Wfs1 (wolframin ER transmembrane glycoprotein)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Wfs1 (wolframin ER transmembrane glycoprotein) Rattus norvegicus

Analyze

Symbol:

Wfs1

Name:

wolframin ER transmembrane glycoprotein

RGD ID:

68954

Description:

Enables several functions, including calcium-dependent protein binding activity; calmodulin binding activity; and proteasome binding activity. Involved in several processes, including negative regulation of ATF6-mediated unfolded protein response; protein stabilization; and regulation of DNA-templated transcription. Is active in synaptic vesicle membrane. Used to study cataract; diabetes mellitus; and glucose intolerance. Biomarker of post-traumatic stress disorder and visual epilepsy. Human ortholog(s) of this gene implicated in Wolfram syndrome (multiple); auditory system disease (multiple); cataract 41; diabetes mellitus (multiple); and optic atrophy (multiple). Orthologous to human WFS1 (wolframin ER transmembrane glycoprotein); PARTICIPATES IN Endoplasmic Reticulum-associated degradation pathway; INTERACTS WITH 2,2',4,4'-Tetrabromodiphenyl ether; 6-propyl-2-thiouracil; aconitine.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

Wolfram syndrome 1; Wolfram syndrome 1 (wolframin); Wolfram syndrome 1 homolog; Wolfram syndrome 1 homolog (human); wolframin

RGD Orthologs

Human

Mouse

Chinchilla

Bonobo

Dog

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

Allele / Splice:

Wfs1^em1Ptsn Wfs1^em2Ptsn Wfs1^em3Ptsn

Genetic Models:

SD-Wfs1^em1Ptsn SD-Wfs1^em2Ptsn SD-Wfs1^em3Ptsn

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	14	73,810,478 - 73,834,993 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	14	73,810,404 - 73,835,602 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	14	78,251,934 - 78,276,445 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	14	79,492,790 - 79,517,297 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	14	75,937,753 - 75,962,260 (+)	NCBI	Rnor_WKY
Rnor_6.0	14	78,640,707 - 78,665,224 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	14	78,640,620 - 78,665,966 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	14	78,606,172 - 78,630,689 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	14	79,379,680 - 79,404,003 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	14	79,389,637 - 79,406,394 (+)	NCBI
Celera	14	72,756,725 - 72,781,236 (+)	NCBI		Celera
Cytogenetic Map	14	q21	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

autistic disorder (ISO)

autosomal dominant nonsyndromic deafness 6 (ISO)

autosomal dominant Wolfram syndrome (ISO)

cataract (IMP,ISO)

cataract 41 (ISO)

Dandy-Walker syndrome (ISO)

diabetes mellitus (IMP,ISO)

genetic disease (ISO)

glucose intolerance (IMP)

Headache (ISO)

Hearing Loss (ISO)

maturity-onset diabetes of the young type 1 (ISO)

nonsyndromic deafness (ISO)

Nonsyndromic Sensorineural Hearing Loss (ISO)

optic atrophy (ISO)

optic atrophy 1 (ISO)

post-traumatic stress disorder (IEP)

sensorineural hearing loss (ISO)

spastic ataxia (ISO)

tooth and nail syndrome (ISO)

type 1 diabetes mellitus (ISO)

type 2 diabetes mellitus (ISO)

visual epilepsy (IEP)

Wolfram syndrome (ISO)

Wolfram syndrome 1 (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (ISO)

17beta-hydroxy-5alpha-androstan-3-one (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (EXP,ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2-methylcholine (ISO)

3,4-methylenedioxymethamphetamine (ISO)

4,4'-sulfonyldiphenol (ISO)

6-propyl-2-thiouracil (EXP)

aconitine (EXP)

afimoxifene (ISO)

aflatoxin B1 (ISO)

Aflatoxin B2 alpha (ISO)

ammonium chloride (EXP)

aristolochic acid A (ISO)

benzo[a]pyrene (ISO)

beta-naphthoflavone (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

caffeine (ISO)

carbon nanotube (ISO)

CGP 52608 (ISO)

chromium(6+) (ISO)

cisplatin (ISO)

clobetasol (ISO)

copper(II) sulfate (ISO)

coumarin (ISO)

Cuprizon (EXP)

cyclosporin A (ISO)

decabromodiphenyl ether (EXP)

dexamethasone (ISO)

dibutyl phthalate (EXP)

dicrotophos (ISO)

endosulfan (EXP)

ethanol (ISO)

fluoxetine (EXP)

folic acid (ISO)

fulvestrant (ISO)

ivermectin (ISO)

kainic acid (ISO)

ketamine (EXP)

lead(0) (ISO)

lead(2+) (ISO)

methidathion (ISO)

N,N-diethyl-m-toluamide (EXP)

nitrofen (EXP)

ozone (EXP)

paracetamol (EXP,ISO)

perfluorooctanoic acid (ISO)

permethrin (EXP)

pirinixic acid (ISO)

potassium dichromate (ISO)

propanal (ISO)

resveratrol (ISO)

silicon dioxide (ISO)

tetrachloromethane (ISO)

thapsigargin (ISO)

tolcapone (EXP)

tunicamycin (ISO)

valproic acid (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

calcium ion homeostasis (IBA,ISO)

endoplasmic reticulum calcium ion homeostasis (ISO)

endoplasmic reticulum unfolded protein response (IBA,ISO)

glucose homeostasis (ISO)

kidney development (ISO)

negative regulation of apoptotic process (ISO)

negative regulation of ATF6-mediated unfolded protein response (IGI,ISO)

negative regulation of DNA-binding transcription factor activity (IGI,ISO)

negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway (ISO)

negative regulation of neuron apoptotic process (ISO)

negative regulation of programmed cell death (ISO)

negative regulation of response to endoplasmic reticulum stress (ISO)

negative regulation of transcription by RNA polymerase II (IMP,ISO)

negative regulation of translation (ISO)

negative regulation of type B pancreatic cell apoptotic process (ISO)

nervous system process (ISO)

olfactory behavior (IEP)

pancreas development (IEP)

positive regulation of calcium ion transport (ISO)

positive regulation of ERAD pathway (ISO)

positive regulation of growth (ISO)

positive regulation of protein metabolic process (ISO)

positive regulation of protein ubiquitination (ISO)

protein stabilization (IMP,ISO)

renal water homeostasis (ISO)

response to endoplasmic reticulum stress (ISO)

sensory perception of sound (ISO)

ubiquitin-dependent ERAD pathway (ISO)

visual perception (ISO)

Cellular Component

endoplasmic reticulum (ISO)

endoplasmic reticulum membrane (ISO)

secretory granule (ISO)

synaptic vesicle membrane (EXP,IDA)

Molecular Function

ATPase binding (ISO)

calcium-dependent protein binding (IMP)

calmodulin binding (IMP)

DNA-binding transcription factor binding (IPI)

proteasome binding (IDA)

protein binding (ISO)

ubiquitin protein ligase binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

Endoplasmic Reticulum-associated degradation pathway (IEA)

Phenotype Annotations Click to see Annotation Detail View

Mammalian Phenotype

abnormal brainstem morphology (IMP)

decreased insulin secretion (IMP)

decreased pancreatic beta cell mass (IMP)

decreased pancreatic islet number (IMP)

hyperglycemia (IMP)

hypermyelination (IMP)

impaired glucose tolerance (IMP)

increased circulating glucose level (IMP)

increased endoplasmic reticulum stress (IMP)

increased urine glucose level (IMP)

optic nerve atrophy (IMP)

retina gliosis (IMP)

small pancreatic islets (IMP)

weight loss (IMP)

References

References - curated

#	Reference Title	Reference Citation
1.	Missense variations of the gene responsible for Wolfram syndrome (WFS1/wolframin) in Japanese: possible contribution of the Arg456His mutation to type 1 diabetes as a nonautoimmune genetic basis.	Awata T, etal., Biochem Biophys Res Commun. 2000 Feb 16;268(2):612-6.
2.	Mutations in the Wolfram syndrome 1 gene (WFS1) are a common cause of low frequency sensorineural hearing loss.	Bespalova IN, etal., Hum Mol Genet. 2001 Oct 15;10(22):2501-8.
3.	A WFS1 haplotype consisting of the minor alleles of rs752854, rs10010131, and rs734312 shows a protective role against type 2 diabetes in Russian patients.	Chistiakov DA, etal., Rev Diabet Stud. 2010 Winter;7(4):285-92. doi: 10.1900/RDS.2010.7.285. Epub 2011 Feb 10.
4.	The wolframin His611Arg polymorphism influences medication overuse headache.	Di Lorenzo C, etal., Neurosci Lett. 2007 Sep 13;424(3):179-84. Epub 2007 Aug 6.
5.	WFS1 mutations in Spanish patients with diabetes mellitus and deafness.	Domenech E, etal., Eur J Hum Genet. 2002 Jul;10(7):421-6.
6.	Testing of diabetes-associated WFS1 polymorphisms in the Diabetes Prevention Program.	Florez JC, etal., Diabetologia. 2008 Mar;51(3):451-7. Epub 2007 Dec 4.
7.	Wolfram syndrome 1 gene negatively regulates ER stress signaling in rodent and human cells.	Fonseca SG, etal., J Clin Invest. 2010 Mar;120(3):744-55. doi: 10.1172/JCI39678. Epub 2010 Feb 15.
8.	Replication of the association between variants in WFS1 and risk of type 2 diabetes in European populations.	Franks PW, etal., Diabetologia. 2008 Mar;51(3):458-63. Epub 2007 Nov 27.
9.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
10.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
11.	A gene encoding a transmembrane protein is mutated in patients with diabetes mellitus and optic atrophy (Wolfram syndrome).	Inoue H, etal., Nat Genet. 1998 Oct;20(2):143-8.
12.	Disruption of the WFS1 gene in mice causes progressive beta-cell loss and impaired stimulus-secretion coupling in insulin secretion.	Ishihara H, etal., Hum Mol Genet. 2004 Jun 1;13(11):1159-70. Epub 2004 Mar 31.
13.	WFS1 gene as a putative biomarker for development of post-traumatic syndrome in an animal model.	Kesner Y, etal., Mol Psychiatry. 2009 Jan;14(1):86-94. Epub 2007 Oct 30.
14.	Cat odour exposure increases the expression of wolframin gene in the amygdaloid area of rat.	Koks S, etal., Neurosci Lett. 2002 Apr 5;322(2):116-20.
15.	WFS1 variants in Finnish patients with diabetes mellitus, sensorineural hearing impairment or optic atrophy, and in suicide victims.	Kytovuori L, etal., J Hum Genet. 2013 Aug;58(8):495-500. doi: 10.1038/jhg.2013.29. Epub 2013 Apr 18.
16.	Evidence for linkage on chromosome 4p16.1 in Type 1 diabetes Danish families and complete mutation scanning of the WFS1 (Wolframin) gene.	Larsen ZM, etal., Diabet Med. 2004 Mar;21(3):218-22.
17.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
18.	Association studies of genetic variation in the WFS1 gene and type 2 diabetes in U.K. populations.	Minton JA, etal., Diabetes. 2002 Apr;51(4):1287-90.
19.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
20.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
21.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
22.	Wfs1- deficient rats develop primary symptoms of Wolfram syndrome: insulin-dependent diabetes, optic nerve atrophy and medullary degeneration.	Plaas M, etal., Sci Rep. 2017 Aug 31;7(1):10220. doi: 10.1038/s41598-017-09392-x.
23.	Identification of p.A684V missense mutation in the WFS1 gene as a frequent cause of autosomal dominant optic atrophy and hearing impairment.	Rendtorff ND, etal., Am J Med Genet A. 2011 Jun;155A(6):1298-313. doi: 10.1002/ajmg.a.33970. Epub 2011 Apr 28.
24.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
25.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
26.	Comprehensive gene review and curation	RGD comprehensive gene curation
27.	Molecular anatomy of a trafficking organelle.	Takamori S, etal., Cell. 2006 Nov 17;127(4):831-46.
28.	WFS1 (Wolfram syndrome 1) gene product: predominant subcellular localization to endoplasmic reticulum in cultured cells and neuronal expression in rat brain.	Takeda K, etal., Hum Mol Genet 2001 Mar 1;10(5):477-84.
29.	Tentative Sequence Identification Numbers	Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
30.	Preventive treatment with liraglutide protects against development of glucose intolerance in a rat model of Wolfram syndrome.	Toots M, etal., Sci Rep. 2018 Jul 5;8(1):10183. doi: 10.1038/s41598-018-28314-z.
31.	Expression and localization of Wolfram syndrome 1 gene in the developing rat pancreas.	Xu R, etal., World J Gastroenterol. 2009 Nov 21;15(43):5425-31.
32.	Identification and characterization of wolframin, the product of the wolfram syndrome gene (WFS1), as a novel calmodulin-binding protein.	Yurimoto S, etal., Biochemistry. 2009 May 12;48(18):3946-55. doi: 10.1021/bi900260y.
33.	The microtubule interacting drug candidate NAP protects against kainic acid toxicity in a rat model of epilepsy.	Zemlyak I, etal., J Neurochem. 2009 Dec;111(5):1252-63. doi: 10.1111/j.1471-4159.2009.06415.x. Epub 2009 Oct 3.

Additional References at PubMed

PMID:9817917	PMID:14527944	PMID:15994758	PMID:16087305	PMID:16571599	PMID:16989814	PMID:17110338	PMID:17492394	PMID:17947299	PMID:19293327	PMID:19911006	PMID:32632005
PMID:34495404	PMID:34828323	PMID:36725880

Genomics

Comparative Map Data

Wfs1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	14	73,810,478 - 73,834,993 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	14	73,810,404 - 73,835,602 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	14	78,251,934 - 78,276,445 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	14	79,492,790 - 79,517,297 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	14	75,937,753 - 75,962,260 (+)	NCBI	Rnor_WKY
Rnor_6.0	14	78,640,707 - 78,665,224 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	14	78,640,620 - 78,665,966 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	14	78,606,172 - 78,630,689 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	14	79,379,680 - 79,404,003 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	14	79,389,637 - 79,406,394 (+)	NCBI
Celera	14	72,756,725 - 72,781,236 (+)	NCBI		Celera
Cytogenetic Map	14	q21	NCBI

WFS1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	4	6,269,850 - 6,303,265 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	4	6,269,849 - 6,303,265 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	4	6,271,577 - 6,304,992 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	4	6,322,478 - 6,355,893 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	4	6,389,648 - 6,423,064	NCBI
Celera	4	6,172,234 - 6,205,670 (+)	NCBI		Celera
Cytogenetic Map	4	p16.1	NCBI
HuRef	4	6,205,316 - 6,238,436 (+)	NCBI		HuRef
CHM1_1	4	6,269,525 - 6,302,942 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	4	6,243,866 - 6,277,297 (+)	NCBI		T2T-CHM13v2.0

Wfs1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	5	37,123,448 - 37,146,326 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	5	37,123,448 - 37,146,549 (-)	Ensembl		GRCm39 Ensembl
GRCm38	5	36,966,104 - 36,988,982 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	5	36,966,104 - 36,989,205 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	5	37,357,343 - 37,380,221 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	5	37,254,356 - 37,277,158 (-)	NCBI		MGSCv36	mm8
Celera	5	34,417,849 - 34,440,871 (-)	NCBI		Celera
Cytogenetic Map	5	B3	NCBI

Wfs1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955514	3,902,454 - 3,924,610 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955514	3,902,508 - 3,924,281 (-)	NCBI	ChiLan1.0	ChiLan1.0

WFS1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	4	6,470,175 - 6,503,684 (+)	NCBI		NHGRI_mPanPan1
PanPan1.1	4	6,345,960 - 6,379,094 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	4	6,345,864 - 6,379,287 (+)	Ensembl	panpan1.1		panPan2

WFS1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	13	38,451,722 - 38,466,481 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	13	38,451,710 - 38,475,827 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	13	38,428,703 - 38,449,916 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	13	38,942,257 - 38,963,449 (-)	NCBI		ROS_Cfam_1.0
UMICH_Zoey_3.1	13	38,633,035 - 38,659,609 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	13	38,742,939 - 38,764,184 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	13	39,217,791 - 39,239,032 (-)	NCBI		UU_Cfam_GSD_1.0

Wfs1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405285	64,638,197 - 64,663,281 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936477	18,339,827 - 18,364,998 (+)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936477	18,339,915 - 18,364,973 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

WFS1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	8	4,362,680 - 4,385,273 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	8	4,362,678 - 4,405,185 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	8	2,954,118 - 2,962,286 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

WFS1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	27	42,404,028 - 42,437,988 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	27	42,404,084 - 42,438,005 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666047	89,197,417 - 89,231,280 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Wfs1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624755	22,824,143 - 22,841,850 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624755	22,818,653 - 22,841,717 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Wfs1
160 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	85
Count of miRNA genes:	81
Interacting mature miRNAs:	85
Transcripts:	ENSRNOT00000034730
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
631839	Niddm37	Non-insulin dependent diabetes mellitus QTL 37	3.37		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	14	11030622	95876975	Rat
70187	Pancm5	Pancreatic morphology QTL 5	16.7		pancreas mass (VT:0010144)	pancreas weight to body weight ratio (CMO:0000630)	14	30320092	80829842	Rat
2313048	Bss84	Bone structure and strength QTL 84	3.1	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	14	37669719	82669719	Rat
2313084	Bss83	Bone structure and strength QTL 83	2.9	0.0001	tibia size trait (VT:0100001)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	14	37669719	82669719	Rat
2313089	Bss81	Bone structure and strength QTL 81	3.4	0.0001	body length (VT:0001256)	body length, nose to rump (CMO:0000079)	14	37669719	82669719	Rat
2313100	Bss82	Bone structure and strength QTL 82	3	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	14	37669719	82669719	Rat
738037	Hcas6	Hepatocarcinoma susceptibility QTL 6	2.93		liver integrity trait (VT:0010547)	liver nonremodeling tumorous lesion volume to total liver volume ratio (CMO:0001464)	14	39057237	83368335	Rat
70214	Niddm28	Non-insulin dependent diabetes mellitus QTL 28	4.06		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	14	39998251	75582726	Rat
631523	Pia13	Pristane induced arthritis QTL 13	3.3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	14	40793460	98037301	Rat
1300136	Rf22	Renal function QTL 22	3.9		renal blood flow trait (VT:2000006)	absolute change in renal vascular resistance (CMO:0001900)	14	42262529	95023211	Rat
1549834	Scl45	Serum cholesterol level QTL 45	5.8		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	14	50023211	95023211	Rat
2300197	Scl59	Serum cholesterol level QTL 59			blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	14	55147478	100147478	Rat
9590294	Uminl4	Urine mineral level QTL 4	5.66	0.001	urine mineral amount (VT:0015086)	urine electrolyte level (CMO:0000593)	14	55624247	100624247	Rat
9589034	Epfw11	Epididymal fat weight QTL 11	6	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	14	55624247	100624247	Rat
2317879	Alcrsp27	Alcohol response QTL 27	3.3	0.63	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	14	56631369	101631369	Rat
634328	Hc5	Hypercalciuria QTL 5	2.3		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	14	58184885	103184885	Rat
70153	Bp59	Blood pressure QTL 59	3.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	14	68757796	83368335	Rat
1582259	Gluco23	Glucose level QTL 23	3.1	0.0008	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	14	70053989	104886043	Rat
1641900	Alcrsp11	Alcohol response QTL 11			alcohol metabolism trait (VT:0015089)	blood ethanol level (CMO:0000535)	14	70053989	104886043	Rat
1582197	Gluco27	Glucose level QTL 27	3.4	0.0006	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	14	73415323	92554092	Rat
1582209	Gluco20	Glucose level QTL 20	3.8	0.0005	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	14	73415323	92554092	Rat
1582236	Gluco22	Glucose level QTL 22	3.3	0.0164	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	14	73415323	92554092	Rat
1582255	Gluco29	Glucose level QTL 29	3.1	0.0025	blood glucose amount (VT:0000188)	absolute change in blood glucose level area under curve (CMO:0002034)	14	73415323	92554092	Rat
1582250	Gluco26	Glucose level QTL 26	3.3	0.0009	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	14	73415323	95876975	Rat

Genetic Models

This gene Wfs1 is modified in the following models/strains

SD-Wfs1^em1Ptsn

SD-Wfs1^em2Ptsn

SD-Wfs1^em3Ptsn

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium		35	7	2		2		3	31	27	29	1
Low	3	8	50	39	19	39	8	8	43	8	12	10	8
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_031823	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF136378	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473963	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000254	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSRNOT00000034730 ⟹ ENSRNOP00000032218

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	14	73,810,404 - 73,835,602 (+)	Ensembl
Rnor_6.0 Ensembl	14	78,640,620 - 78,665,966 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000109032 ⟹ ENSRNOP00000087329

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	14	73,810,413 - 73,835,364 (+)	Ensembl

RefSeq Acc Id:

NM_031823 ⟹ NP_114011

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	14	73,810,478 - 73,834,993 (+)	NCBI
Rnor_6.0	14	78,640,707 - 78,665,224 (+)	NCBI
Rnor_5.0	14	78,606,172 - 78,630,689 (+)	NCBI
RGSC_v3.4	14	79,379,680 - 79,404,003 (+)	RGD
Celera	14	72,756,725 - 72,781,236 (+)	RGD

Sequence:

show sequence

GCACTGCGGCCGGCAAGATGAGCTCAGGCACCCCACCTCCGAGCCCCTCTGGCCCACCTCCTCC
ACCCGCACCACAGCCCCAGGCCCGGGCCCGGCTCAATGCCACCACCTCACTGGAGCAGGACAAG
ATTGAACCGCCTCGTGCTCCTAGACCTCAGCCTGACTCCAGTGCTGGACGAAGTGCTGGGGAAG
CAACCACGCCGGAGCCTCGGGCCCCTCACGCCAGCAGCCGAGAAGGGACAGATAAAGCTGGTCC
CATGAAGGCAGATGTGGAGATCCCCTTTGAAGAAATCCTGGAGAAGGCCAAGGCTGGAGACCCC
AAAGCACAGACAGAGGTGGGCAAACACTACCTGCGACTTGCCAATGATGCAGATGAAGAGCTCA
ACAGCTGCTCGGCTGTGGCCTGGCTAATCCTGGCGGCCAAGCAGGGCAGGCGGGAGGCCGTGAA
GCTGCTGAGGCGGTGCCTAGCTGACCGGAAAGGCATCACTTCTGAGAATGAGGCCGAGGTGAAG
CAGCTATCCTCTGAGACCGACCTGGAAAGGGCAGTGCGCAAGGCTGCCCTGGTCATGTACTGGA
AACTCAACCCCAAGAAAAAGAAGCAGGTGGCTGTGTCTGAGCTGCTGGAGAATGTCGGGCAGGT
CAACGAACAGGATGGAGGGGCGCAGCCAGGCCCCGTCCCCAAGTCCCTGCAGAAGCAGAGGCGC
ATGCTGGAGCGTCTAGTGAGCAGTGAATCCAAGAACTACATTGCTCTGGACGATTTTGTGGAGC
TCACCAAGAAGTATGCCAAGGGCATCATCCCCAACAACCTGTTCCTGCAGGATGAGGATGAAGA
TGAAGACGAGCTGTCAGGGAAGAGCCCCGAGGACCTGCCACTACGCCAGAAGGTGGTGAAGTAC
CCCTTACACGCCATCATGGAGATCAAAGAGTACCTGATTGACGTGGCCTCCAAGGCAGGCATGC
ACTGGCTCTCCACCATCGTGCCCACCCATCACATCAACGCCCTCATCTTCTTCTTCATCATCAG
CAACCTAACCATCGACTTCTTCGCCTTCTTCATCCCCCTGGTGGTCTTCTACCTGTCCTTCGTG
TCCATGGTCATCTGCACCCTCAAAGTGTTCCAGGACAGCAAGGCCTGGGAGAACTTCCGCACTC
TCACCGACCTGCTGCTGCGCTTCGAGCCCAACCTAGATGTGGAGCAGGCGGAAGTGAACTTCGG
CTGGAACCACCTGGAGCCTTACATCCACTTCCTGCTGTCAGTCGTCTTCGTGATCTTCTCCTTC
CCGCTGGCCAGCAAGGACTGCATCCCGTGCTCCGAGCTCGCTGTCGTCTCCGCCTTCTTCACGG
TGACGAGCTACATGAGTCTGAGCAGCTCCGCCGAGCCCTACACCAGGCGGGCCCTGGTCACTGA
GGTGGCTGCTGGGCTGCTGTCCCTTCTGCCCACCATGCCCGTGGACTGGCCCTTCCTGAAAGCA
CTCGGCCAGACGTTCTTCACCGTGCCCATCGGCCACTTCATCATCCTCAACGTCAGCCTCCCCT
GCCTGCTCTATGTCTATCTCTTTTACCTCTTCTTCCGCATGGCCCAGCTGAGGAACTTCAAGGG
CACCTACTGCTACCTGGTGCCCTACCTGGTGTGCTTCATGTGGTGTGAACTGTCCGTGGTCATC
CTGCTCCAGTCCACCGGCCTGGGCTTGGTCCGTGCCTCCATCGGCTACTTCCTCTTCCTCTTTG
CCCTCCCCATCCTGGTGGCTGGCCTTGCCCTCATGGGCACCGTGCAGTTTGCCCGATGGTTCCT
GTCACTGGACCTCACCAAGATCATGGTCACCACAGTGATCTGCAGCGTGCCCCTGCTTTTCCGC
TGGTGGACCAAGGCCAACTTTTCGGTGGTGGGAATGGTCAAGTCCCTGACTCGGAGCTCCATAG
TGAAGCTCATTCTGGTGTGGCTCACGGCCATCCTGCTCTTTTGCTGGTTCTACGTGTACCGGTC
GGAAGGCATGAAGGTCTACAATTCCACACTCACCTGGCAGCAATATGGCTTCCTGTGTGGGCCA
CGGGCCTGGAAGGAGACTAACATGGCCCGGACCCAGATCCTGTGCAGCCACCTGGAGGGCCACA
GGGTCACGTGGACAGGCCGCTTCAAGTATGTCCGAGTGACCGAGATCGACAACAGCGCCGAGTC
GGCCATCAACATGCTCCCGTTCTTCCTGGGTGACTGGATGCGCTGCCTGTACGGTGAGGCCTAC
CCATCCTGTAGCTCTGGTAACACGTCCACGGCTGAGGAGGAGCTCTGCCGTCTCAAGCAGCTGG
CCAAGCACCCCTGCCACATCAAGAAGTTTGACCGCTACAAGTTTGAGATCACAGTGGGCATGCC
CTTCGGCACCAACGGCAACCGCGGCCACGAAGAAGACGACATCACCAAGGACATCGTCCTGCGA
GCCAGCAGCGAGTTCAAGGACGTGCTGCTGAACCTGCGTCAGGGCAGCCTCATAGAGTTCAGCA
CCATCCTCGAGGGCCGCCTGGGTAGCAAGTGGCCCGTCTTCGAGCTCAAGGCCATCAGCTGCCT
CAATTGCATGACACAGCTGTCCCCTGCCCGGAGGCACGTAAAGATCGAACAGGACTGGCGTAGC
ACGGTGCACGGTGCCCTCAAGTTCGCCTTCGACTTCTTCTTCTTCCCATTCCTGTCTGCCGCCT
GAGGAGTGTCTGCCACTGGAGGACGCCTCGGTGCATGTTGCTGTGAGGTCCTTC

hide sequence

Protein Sequences


Protein RefSeqs	NP_114011	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAF61423	(Get FASTA)	NCBI Sequence Viewer
	EDM00031	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:

NP_114011 ⟸ NM_031823

- UniProtKB:

Q9JLT5 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MSSGTPPPSPSGPPPPPAPQPQARARLNATTSLEQDKIEPPRAPRPQPDSSAGRSAGEATTPEP
RAPHASSREGTDKAGPMKADVEIPFEEILEKAKAGDPKAQTEVGKHYLRLANDADEELNSCSAV
AWLILAAKQGRREAVKLLRRCLADRKGITSENEAEVKQLSSETDLERAVRKAALVMYWKLNPKK
KKQVAVSELLENVGQVNEQDGGAQPGPVPKSLQKQRRMLERLVSSESKNYIALDDFVELTKKYA
KGIIPNNLFLQDEDEDEDELSGKSPEDLPLRQKVVKYPLHAIMEIKEYLIDVASKAGMHWLSTI
VPTHHINALIFFFIISNLTIDFFAFFIPLVVFYLSFVSMVICTLKVFQDSKAWENFRTLTDLLL
RFEPNLDVEQAEVNFGWNHLEPYIHFLLSVVFVIFSFPLASKDCIPCSELAVVSAFFTVTSYMS
LSSSAEPYTRRALVTEVAAGLLSLLPTMPVDWPFLKALGQTFFTVPIGHFIILNVSLPCLLYVY
LFYLFFRMAQLRNFKGTYCYLVPYLVCFMWCELSVVILLQSTGLGLVRASIGYFLFLFALPILV
AGLALMGTVQFARWFLSLDLTKIMVTTVICSVPLLFRWWTKANFSVVGMVKSLTRSSIVKLILV
WLTAILLFCWFYVYRSEGMKVYNSTLTWQQYGFLCGPRAWKETNMARTQILCSHLEGHRVTWTG
RFKYVRVTEIDNSAESAINMLPFFLGDWMRCLYGEAYPSCSSGNTSTAEEELCRLKQLAKHPCH
IKKFDRYKFEITVGMPFGTNGNRGHEEDDITKDIVLRASSEFKDVLLNLRQGSLIEFSTILEGR
LGSKWPVFELKAISCLNCMTQLSPARRHVKIEQDWRSTVHGALKFAFDFFFFPFLSAA

hide sequence

RefSeq Acc Id:

ENSRNOP00000032218 ⟸ ENSRNOT00000034730

RefSeq Acc Id:

ENSRNOP00000087329 ⟸ ENSRNOT00000109032

Protein Domains

Wolframin cysteine-rich Wolframin EF-hand Wolframin OB-fold

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-E9PT53-F1-model_v2	AlphaFold	E9PT53	1-890	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13699375

Promoter ID:

EPDNEW_R9900

Type:

initiation region

Name:

Wfs1_1

Description:

wolframin ER transmembrane glycoprotein

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	14	78,640,642 - 78,640,702	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:68954	AgrOrtholog
BioCyc Gene	G2FUF-15350	BioCyc
Ensembl Genes	ENSRNOG00000005108	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000032218	ENTREZGENE
	ENSRNOP00000032218.3	UniProtKB/TrEMBL
	ENSRNOP00000087329.1	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000034730	ENTREZGENE
	ENSRNOT00000034730.5	UniProtKB/TrEMBL
	ENSRNOT00000109032.1	UniProtKB/TrEMBL
Gene3D-CATH	1.25.40.10	UniProtKB/TrEMBL
InterPro	TPR-like_helical_dom_sf	UniProtKB/TrEMBL
	Wolframin	UniProtKB/TrEMBL
	Wolframin_Cys-rich	UniProtKB/TrEMBL
	Wolframin_EF-hand	UniProtKB/TrEMBL
	Wolframin_fam	UniProtKB/TrEMBL
	Wolframin_OB_fold	UniProtKB/TrEMBL
	Wolframin_Sel1-like_rpt	UniProtKB/TrEMBL
KEGG Report	rno:83725	UniProtKB/TrEMBL
NCBI Gene	83725	ENTREZGENE
PANTHER	PTHR13098	UniProtKB/TrEMBL
	WOLFRAMIN	UniProtKB/TrEMBL
Pfam	WC-rich	UniProtKB/TrEMBL
	WCOB	UniProtKB/TrEMBL
	WEF-hand	UniProtKB/TrEMBL
	WSLR	UniProtKB/TrEMBL
PhenoGen	Wfs1	PhenoGen
PRINTS	WOLFFAMILY	UniProtKB/TrEMBL
	WOLFRAMIN	UniProtKB/TrEMBL
TIGR	TC230134
UniProt	A0A8I6A452_RAT	UniProtKB/TrEMBL
	E9PT53_RAT	UniProtKB/TrEMBL
	Q9JLT5	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-02-24	Wfs1	wolframin ER transmembrane glycoprotein	Wfs1	Wolfram syndrome 1 (wolframin)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2013-02-04	Wfs1	Wolfram syndrome 1 (wolframin)	Wfs1	Wolfram syndrome 1 homolog (human)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-30	Wfs1	Wolfram syndrome 1 homolog (human)		Wolfram syndrome 1	Name updated	1299863	APPROVED
2002-06-10	Wfs1	Wolfram syndrome 1			Symbol and Name status set to approved	70586	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_disease	associated with Wolfram (DIDMOAD) syndrome	62397
gene_expression	expressed in neurons in the hippocampus CA1, amygdaloid areas, olfactory tubercle and superficial layer of the allocortex	62397
gene_process	may function in emotional, behavioral and visceral control	62397
gene_process	may be involved in membrane trafficking, protein processing and/or regulation of ER calcium homeostasis	62397

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)

Mammalian Phenotype

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)

Mammalian Phenotype