Stmn2 (stathmin 2) - Rat Genome Database

Name: Stmn2
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Stmn2 (stathmin 2) Rattus norvegicus

Analyze

Symbol:

Stmn2

Name:

stathmin 2

RGD ID:

68947

Description:

Predicted to enable calcium-dependent protein binding activity and tubulin binding activity. Predicted to be involved in several processes, including cellular response to nerve growth factor stimulus; regulation of microtubule polymerization or depolymerization; and regulation of neuron projection development. Located in Golgi apparatus; growth cone; and vesicle. Orthologous to human STMN2 (stathmin 2); INTERACTS WITH 17alpha-ethynylestradiol; 17beta-estradiol 3-benzoate; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

MGC105372; SCG10; Scgn10; stathmin-2; stathmin-like 2; superior cervical ganglion-10 protein; superiorcervical ganglia neural specific 10; superiorcervical ganglia, neural specific 10

RGD Orthologs

Human

Mouse

Chinchilla

Bonobo

Dog

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	STMN2 (stathmin 2)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther
Mus musculus (house mouse):	Stmn2 (stathmin-like 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Stmn2 (stathmin 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	STMN2 (stathmin 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	STMN2 (stathmin 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Stmn2 (stathmin 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	STMN2 (stathmin 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	STMN2 (stathmin 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Stmn2 (stathmin 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	STMN3 (stathmin 3)	HGNC	OrthoDB
Alliance orthologs ³
Homo sapiens (human):	STMN2 (stathmin 2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Stmn2 (stathmin-like 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	stmn2b (stathmin 2b)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	stmn2a (stathmin 2a)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	stai	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector\|PANTHER)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	2	93,204,690 - 93,252,011 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	93,204,692 - 93,252,011 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	99,728,967 - 99,776,344 (-)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	2	97,849,998 - 97,897,381 (-)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	2	92,906,867 - 92,954,252 (-)	NCBI	Rnor_WKY
Rnor_6.0	2	95,424,251 - 95,471,900 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	95,424,251 - 95,472,115 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	115,167,504 - 115,215,213 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	95,284,903 - 95,332,686 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	2	95,229,866 - 95,277,648 (-)	NCBI
Celera	2	88,774,309 - 88,821,687 (-)	NCBI		Celera
Cytogenetic Map	2	q23	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

genetic disease (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dichloroethane (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (EXP,ISO)

17beta-estradiol (ISO)

17beta-estradiol 3-benzoate (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

3,4-methylenedioxymethamphetamine (EXP)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

5-aza-2'-deoxycytidine (ISO)

6-propyl-2-thiouracil (EXP)

aflatoxin B1 (ISO)

ammonium chloride (EXP)

arotinoid acid (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

belinostat (ISO)

benzo[a]pyrene (EXP,ISO)

benzo[b]fluoranthene (ISO)

bis(2-ethylhexyl) phthalate (EXP,ISO)

bisphenol A (EXP,ISO)

Brodifacoum (EXP)

Butylparaben (EXP)

C60 fullerene (EXP)

cadmium dichloride (EXP)

carbon nanotube (ISO)

CHIR 99021 (ISO)

ciguatoxin CTX1B (ISO)

cisplatin (ISO)

cobalt dichloride (EXP)

copper atom (EXP)

copper(0) (EXP)

cortisol (ISO)

crocidolite asbestos (ISO)

DDE (EXP)

dexamethasone (ISO)

dibutyl phthalate (EXP)

doramapimod (EXP)

dorsomorphin (ISO)

enzacamene (EXP)

epoxiconazole (EXP)

ethanol (ISO)

etoposide (ISO)

furan (EXP)

indometacin (ISO)

ivermectin (ISO)

L-ascorbic acid (ISO)

L-ascorbic acid 2-phosphate (ISO)

linuron (EXP)

methylazoxymethanol (ISO)

methylmercury chloride (ISO)

mifepristone (ISO)

N-methyl-N-nitrosourea (ISO)

nickel atom (ISO)

nitrofen (EXP)

ozone (ISO)

panobinostat (ISO)

paraquat (EXP)

pirinixic acid (ISO)

prochloraz (EXP)

procymidone (EXP)

progesterone (ISO)

rotenone (ISO)

sarin (ISO)

SB 431542 (ISO)

thalidomide (ISO)

titanium dioxide (ISO)

trichloroethene (EXP)

trichostatin A (ISO)

triclosan (ISO)

uranium atom (ISO)

valproic acid (ISO)

vinclozolin (EXP)

vorinostat (ISO)

XAV939 (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cellular response to nerve growth factor stimulus (ISO,ISS)

microtubule depolymerization (IBA)

negative regulation of microtubule depolymerization (ISO)

negative regulation of microtubule polymerization (ISO,ISS)

negative regulation of neuron projection development (ISO)

neuron projection development (IBA)

positive regulation of microtubule depolymerization (ISO)

positive regulation of neuron projection development (ISO,ISS)

regulation of microtubule polymerization or depolymerization (IBA,IEA)

Cellular Component

cytoplasm (IBA)

cytoplasm (ISO)

cytoplasm (ISO,ISS)

endosome (IEA)

Golgi apparatus (IDA)

growth cone (IBA,IDA,ISO)

lamellipodium (ISO,ISS)

membrane (IEA)

neuron projection (IBA,ISO)

neuron projection (ISO)

neuron projection (ISS)

neuronal cell body (ISO,ISS)

perinuclear region of cytoplasm (ISO)

vesicle (IDA)

Molecular Function

calcium-dependent protein binding (ISO)

protein binding (IPI,ISO)

tubulin binding (IBA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	The stathmin phosphoprotein family: intracellular localization and effects on the microtubule network.	Gavet O, etal., J Cell Sci 1998 Nov;111 ( Pt 22):3333-46.
3.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
4.	TRPC5 is a regulator of hippocampal neurite length and growth cone morphology.	Greka A, etal., Nat Neurosci 2003 Aug;6(8):837-45.
5.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
6.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
7.	The interaction of RGSZ1 with SCG10 attenuates the ability of SCG10 to promote microtubule disassembly.	Nixon AB, etal., J Biol Chem 2002 May 17;277(20):18127-33. Epub 2002 Mar 6.
8.	Differential, regional, and cellular expression of the stathmin family transcripts in the adult rat brain.	Ozon S, etal., J Neurosci Res 1999 Jun 1;56(5):553-64.
9.	Identification of upregulated SCG10 mRNA expression associated with late-phase long-term potentiation in the rat hippocampal Schaffer-CA1 pathway in vivo.	Peng H, etal., J Neurosci 2003 Jul 23;23(16):6617-26.
10.	GOA pipeline	RGD automated data pipeline
11.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
12.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
13.	JNK1 phosphorylation of SCG10 determines microtubule dynamics and axodendritic length.	Tararuk T, etal., J Cell Biol. 2006 Apr 24;173(2):265-77. Epub 2006 Apr 17.
14.	Tentative Sequence Identification Numbers	Tentative Sequence Data IDs. TIGR Gene Index, Rat Data

Additional References at PubMed

PMID:3272176	PMID:12477932	PMID:14741408	PMID:15200951	PMID:15489334	PMID:15581637	PMID:16838365	PMID:18422486	PMID:18452648	PMID:18996843	PMID:19959466	PMID:20106964
PMID:20621975	PMID:20802173	PMID:21215777	PMID:21471001

Genomics

Comparative Map Data

Stmn2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	2	93,204,690 - 93,252,011 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	93,204,692 - 93,252,011 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	99,728,967 - 99,776,344 (-)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	2	97,849,998 - 97,897,381 (-)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	2	92,906,867 - 92,954,252 (-)	NCBI	Rnor_WKY
Rnor_6.0	2	95,424,251 - 95,471,900 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	95,424,251 - 95,472,115 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	115,167,504 - 115,215,213 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	95,284,903 - 95,332,686 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	2	95,229,866 - 95,277,648 (-)	NCBI
Celera	2	88,774,309 - 88,821,687 (-)	NCBI		Celera
Cytogenetic Map	2	q23	NCBI

STMN2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	8	79,611,117 - 79,666,158 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	8	79,611,117 - 79,666,158 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	8	80,523,352 - 80,578,393 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	8	80,685,935 - 80,739,792 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	8	80,685,934 - 80,739,779	NCBI
Celera	8	76,527,590 - 76,581,458 (+)	NCBI		Celera
Cytogenetic Map	8	q21.13	NCBI
HuRef	8	76,012,743 - 76,068,118 (+)	NCBI		HuRef
CHM1_1	8	80,575,276 - 80,630,679 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	8	80,042,462 - 80,097,513 (+)	NCBI		T2T-CHM13v2.0

Stmn2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	3	8,574,587 - 8,626,664 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	3	8,574,420 - 8,626,666 (+)	Ensembl		GRCm39 Ensembl
GRCm38	3	8,509,527 - 8,561,604 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	3	8,509,360 - 8,561,606 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	3	8,509,527 - 8,561,604 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	3	8,492,600 - 8,544,677 (+)	NCBI		MGSCv36	mm8
Celera	3	8,514,599 - 8,566,747 (+)	NCBI		Celera
Cytogenetic Map	3	A1	NCBI
cM Map	3	2.15	NCBI

Stmn2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955444	1,585,042 - 1,646,812 (-)	NCBI	ChiLan1.0	ChiLan1.0

STMN2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
PanPan1.1	8	77,768,471 - 77,823,909 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	8	77,765,243 - 77,827,611 (+)	Ensembl	panpan1.1		panPan2
Mhudiblu_PPA_v0	8	76,137,827 - 76,193,112 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3

STMN2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	29	27,055,891 - 27,105,695 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	29	27,055,900 - 27,104,501 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	29	27,329,341 - 27,379,157 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	29	27,179,142 - 27,228,977 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	29	27,179,152 - 27,228,973 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	29	27,224,785 - 27,274,552 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	29	27,263,476 - 27,313,267 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	29	27,620,016 - 27,669,831 (+)	NCBI		UU_Cfam_GSD_1.0

Stmn2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405303	51,992,013 - 52,044,650 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936871	519,611 - 572,460 (+)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936871	519,611 - 572,429 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

STMN2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	4	56,952,978 - 57,006,462 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	4	56,952,968 - 57,006,744 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	4	62,173,165 - 62,226,945 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

STMN2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	8	75,071,514 - 75,127,605 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	8	75,071,638 - 75,128,187 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666039	66,074,674 - 66,130,665 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Stmn2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624744	11,572,745 - 11,630,819 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624744	11,573,707 - 11,630,570 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Stmn2
237 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	333
Count of miRNA genes:	205
Interacting mature miRNAs:	243
Transcripts:	ENSRNOT00000015720
Prediction methods:	Microtar, Miranda, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
61355	Bp36	Blood pressure QTL 36	2.9		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	2	5873687	102844969	Rat
1302794	Stl27	Serum triglyceride level QTL 27	4.4	0.0001	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	2	25413423	143657569	Rat
1358894	Kidm24	Kidney mass QTL 24	4.03		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	25413423	157142209	Rat
1358899	Kidm23	Kidney mass QTL 23	3.88		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	25413423	157142209	Rat
1358901	Cm38	Cardiac mass QTL 38	2		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	157142209	Rat
1358904	Cm39	Cardiac mass QTL 39	2.26		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	157142209	Rat
1358910	Kidm27	Kidney mass QTL 27	5.77		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	25413423	157142209	Rat
1358911	Kidm28	Kidney mass QTL 28	5.42		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	25413423	157142209	Rat
1358913	Cm41	Cardiac mass QTL 41	2.73		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	203928301	Rat
1358917	Cm42	Cardiac mass QTL 42	2.82		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	203928301	Rat
1358887	Bw50	Body weight QTL 50	2.39		body mass (VT:0001259)	body weight (CMO:0000012)	2	25413652	157142078	Rat
1358908	Bw49	Body weight QTL 49	3.36		body mass (VT:0001259)	body weight (CMO:0000012)	2	25413652	157142078	Rat
1354603	Bp243	Blood pressure QTL 243	3.9		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	26917817	127469484	Rat
2290453	Scl55	Serum cholesterol level QTL 55	2.83		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	2	26917817	136917119	Rat
70174	BpQTLCluster2	Blood pressure QTL cluster 2	4.24		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	40067944	102785628	Rat
70174	BpQTLCluster2	Blood pressure QTL cluster 2	4.24		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	40067944	102785628	Rat
70174	BpQTLCluster2	Blood pressure QTL cluster 2	4.24		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	40067944	102785628	Rat
70174	BpQTLCluster2	Blood pressure QTL cluster 2	4.24		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	2	40067944	102785628	Rat
70174	BpQTLCluster2	Blood pressure QTL cluster 2	4.24		arterial blood pressure trait (VT:2000000)	absolute change in mean arterial blood pressure (CMO:0000533)	2	40067944	102785628	Rat
2293835	Kiddil5	Kidney dilation QTL 5	3.8		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	2	42804607	157142209	Rat
2293843	Kiddil6	Kidney dilation QTL 6	3.1		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	2	42804607	182042367	Rat
1298074	Bp164	Blood pressure QTL 164		0.003	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	42804607	202447032	Rat
1298085	Bp165	Blood pressure QTL 165		0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	42804607	202447032	Rat
61467	Bp14	Blood pressure QTL 14	2.2		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	43154682	202446871	Rat
61467	Bp14	Blood pressure QTL 14	2.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	43154682	202446871	Rat
2293676	Bmd19	Bone mineral density QTL 19	10.7	0.0001	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	2	43162366	111362592	Rat
2293682	Bmd24	Bone mineral density QTL 24	8.9	0.0001	femur mineral mass (VT:0010011)	compact volumetric bone mineral density (CMO:0001730)	2	43162366	111362592	Rat
2293671	Bss44	Bone structure and strength QTL 44	10.97	0.0001	lumbar vertebra morphology trait (VT:0010494)	lumbar vertebra cortical cross-sectional area (CMO:0001690)	2	43162366	148478373	Rat
1354601	Slep1	Serum leptin concentration QTL 1	5.39		blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	2	43171017	184114403	Rat
631266	Bp132	Blood pressure QTL 132		0.0005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	46123260	202447032	Rat
1331760	Bp206	Blood pressure QTL 206	3.62454		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	56043031	202447032	Rat
1558648	Smcn1	Smooth muscle cell number QTL 1		0.039	blood vessel smooth muscle cell quantity (VT:0010525)	aorta smooth muscle cell count per unit vessel length (CMO:0001646)	2	59134147	127460910	Rat
5684990	Bmd82	Bone mineral density QTL 82	2.8		tibia mineral mass (VT:1000283)	bone mineral content (CMO:0001554)	2	59324377	103795077	Rat
5684996	Bmd85	Bone mineral density QTL 85	4.7	0.024	tibia mineral mass (VT:1000283)	bone mineral density (CMO:0001226)	2	59324377	103795077	Rat
61438	Cia7	Collagen induced arthritis QTL 7	4.6	0.0001	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	2	59324377	141596857	Rat
631500	Bp99	Blood pressure QTL 99	2.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	59324719	102755241	Rat
1578777	Stresp15	Stress response QTL 15	2	0.05	blood aldosterone amount (VT:0005346)	plasma aldosterone level (CMO:0000551)	2	59846005	104846005	Rat
2306903	Bp336	Blood pressure QTL 336		0.01	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	64366971	109366971	Rat
1298080	Bp163	Blood pressure QTL 163		0.02	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	66118275	202447032	Rat
1354648	Bp239	Blood pressure QTL 239		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	66118463	226797303	Rat
7411551	Bw131	Body weight QTL 131	29.6	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	2	67942638	112942638	Rat
1558653	Prcr1	Prostate cancer resistance QTL 1	5		prostate integrity trait (VT:0010571)	area of ventral prostate occupied by tumorous lesions to total ventral prostate area ratio (CMO:0000899)	2	72532993	157142209	Rat
1359034	Bp274	Blood pressure QTL 274			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	74786664	94359546	Rat
1359034	Bp274	Blood pressure QTL 274			arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	74786664	94359546	Rat
1354605	Rf48	Renal function QTL 48	2.9		blood creatinine amount (VT:0005328)	plasma creatinine level (CMO:0000537)	2	74786664	206665859	Rat
61465	Bp13	Blood pressure QTL 13	3.3		blood pressure trait (VT:0000183)	diastolic blood pressure (CMO:0000005)	2	76539322	102785628	Rat
61465	Bp13	Blood pressure QTL 13	3.3		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	2	76539322	102785628	Rat
631198	Cm22	Cardiac mass QTL 22	4.3	0.0008	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	2	76539322	150540526	Rat
61374	Edpm2	Estrogen-dependent pituitary mass QTL 2	4.42	0.86	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	2	76539322	202447032	Rat
2299162	Iddm32	Insulin dependent diabetes mellitus QTL 32	2.36		blood glucose amount (VT:0000188)	age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140)	2	78665616	143657569	Rat
1581569	Uae32	Urinary albumin excretion QTL 32		0.0001	urine protein amount (VT:0005160)	urine albumin excretion rate (CMO:0000757)	2	78665619	219826953	Rat
724534	Uae6	Urinary albumin excretion QTL 6	10		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	2	78665619	249053267	Rat
61392	Bp6	Blood pressure QTL 6	7		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	2	80270434	125270434	Rat
1598865	Bp296	Blood pressure QTL 296	2.1		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	81018907	126018907	Rat
8662832	Vetf7	Vascular elastic tissue fragility QTL 7	3.5		aorta elastin amount (VT:0003905)	aorta wall extracellular elastin dry weight to aorta wall dry weight ratio (CMO:0002002)	2	81689826	221035911	Rat
1354622	Kidm16	Kidney mass QTL 16	3		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	2	81754530	222436696	Rat
1354649	Kidm17	Kidney mass QTL 17	2.9		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	2	81754530	227146641	Rat
1578772	Stresp14	Stress response QTL 14	5	0.001	blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	2	82345893	130923501	Rat
7207808	Bmd89	Bone mineral density QTL 89	4.1		femur strength trait (VT:0010010)	femoral neck ultimate force (CMO:0001703)	2	88862519	133862519	Rat
2300165	Bmd49	Bone mineral density QTL 49	4.8	0.0001	lumbar vertebra mineral mass (VT:0010511)	bone mineral density (CMO:0001226)	2	88862519	133862519	Rat
2300170	Bmd45	Bone mineral density QTL 45	12.1	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	2	88862519	133862519	Rat
2300185	Bmd46	Bone mineral density QTL 46	8.4	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	2	88862519	133862519	Rat
1598862	Glom9	Glomerulus QTL 9	3.5		kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	2	92337601	137337601	Rat
1598863	Cm65	Cardiac mass QTL 65	2.3		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	92337601	137337601	Rat

Markers in Region

D8S1385E

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	93,204,790 - 93,204,900 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	95,424,352 - 95,424,461	NCBI	Rnor6.0
Rnor_5.0	2	115,167,605 - 115,167,714	UniSTS	Rnor5.0
RGSC_v3.4	2	95,285,004 - 95,285,113	UniSTS	RGSC3.4
Celera	2	88,774,410 - 88,774,519	UniSTS
Cytogenetic Map	2	q23	UniSTS

AI454126

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	93,204,851 - 93,205,039 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	95,424,413 - 95,424,600	NCBI	Rnor6.0
Rnor_5.0	2	115,167,666 - 115,167,853	UniSTS	Rnor5.0
RGSC_v3.4	2	95,285,065 - 95,285,252	UniSTS	RGSC3.4
Celera	2	88,774,471 - 88,774,658	UniSTS
RH 3.4 Map	2	589.3	UniSTS
Cytogenetic Map	2	q23	UniSTS

D8S1388E

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	93,204,719 - 93,204,809 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	95,424,281 - 95,424,370	NCBI	Rnor6.0
Rnor_5.0	2	115,167,534 - 115,167,623	UniSTS	Rnor5.0
RGSC_v3.4	2	95,284,933 - 95,285,022	UniSTS	RGSC3.4
Celera	2	88,774,339 - 88,774,428	UniSTS
Cytogenetic Map	2	q23	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High									37
Medium	1	12	14	14	2	14			37		12
Low	2	16	20	7	14	7	7	10		17	22	11	7
Below cutoff		14	18	15	3	15	1	1		18	6		1

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_053440	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF306458	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC087660	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473961	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000067	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSRNOT00000015720 ⟹ ENSRNOP00000015720

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	93,204,692 - 93,252,011 (-)	Ensembl
Rnor_6.0 Ensembl	2	95,424,251 - 95,472,115 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000095634 ⟹ ENSRNOP00000083052

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	93,204,692 - 93,223,840 (-)	Ensembl

RefSeq Acc Id:

NM_053440 ⟹ NP_445892

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	2	93,204,690 - 93,252,011 (-)	NCBI
Rnor_6.0	2	95,424,251 - 95,471,900 (-)	NCBI
Rnor_5.0	2	115,167,504 - 115,215,213 (-)	NCBI
RGSC_v3.4	2	95,284,903 - 95,332,686 (-)	RGD
Celera	2	88,774,309 - 88,821,687 (-)	RGD

Sequence:

show sequence

CCGCTCCGAGCGTGCACATCCCTACAATGGCTAAAACAGCAATGGCCTACAAGGAAAAAATGAA
GGAGCTGTCTATGCTGTCACTGATCTGCTCCTGCTTCTACCCGGAGCCTCGCAACATCAACATC
TACACCTACGATGACATGGAGGTGAAGCAGATCAACAAGCGTGCTTCCGGCCAGGCTTTCGAGC
TGATCTTAAAGCCCCCGTCTCCCATCTCGGAAGCTCCACGAACTCTAGCTTCTCCAAAGAAGAA
AGACCTGTCTCTGGAGGAGATCCAGAAAAAGCTGGAGGCTGCAGAGGGGCGAAGGAAGTCTCAG
GAGGCCCAGGTGCTGAAGCAGTTGGCAGAGAAGAGGGAGCACGAGCGAGAAGTCCTCCAGAAGG
CTTTGGAGGAGAATAACAACTTCAGCAAGATGGCGGAGGAGAAGCTGATCCTGAAAATGGAACA
AATTAAGGAAAACCGTGAGGCTAATCTAGCTGCTATCATTGAACGTCTGCAGGAAAAGGAGAGG
CATGCTGCCGAGGTGCGCAGGAACAAGGAACTGCAGGTTGAACTGTCTGGCTGAAGCAATGGCG
GGTATGGCACGCCCCTCCCATAGTAAATCCCCCTGCCTATATTATAATGGATCATGCGATATCA
GTATGGGAAAATGTATGACATGGTTTAAAAAGAACTCATTATGAAAAAAAAACAGAATCAAAAA
TAAAATAAATCAATGCGGTCTCTTTGCAGAATGTTTTGCTTGATGTTTAAAAAAGTACCTTGGA
TCTTATTTTGTAAATATTTACATTTTTGTTAAAAAATACAAGTATTGCATTATGCAAGTTATTT
CATAATCTTACATGTCCTGTAACAGGCATTCGATGTTGTGTCTTCCCACTCAAATGAATTTGCT
AGCTCTATTCTTTTGGAAGCTCCCCCATGTTGAACTCAGTCCCTGCCCTTTTCATTCCACCCAA
AAATGAGGTCAGTAGACAGTCTATGGTGCTAGAAACCCACCATTGCCTAGTGACCTAGATGACT
CCATACTCTCCGAGCTTGGCCAAGACCACACCTAGATCGTGGGGACCGTGTGCCCATGTGAACC
TCCACATTTCTCTGCTCATAATCTGCTTCCTGCCTAGAAACCACAAAGCCAGGCTAAGGAAATC
CACCAGTCCTAGCACTGACCTCTGCTTCTCGTGGAGTGTGTGCTTCACTCGTGTTTGGGTTTTA
GAAAGAGATGAATGGGAAGACAGAGCTGTGCTCAATGAGGGTAGAAGGGCGAGGCTGAACCTTC
TAATGGGCCGAACACAAACACAAAGCTAGAGGGTTCGAGCGGCCATGACGTTGTTCTTCATGAA
GTGGGCTTTCTTCTCTTGTTTCGGTTATTTTGATGGAATGACTTAATCAACATGTCGATGGCTT
ATCTGTGGGTGCCATGGGTGACGATGTTCGTTTTAAGCTTTTGCCTGTAGTACAAGCACATGAT
GCTACTAAATATTTTTCCACTTGGAGACTGTGAGCTGGTTGTTGCATTAAACACACAAACGAAA
TCACAAACACTGTGGACTTTTACTCAAGCTGGTCTTTCATTCCCAGTGTAGGGCAATCCTGCCT
ATAAACAAGACCAAATCACTCCATCTGTGACGCTGCCGCAGTTAAGGGGGCTAGGCAGGGCATT
TGTGCCACTGTAAGAATCAGCAGAGACCCAGCATACGTACCTTTTGCAGTTTTGAAGTTGTCTT
TCCCCAACTCCCAACTCCTGAAGGTTGCTGCCTGCATACTTACTTCTCGTCAGTGCTATCTTCT
TGTATGTCATTGTGAGCAAACTGTGATGAATAAAGAATTGGAGTTCTGTGAACTAAAAAAAAAA
AAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_445892	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAG33230	(Get FASTA)	NCBI Sequence Viewer
	AAH87660	(Get FASTA)	NCBI Sequence Viewer
	EDM01022	(Get FASTA)	NCBI Sequence Viewer
	EDM01023	(Get FASTA)	NCBI Sequence Viewer
	P21818	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:	NP_445892 ⟸ NM_053440
- UniProtKB:	Q9ERH2 (UniProtKB/Swiss-Prot), P21818 (UniProtKB/Swiss-Prot)
- Sequence:	show sequence MAKTAMAYKEKMKELSMLSLICSCFYPEPRNINIYTYDDMEVKQINKRASGQAFELILKPPSPI SEAPRTLASPKKKDLSLEEIQKKLEAAEGRRKSQEAQVLKQLAEKREHEREVLQKALEENNNFS KMAEEKLILKMEQIKENREANLAAIIERLQEKERHAAEVRRNKELQVELSG hide sequence

RefSeq Acc Id:

ENSRNOP00000015720 ⟸ ENSRNOT00000015720

RefSeq Acc Id:

ENSRNOP00000083052 ⟸ ENSRNOT00000095634

Protein Domains

SLD

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P21818-F1-model_v2	AlphaFold	P21818	1-179	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13691243

Promoter ID:

EPDNEW_R1767

Type:

multiple initiation site

Name:

Stmn2_1

Description:

stathmin 2

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	2	95,471,943 - 95,472,003	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:68947	AgrOrtholog
BioCyc Gene	G2FUF-53712	BioCyc
Ensembl Genes	ENSRNOG00000011705	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000015720	ENTREZGENE
	ENSRNOP00000015720.5	UniProtKB/Swiss-Prot
	ENSRNOP00000083052.1	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000015720	ENTREZGENE
	ENSRNOT00000015720.7	UniProtKB/Swiss-Prot
	ENSRNOT00000095634.1	UniProtKB/TrEMBL
Gene3D-CATH	6.10.280.30	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7313867	IMAGE-MGC_LOAD
InterPro	Stathmin_CS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Stathmin_fam	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Stathmin_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:84510	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:105372	IMAGE-MGC_LOAD
NCBI Gene	84510	ENTREZGENE
PANTHER	PTHR10104	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR10104:SF18	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Stathmin	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Stmn2	PhenoGen
PIRSF	Stathmin	UniProtKB/Swiss-Prot
PRINTS	STATHMIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	STATHMIN_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	STATHMIN_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	STATHMIN_3	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF101494	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
TIGR	TC228640
UniProt	A0A8I5ZV30_RAT	UniProtKB/TrEMBL
	P21818	ENTREZGENE
	Q9ERH2	ENTREZGENE
	STMN2_RAT	UniProtKB/Swiss-Prot
UniProt Secondary	Q9ERH2	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2014-04-11	Stmn2	stathmin 2	Stmn2	stathmin-like 2	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2003-04-09	Stmn2	stathmin-like 2	Scgn10	superiorcervical ganglia, neural specific 10	Symbol and Name updated	629477	APPROVED
2002-06-10	Scgn10	superiorcervical ganglia, neural specific 10			Symbol and Name status set to approved	70586	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_cellular_localization	anchored to intracellular membranes, including the Golgi apparatus, by NH2-terminal domain through palmitoylation of two cysteines	61521
gene_cellular_localization	anchored to intracellular membranes, including the Golgi apparatus, by NH2-terminal domain through palmitoylation of two cysteines	61528
gene_cellular_localization	localizes to the Golgi apparatus	1299171
gene_expression	present in glutamatergic neurons, such as pyramidal cells of the hippocampus and granular cells of the cerebellum	61521
gene_expression	present in glutamatergic neurons, such as pyramidal cells of the hippocampus and granular cells of the cerebellum	61528
gene_physical_interaction	interacts in vitro with tubulin in a phosphorylation-dependent manner	61528
gene_physical_interaction	interacts with RGSZ1	1299171
gene_process	involved in the neuronal-like differentiation of PC12 cells	61521
gene_process	involved in the neuronal-like differentiation of PC12 cells	61528
gene_process	sequesters free tubulin and promotes microtubule depolymerization	61528
gene_regulation	expression controlled by a neuronal restricted silencer element (NRSE)	61521
gene_regulation	expression controlled by a neuronal restricted silencer element (NRSE)	61528
gene_regulation	interaction with RGSZ1 effectively blocked the ability to induce microtubule disassembly	1299171
gene_regulation	transcription in vivo is regulated by long-lasting synaptic activity	1299172

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar