride (EXP)

Sodium salicylate (EXP)

tributylstannane (EXP)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

bicarbonate transport (IDA)

chloride transmembrane transport (IBA,IMP)

chloride transport (IDA)

cochlea development (IEP)

fructose transmembrane transport (IDA)

monoatomic anion transmembrane transport (IDA)

monoatomic ion transmembrane transport (IDA)

negative regulation of monoatomic ion transmembrane transport (IDA)

oxalate transport (IDA)

positive regulation of cell motility (IDA)

positive regulation of cell size (IDA)

regulation of cell shape (IEA)

regulation of membrane potential (IEA,ISO)

response to auditory stimulus (IEP)

response to ischemia (IEP)

response to potassium ion (IEP)

response to salicylic acid (IEP)

response to salt (IEP)

response to thyroid hormone (IEP)

response to xenobiotic stimulus (IEP)

sensory perception of sound (IEA,ISO)

sulfate transmembrane transport (IBA,IEA)

transmembrane transport (IEA)

Cellular Component

basolateral plasma membrane (IDA,IEA,ISO)

lateral plasma membrane (IDA,IEA,ISO)

lateral wall of outer hair cell (IEA,ISO)

membrane (IEA)

plasma membrane (IBA,IEA,ISO,TAS)

Molecular Function

bicarbonate transmembrane transporter activity (IBA)

chloride transmembrane transporter activity (IBA)

chloride:bicarbonate antiporter activity (IDA)

cytoskeletal motor activity (TAS)

identical protein binding (IPI)

oxalate transmembrane transporter activity (IBA)

protein binding (ISO)

protein homodimerization activity (IEA,ISO,ISS)

secondary active sulfate transmembrane transporter activity (IEA)

spectrin binding (IEA,ISO)

sulfate transmembrane transporter activity (IBA)

transcription factor binding (IPI)

References

References - curated

#	Reference Title	Reference Citation
1.	[Pre-stained slides for differential blood counts (author's transl)]	Bostjancic W, etal., Dtsch Med Wochenschr 1977 Aug 19;102(33):1175-7, 1185.
2.	Sugar transport by mammalian members of the SLC26 superfamily of anion-bicarbonate exchangers.	Chambard JM and Ashmore JF, J Physiol. 2003 Aug 1;550(Pt 3):667-77.
3.	Regulation of the voltage-gated potassium channel KCNQ4 in the auditory pathway.	Chambard JM and Ashmore JF, Pflugers Arch. 2005 Apr;450(1):34-44. Epub 2005 Jan 20.
4.	Cochlear function in Prestin knockout mice.	Cheatham MA, etal., J Physiol. 2004 Nov 1;560(Pt 3):821-30. Epub 2004 Aug 19.
5.	Prestin gene expression in the rat cochlea following intense noise exposure.	Chen GD Hear Res. 2006 Dec;222(1-2):54-61. Epub 2006 Sep 26.
6.	Aging outer hair cells (OHCs) in the Fischer 344 rat cochlea: function and morphology.	Chen GD, etal., Hear Res. 2009 Feb;248(1-2):39-47. doi: 10.1016/j.heares.2008.11.010. Epub 2008 Dec 10.
7.	Conserved dimeric subunit stoichiometry of SLC26 multifunctional anion exchangers.	Detro-Dassen S, etal., J Biol Chem. 2008 Feb 15;283(7):4177-88. Epub 2007 Dec 11.
8.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
9.	Molecular architecture and the structural basis for anion interaction in prestin and SLC26 transporters.	Gorbunov D, etal., Nat Commun. 2014 Apr 8;5:3622. doi: 10.1038/ncomms4622.
10.	Expression of prestin mRNA in the organotypic culture of rat cochlea.	Gross J, etal., Hear Res. 2005 Jun;204(1-2):183-90.
11.	Expression of prestin and Gata-3,-2,-1 mRNA in the rat organ of Corti during the postnatal period and in culture.	Gross J, etal., Hear Res. 2010 Mar;261(1-2):9-21. doi: 10.1016/j.heares.2009.12.017. Epub 2009 Dec 16.
12.	An ENU-induced mutation of miR-96 associated with progressive hearing loss in mice.	Lewis MA, etal., Nat Genet. 2009 May;41(5):614-8. doi: 10.1038/ng.369. Epub 2009 Apr 12.
13.	Prestin, a cochlear motor protein, is defective in non-syndromic hearing loss.	Liu XZ, etal., Hum Mol Genet. 2003 May 15;12(10):1155-62.
14.	Molecular screening of patients with nonsyndromic hearing loss from Nanjing city of China.	Lu Y, etal., J Biomed Res. 2011 Sep;25(5):309-18. doi: 10.1016/S1674-8301(11)60042-0.
15.	Reciprocal electromechanical properties of rat prestin: the motor molecule from rat outer hair cells.	Ludwig J, etal., Proc Natl Acad Sci U S A 2001 Mar 27;98(7):4178-83.
16.	The ultrastructural distribution of prestin in outer hair cells: a post-embedding immunogold investigation of low-frequency and high-frequency regions of the rat cochlea.	Mahendrasingam S, etal., Eur J Neurosci. 2010 May;31(9):1595-605. doi: 10.1111/j.1460-9568.2010.07182.x.
17.	Decrease of prestin expression by increased potassium concentration in organotypic cultures of the organ of Corti of newborn rats.	Mazurek B, etal., Neurosci Lett. 2011 Jul 15;499(1):52-6. doi: 10.1016/j.neulet.2011.05.031. Epub 2011 May 20.
18.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
19.	The motor protein prestin is a bullet-shaped molecule with inner cavities.	Mio K, etal., J Biol Chem. 2008 Jan 11;283(2):1137-45. Epub 2007 Nov 12.
20.	Mammalian prestin is a weak Cl⁻/HCO₃⁻ electrogenic antiporter.	Mistrík P, etal., J Physiol. 2012 Nov 15;590(22):5597-610. doi: 10.1113/jphysiol.2012.241448. Epub 2012 Aug 13.
21.	Deafness and permanently reduced potassium channel gene expression and function in hypothyroid Pit1dw mutants.	Mustapha M, etal., J Neurosci. 2009 Jan 28;29(4):1212-23. doi: 10.1523/JNEUROSCI.4957-08.2009.
22.	Promyelocytic leukemia zinc finger protein localizes to the cochlear outer hair cells and interacts with prestin, the outer hair cell motor protein.	Nagy I, etal., Hear Res. 2005 Jun;204(1-2):216-22.
23.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
24.	Intracellular anions as the voltage sensor of prestin, the outer hair cell motor protein.	Oliver D, etal., Science. 2001 Jun 22;292(5525):2340-3.
25.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
26.	GOA pipeline	RGD automated data pipeline
27.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
28.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
29.	Anion transport by the cochlear motor protein prestin.	Schanzler M and Fahlke C, J Physiol. 2012 Jan 15;590(Pt 2):259-72. doi: 10.1113/jphysiol.2011.209577. Epub 2011 Nov 7.
30.	High frequency of the IVS2-2A>G DNA sequence variation in SLC26A5, encoding the cochlear motor protein prestin, precludes its involvement in hereditary hearing loss.	Tang HY, etal., BMC Med Genet. 2005 Aug 8;6:30.
31.	Tentative Sequence Identification Numbers	Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
32.	Thyroid hormone is a critical determinant for the regulation of the cochlear motor protein prestin.	Weber T, etal., Proc Natl Acad Sci U S A 2002 Mar 5;99(5):2901-6.
33.	Thyroid hormone receptor alpha1 is a critical regulator for the expression of ion channels during final differentiation of outer hair cells.	Winter H, etal., Histochem Cell Biol. 2007 Jul;128(1):65-75. Epub 2007 May 23.
34.	Prestin regulation and function in residual outer hair cells after noise-induced hearing loss.	Xia A, etal., PLoS One. 2013 Dec 20;8(12):e82602. doi: 10.1371/journal.pone.0082602. eCollection 2013.
35.	Long-term administration of salicylate enhances prestin expression in rat cochlea.	Yang K, etal., Int J Audiol. 2009 Jan;48(1):18-23. doi: 10.1080/14992020802327998.

Additional References at PubMed

PMID:11125015	PMID:12584604	PMID:14553901	PMID:15649974	PMID:16803873	PMID:17120772	PMID:18226918	PMID:18796539	PMID:20418376	PMID:21344672	PMID:21614551	PMID:23542924
PMID:24303013	PMID:24603188	PMID:26635354	PMID:27636386	PMID:28097024	PMID:30529910	PMID:33667636

Genomics

Comparative Map Data

Slc26a5
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	14,102,492 - 14,141,520 (+)	NCBI		GRCr8
mRatBN7.2	4	13,210,260 - 13,249,289 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	13,210,260 - 13,249,289 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	4	18,355,676 - 18,394,701 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	14,172,343 - 14,209,428 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	12,541,325 - 12,580,338 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	9,795,811 - 9,860,904 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	9,821,541 - 9,860,571 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	4	9,822,682 - 9,861,708 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	4	8,657,314 - 8,697,539 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	4	8,657,313 - 8,697,539 (+)	NCBI
Celera	4	8,801,513 - 8,840,481 (+)	NCBI		Celera
Cytogenetic Map	4	q11	NCBI

SLC26A5
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	7	103,352,730 - 103,446,207 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	7	103,352,730 - 103,446,207 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	7	102,993,177 - 103,086,654 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	7	102,780,413 - 102,873,834 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	7	97,800,386 - 97,892,942 (-)	NCBI		Celera
Cytogenetic Map	7	q22.1	NCBI
HuRef	7	97,355,533 - 97,447,053 (-)	NCBI		HuRef
CHM1_1	7	102,926,169 - 103,019,937 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	7	104,667,171 - 104,760,648 (-)	NCBI		T2T-CHM13v2.0
CRA_TCAGchr7v2	7	102,353,543 - 102,447,443 (-)	NCBI

Slc26a5
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	5	22,013,999 - 22,070,602 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	5	22,015,653 - 22,070,602 (-)	Ensembl		GRCm39 Ensembl
GRCm38	5	21,809,001 - 21,865,604 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	5	21,810,655 - 21,865,604 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	5	21,316,473 - 21,371,422 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	5	21,322,479 - 21,377,428 (-)	NCBI		MGSCv36	mm8
Celera	5	18,781,281 - 18,837,517 (-)	NCBI		Celera
Cytogenetic Map	5	A3	NCBI
cM Map	5	9.97	NCBI

Slc26a5
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955410	8,358,786 - 8,414,145 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955410	8,358,780 - 8,414,145 (-)	NCBI	ChiLan1.0	ChiLan1.0

SLC26A5
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	6	140,227,545 - 140,305,630 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	7	188,497,418 - 188,575,508 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	7	95,363,028 - 95,437,527 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	7	108,088,197 - 108,178,578 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	7	108,088,197 - 108,178,578 (-)	Ensembl	panpan1.1		panPan2

SLC26A5
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	18	16,783,795 - 16,841,946 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	18	16,788,759 - 16,839,940 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	18	16,426,732 - 16,484,887 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	18	17,074,350 - 17,132,490 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	18	17,079,270 - 17,131,472 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	18	16,839,580 - 16,897,324 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	18	16,777,413 - 16,835,901 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	18	17,046,210 - 17,104,115 (+)	NCBI		UU_Cfam_GSD_1.0

Slc26a5
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	58,980,819 - 59,021,086 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936479	20,104,595 - 20,144,601 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936479	20,104,625 - 20,145,392 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

SLC26A5
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	9	103,378,776 - 103,453,730 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	9	103,382,558 - 103,420,054 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	9	113,990,590 - 114,062,746 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

SLC26A5
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	21	72,347,276 - 72,418,311 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	21	72,347,792 - 72,393,765 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666042	31,608,735 - 31,657,804 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Slc26a5
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624739	25,930,221 - 25,995,828 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624739	25,925,835 - 25,998,410 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Slc26a5
261 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	91
Count of miRNA genes:	79
Interacting mature miRNAs:	84
Transcripts:	ENSRNOT00000015733
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2302371	Stl22	Serum triglyceride level QTL 22	5.15		blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	4	5218294	57114705	Rat
8552903	Pigfal2	Plasma insulin-like growth factor 1 level QTL 2	7.3		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	4	1	31934116	Rat
724557	Plsm1	Polydactyly-luxate syndrome (PLS) morphotypes QTL 1		0.0003	forelimb integrity trait (VT:0010562)	front foot phalanges count (CMO:0001947)	4	1	27716890	Rat
9590100	Sffal4	Serum free fatty acids level QTL 4	7.36	0.05	blood free fatty acid amount (VT:0001553)	plasma free fatty acids level (CMO:0000546)	4	1	31934116	Rat
8552906	Pigfal3	Plasma insulin-like growth factor 1 level QTL 3			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	4	10084089	55084089	Rat
1357341	Gluco5	Glucose level QTL 5	6.4		adipocyte free fatty acid secretion trait (VT:0010465)	absolute change in adipocyte free fatty acid secretion per unit volume (CMO:0001446)	4	1	33250345	Rat
1357343	Gluco4	Glucose level QTL 4		0.00002	adipocyte glucose uptake trait (VT:0004185)	adipocyte maximal glucose uptake to basal glucose uptake ratio (CMO:0000874)	4	1	33250345	Rat
6478766	Anxrr47	Anxiety related response QTL 47		0.09637	locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	4	10084089	55084089	Rat
631642	Stl2	Serum triglyceride level QTL 2	3.3		blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	4	5219178	56647776	Rat
6478769	Anxrr48	Anxiety related response QTL 48		0.02514	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	10084089	55084089	Rat
631261	Tcas3	Tongue tumor susceptibility QTL 3	6.88		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	4	10814170	91360527	Rat
61333	Gluco16	Glucose level QTL 16	4.3	0.00001	adipocyte glucose uptake trait (VT:0004185)	absolute change in adipocyte glucose uptake (CMO:0000873)	4	1	30372989	Rat
634323	Hc2	Hypercalciuria QTL 2	2.15		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	4	210796	45210796	Rat
61408	Scl23	Serum cholesterol level QTL 23		0.0005	blood HDL phospholipid amount (VT:0010504)	serum high density lipoprotein phospholipid level (CMO:0001567)	4	1	27716890	Rat
631209	Bw2	Body weight QTL2	4.2		retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	4	9940885	44463908	Rat
8694374	Bw155	Body weight QTL 155	3.39	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	4	10084089	55084089	Rat
2303168	Bp330	Blood pressure QTL 330	4.25	0.017	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	5214602	146446691	Rat
9589046	Scfw2	Subcutaneous fat weight QTL 2	5.54	0.001	subcutaneous adipose mass (VT:1000472)	abdominal subcutaneous fat pad weight (CMO:0002069)	4	1	31934116	Rat
6478724	Anxrr35	Anxiety related response QTL 35		0.00449	defecation behavior trait (VT:0010462)	defecation measurement (CMO:0000997)	4	10084089	55084089	Rat
61351	Bp33	Blood pressure QTL 33		0.0018	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	1	27716890	Rat
61415	Eae11	Experimental allergic encephalomyelitis QTL 11	2.9		nervous system integrity trait (VT:0010566)	post-insult time to onset of experimental autoimmune encephalomyelitis (CMO:0001422)	4	1	39505420	Rat
1641905	Colcr1	Colorectal carcinoma resistance QTL 1	4.3	0.0003	intestine integrity trait (VT:0010554)	benign colorectal tumor surface area measurement (CMO:0001799)	4	1	29494328	Rat
619616	Bp79	Blood pressure QTL 79		0.0292	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	5214602	78882945	Rat
1358201	Gluco12	Glucose level QTL12	1.6		adipocyte glucose uptake trait (VT:0004185)	adipocyte maximal glucose uptake (CMO:0000870)	4	5218392	29593287	Rat
738021	Hcar13	Hepatocarcinoma resistance QTL 13	4.3		liver integrity trait (VT:0010547)	liver nonremodeling tumorous lesion volume to total liver volume ratio (CMO:0001464)	4	1	32584199	Rat
1358203	Stl19	Serum triglyceride level QTL 19	2.8	0.002	blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	4	5218294	65958103	Rat
9590304	Scort17	Serum corticosterone level QTL 17	4.96	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	10084089	55084089	Rat
9589097	Slep11	Serum leptin concentration QTL 11	5.09	0.001	blood leptin amount (VT:0005667)	plasma leptin level (CMO:0000781)	4	1	31934116	Rat
2316958	Gluco58	Glucose level QTL 58	10		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	11320076	180699135	Rat
1300141	Bp178	Blood pressure QTL 178			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	10024901	39524530	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
1	2	23	74	25	21	9	8	9	2	57	39	64	6	41	12

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_030840	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017592917	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC141152	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF315652	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AJ303372	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AJ428404	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474020	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000004	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000015733 ⟹ ENSRNOP00000015733

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	4	13,210,260 - 13,249,289 (+)	Ensembl
Rnor_6.0 Ensembl	4	9,821,541 - 9,860,571 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000114029 ⟹ ENSRNOP00000085244

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	4	13,210,260 - 13,249,289 (+)	Ensembl

RefSeq Acc Id:

NM_030840 ⟹ NP_110467

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	14,102,492 - 14,141,520 (+)	NCBI
mRatBN7.2	4	13,210,260 - 13,249,289 (+)	NCBI
Rnor_6.0	4	9,821,541 - 9,860,571 (+)	NCBI
Rnor_5.0	4	9,822,682 - 9,861,708 (+)	NCBI
RGSC_v3.4	4	8,657,314 - 8,697,539 (+)	RGD
Celera	4	8,801,513 - 8,840,481 (+)	RGD

Sequence:

show sequence

ATGGATCATGCTGAAGAAAATGAAATTCCTGCAGAGACTCAGAAGTACCTCGTGGAAAGGCCTA
TCTTCAGTCATCCGGTCCTCCAGGAGAGGCTGCACGTCAAGGACAAAGTCACAGACTCCATCGG
GGATAAGCTGAAGCAGGCATTCACGTGCACTCCTAAAAAAGTAAGAAACATCATCTACATGTTC
TTGCCCATCACTAAGTGGTTGCCAGCATATAAATTCAAGGAGTATGTGCTGGGTGACTTGGTCT
CGGGCATAAGCACTGGGGTGCTTCAGCTCCCCCAAGGCTTAGCCTTCGCGATGCTGGCAGCTGT
GCCTCCGGTGTTCGGCCTGTACTCCTCATTTTACCCCGTTATCATGTACTGTTTCTTTGGAACC
TCCAGACACATATCTATAGGTCCTTTTGCGGTTATTAGCTTGATGATTGGAGGTGTGGCTGTCC
GCTTGGTACCGGATGACATCGTTATCCCAGGAGGAGTAAATGCAACCAATGGGACGGAAGCCAG
AGATGCGTTAAGGGTCAAAGTCGCCATGTCCGTTACCCTACTTTCAGGAATCATTCAGTTTTGC
CTAGGTGTCTGTAGGTTTGGATTTGTGGCCATATACCTCACGGAGCCGCTAGTGCGAGGCTTTA
CCACGGCGGCGGCTGTGCACGTGTTCACCTCCATGTTAAAATACCTGTTTGGGGTCAAAACTAA
GCGGTACAGTGGGATCTTCTCAGTGGTGTATAGTACCGTGGCTGTGCTGCAGAATGTTAAAAAC
CTCAACGTGTGTTCCCTAGGCGTCGGCCTCATGGTTTTTGGTTTGCTGTTGGGTGGCAAGGAGT
TTAATGAGAGATTTAAAGAGAAACTGCCAGCGCCCATTCCTCTAGAGTTCTTTGCTGTGGTGAT
GGGGACCGGCATTTCTGCAGGGTTTAACTTGCACGAGTCCTACAGCGTGGATGTCGTTGGGACA
CTTCCTCTGGGACTACTCCCACCCGCCAACCCGGACACCAGCCTGTTCCACCTCGTGTACGTGG
ACGCCATTGCCATCGCCATTGTTGGGTTTTCAGTGACGATCTCCATGGCCAAAACCTTGGCAAA
TAAGCATGGCTACCAGGTTGATGGCAACCAGGAGCTCATTGCCTTGGGAATATGCAACTCCATC
GGATCTCTCTTCCAGACCTTCTCAATCTCTTGCTCCTTGTCTCGAAGCCTTGTTCAGGAAGGAA
CTGGAGGGAAGACACAGCTTGCAGGTTGCTTGGCCTCACTGATGATCCTGCTGGTCATATTAGC
CACTGGATTCCTCTTTGAGTCATTACCCCAGGCCGTGCTTTCCGCCATTGTGATTGTCAACCTG
AAAGGAATGTTCATGCAGTTCTCAGACCTGCCCTTTTTCTGGAGAACCAGCAAAATCGAGTTGA
CCATCTGGCTCACCACCTTTGTGTCCTCCCTGTTCCTGGGCTTGGACTATGGACTGATTACTGC
TGTGATCATTGCTCTGCTCACTGTGATTTACAGAACACAGAGTCCGAGCTACACAGTCCTGGGA
CAGCTCCCTGACACCGATGTATACATTGACATTGATGCCTATGAGGAGGTGAAAGAAATTCCTG
GAATAAAAATATTCCAAATAAATGCCCCAATTTACTATGCAAATAGCGACTTGTACAGCAGCGC
ACTGAAAAGAAAGACTGGCGTGAACCCAGCAATCATCATGGGAGCAAGAAGAAAGGCCATGAGG
AAGTACGCGAAGGAGGTTGGAAATGCCAACATAGCTAACGCGACTGTTGTCAAAGTGGATGCAG
AAGTAGATGGAGAAAATGCTACGAAGCCTGAAGAAGAGGACGACGAAGTCAAATTTCCCCCAAT
AGTCATCAAAACAACATTTCCTGAAGAGCTGCAGAGGTTTTTGCCCCAGGGGGAAAATATCCAC
ACTGTCATTCTAGACTTCACGCAGGTCAATTTTATGGATTCTGTTGGAGTGAAAACTCTGGCTG
GGATTGTGAAAGAGTACGGCGATGTTGGAATTTATGTGTACTTAGCAGGATGCAGTGCACAAGT
TGTGAATGACCTCACCAGCAACCGTTTTTTTGAAAATCCTGCCTTAAAGGAGCTTCTGTTCCAC
AGTATCCATGACGCGGTCTTGGGCAGCCAAGTCCGTGAGGCGATGGCTGAGCAAGAAACCACGG
TTCTGCCTCCCCAGGAAGATATGGAGCCCAATGCCACGCCCACCACACCGGAAGCATAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_110467	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAG30297	(Get FASTA)	NCBI Sequence Viewer
	CAC21555	(Get FASTA)	NCBI Sequence Viewer
	CAD21439	(Get FASTA)	NCBI Sequence Viewer
	EDL99408	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000015733
	ENSRNOP00000015733.2
	ENSRNOP00000085244.1
GenBank Protein	Q9EPH0	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_110467 ⟸ NM_030840

- UniProtKB:

Q9ERC6 (UniProtKB/Swiss-Prot), Q9EPH0 (UniProtKB/Swiss-Prot), A0A8I6A1V5 (UniProtKB/TrEMBL), A6K5A0 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MDHAEENEIPAETQKYLVERPIFSHPVLQERLHVKDKVTDSIGDKLKQAFTCTPKKVRNIIYMF
LPITKWLPAYKFKEYVLGDLVSGISTGVLQLPQGLAFAMLAAVPPVFGLYSSFYPVIMYCFFGT
SRHISIGPFAVISLMIGGVAVRLVPDDIVIPGGVNATNGTEARDALRVKVAMSVTLLSGIIQFC
LGVCRFGFVAIYLTEPLVRGFTTAAAVHVFTSMLKYLFGVKTKRYSGIFSVVYSTVAVLQNVKN
LNVCSLGVGLMVFGLLLGGKEFNERFKEKLPAPIPLEFFAVVMGTGISAGFNLHESYSVDVVGT
LPLGLLPPANPDTSLFHLVYVDAIAIAIVGFSVTISMAKTLANKHGYQVDGNQELIALGICNSI
GSLFQTFSISCSLSRSLVQEGTGGKTQLAGCLASLMILLVILATGFLFESLPQAVLSAIVIVNL
KGMFMQFSDLPFFWRTSKIELTIWLTTFVSSLFLGLDYGLITAVIIALLTVIYRTQSPSYTVLG
QLPDTDVYIDIDAYEEVKEIPGIKIFQINAPIYYANSDLYSSALKRKTGVNPAIIMGARRKAMR
KYAKEVGNANIANATVVKVDAEVDGENATKPEEEDDEVKFPPIVIKTTFPEELQRFLPQGENIH
TVILDFTQVNFMDSVGVKTLAGIVKEYGDVGIYVYLAGCSAQVVNDLTSNRFFENPALKELLFH
SIHDAVLGSQVREAMAEQETTVLPPQEDMEPNATPTTPEA

hide sequence

Ensembl Acc Id:

ENSRNOP00000015733 ⟸ ENSRNOT00000015733

Ensembl Acc Id:

ENSRNOP00000085244 ⟸ ENSRNOT00000114029

Protein Domains

STAS

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q9EPH0-F1-model_v2	AlphaFold	Q9EPH0	1-744	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:69334	AgrOrtholog
BioCyc Gene	G2FUF-45989	BioCyc
Ensembl Genes	ENSRNOG00000011616	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000015733	ENTREZGENE
	ENSRNOT00000015733.3	UniProtKB/Swiss-Prot
	ENSRNOT00000114029.1	UniProtKB/TrEMBL
Gene3D-CATH	3.30.750.24	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	S04_transporter_CS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SLC26A/SulP_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SLC26A/SulP_fam	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	STAS_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	STAS_dom_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:83819	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
NCBI Gene	Slc26a5	ENTREZGENE
PANTHER	PTHR11814	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	STAS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Sulfate_transp	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Slc26a5	PhenoGen
PROSITE	SLC26A	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	STAS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000011616	RatGTEx
Superfamily-SCOP	SSF52091	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
TIGR	TC226893
UniProt	A0A8I6A1V5	ENTREZGENE, UniProtKB/TrEMBL
	A6K5A0	ENTREZGENE, UniProtKB/TrEMBL
	Q9EPH0	ENTREZGENE
	Q9ERC6	ENTREZGENE
	S26A5_RAT	UniProtKB/Swiss-Prot
UniProt Secondary	Q9ERC6	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-03-09	Slc26a5	solute carrier family 26 member 5	Slc26a5	solute carrier family 26 (anion exchanger), member 5	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2013-08-02	Slc26a5	solute carrier family 26 (anion exchanger), member 5	Slc26a5	solute carrier family 26, member 5 (prestin)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-09-19	Slc26a5	solute carrier family 26, member 5 (prestin)	Slc26a5	solute carrier family 26, member 5	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-30	Slc26a5	solute carrier family 26, member 5	Pres	prestin (motor protein)	Symbol and Name updated	1299863	APPROVED
2002-06-10	Pres	prestin (motor protein)			Name updated	70584	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_cellular_localization	localizes to the lateral membrane before the onset of hearing but was localized to the entire OHC membrane in hypothyroid rats	70328
gene_domains	contains a TRE (thyroid hormone response element) in the second intron upstream of the ATG start site, which binds thyroid hormone receptors	68832
gene_domains	contains a TRE (thyroid hormone response element) in the second intron upstream of the ATG start site, which binds thyroid hormone receptors	70328
gene_expression	expressed in the apical cell pole of cochlear outer hair cells	68832
gene_expression	expressed in the apical cell pole of cochlear outer hair cells	70328
gene_function	cochlear motor protein	68832
gene_function	cochlear motor protein	70328
gene_regulation	transcription is stimulated by thyroid hormone	68832
gene_regulation	transcription is stimulated by thyroid hormone	70328

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM