Advanced Search (OLGA)

Gene: Cldn3 (claudin 3) Rattus norvegicus

Analyze

Symbol:

Cldn3

Name:

claudin 3

RGD ID:

68425

Description:

Predicted to enable cell-cell adhesion mediator activity; identical protein binding activity; and structural molecule activity. Involved in response to Gram-positive bacterium and response to ethanol. Located in bicellular tight junction and lateral plasma membrane. Biomarker of peptic esophagitis. Orthologous to human CLDN3 (claudin 3); PARTICIPATES IN hepatitis C pathway; INTERACTS WITH (+)-schisandrin B; 2,2',5,5'-tetrachlorobiphenyl; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

claudin-3; RVP1; ventral prostate.1 protein

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	CLDN3 (claudin 3)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB
Mus musculus (house mouse):	Cldn3 (claudin 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	CLDN3 (claudin 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	CLDN3 (claudin 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Cldn3 (claudin 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	CLDN3 (claudin 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	CLDN3 (claudin 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Cldn3 (claudin 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	CLDN3 (claudin 3)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Cldn3 (claudin 3)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	cldnc (claudin c)	Alliance	DIOPT (OMA\|OrthoFinder\|PANTHER)
Danio rerio (zebrafish):	cldnh (claudin h)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	cldn3	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	12	27,345,075 - 27,346,547 (-)	NCBI		GRCr8
mRatBN7.2	12	21,708,538 - 21,710,010 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	21,708,398 - 21,711,001 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	12	22,849,399 - 22,850,871 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	12	23,461,727 - 23,463,199 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	12	22,529,747 - 22,531,219 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	12	21,831,341 - 21,832,813 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	21,831,342 - 21,832,813 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	12	23,849,259 - 23,850,731 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
Celera	12	23,471,431 - 23,472,903 (-)	NCBI		Celera
Cytogenetic Map	12	q12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

RGD Manual Disease Annotations Click to see Annotation Detail View

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Cldn3	Rat	Intestinal Reperfusion Injury		IEP		2325127	protein:decreased expression:colon:	RGD
Cldn3	Rat	peptic esophagitis		IEP		11344880	protein:altered expression:epithelial cell, esophagus:	RGD

Imported Disease Annotations - ClinVar

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Cldn3	Rat	autism spectrum disorder		ISO	RGD:68632	8554872	ClinVar Annotator: match by term: Autism spectrum disorder	ClinVar	PMID:21658581\|PMID:25741868\|PMID:27569545
Cldn3	Rat	autistic disorder		ISO	RGD:68632	8554872	ClinVar Annotator: match by term: Autism	ClinVar	PMID:21681106\|PMID:30208311
Cldn3	Rat	intestinal volvulus		ISO	RGD:68632	8554872	ClinVar Annotator: match by term: INTESTINAL MALROTATION, FAMILIAL	ClinVar	PMID:25741868
Cldn3	Rat	Neurodevelopmental Disorders		ISO	RGD:68632	8554872	ClinVar Annotator: match by term: Neurodevelopmental disorder	ClinVar	PMID:25741868
Cldn3	Rat	pleomorphic xanthoastrocytoma		ISO	RGD:68632	8554872	ClinVar Annotator: match by term: Pleomorphic xanthoastrocytoma	ClinVar	PMID:28299358
Cldn3	Rat	schizophrenia		ISO	RGD:68632	8554872	ClinVar Annotator: match by term: Schizophrenia	ClinVar	PMID:21681106\|PMID:30208311
Cldn3	Rat	supravalvular aortic stenosis		ISO	RGD:68632	8554872	ClinVar Annotator: match by term: Supravalvar aortic stenosis	ClinVar	PMID:10627943\|PMID:11175284\|PMID:25205790\|PMID:28277377\|PMID:28492532\|PMID:7557968\|PMID:7611295\|PMID:7726172\|PMID:8968740
Cldn3	Rat	Volvulus Of Midgut		ISO	RGD:68632	8554872	ClinVar Annotator: match by term: Volvulus of midgut	ClinVar	PMID:25741868
Cldn3	Rat	Williams-Beuren syndrome		ISO	RGD:68632	8554872	ClinVar Annotator: match by term: Williams syndrome	ClinVar	PMID:25741868

Imported Disease Annotations - CTD

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Cldn3	Rat	allergic rhinitis		ISO	RGD:68632	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:33441633
Cldn3	Rat	autism spectrum disorder		ISO	RGD:68632	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:35663546
Cldn3	Rat	Prostatic Neoplasms		ISO	RGD:68632	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:17013881
Cldn3	Rat	Stomach Neoplasms		ISO	RGD:68632	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:16367923

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Cldn3	Rat	(+)-schisandrin B	multiple interactions	EXP		6480464	schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of CLDN3 mRNA]	CTD	PMID:31150632
Cldn3	Rat	1,2-dimethylhydrazine	multiple interactions	ISO	RGD:68633	6480464	[1,2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of CLDN3 mRNA	CTD	PMID:22206623
Cldn3	Rat	17alpha-ethynylestradiol	increases expression	ISO	RGD:68633	6480464	Ethinyl Estradiol results in increased expression of CLDN3 mRNA	CTD	PMID:17942748
Cldn3	Rat	17alpha-ethynylestradiol	multiple interactions	ISO	RGD:68633	6480464	[Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in decreased expression of CLDN3 mRNA	CTD	PMID:17942748
Cldn3	Rat	17beta-estradiol	increases expression	ISO	RGD:68633	6480464	Estradiol results in increased expression of CLDN3 mRNA	CTD	PMID:19484750\|PMID:39298647
Cldn3	Rat	17beta-estradiol	multiple interactions	ISO	RGD:68632	6480464	[Estradiol co-treated with TGFB1 protein] results in decreased expression of CLDN3 mRNA	CTD	PMID:30165855
Cldn3	Rat	17beta-hydroxy-17-methylestra-4,9,11-trien-3-one	increases expression	ISO	RGD:68632	6480464	Metribolone results in increased expression of CLDN3 mRNA	CTD	PMID:17010196
Cldn3	Rat	2,2',5,5'-tetrachlorobiphenyl	increases expression	EXP		6480464	2,5,2',5'-tetrachlorobiphenyl results in increased expression of CLDN3 mRNA	CTD	PMID:23829299
Cldn3	Rat	2,3,7,8-tetrachlorodibenzodioxine	multiple interactions	ISO	RGD:68633	6480464	[Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in decreased expression of CLDN3 mRNA	CTD	PMID:17942748
Cldn3	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	RGD:68633	6480464	Tetrachlorodibenzodioxin affects the expression of CLDN3 mRNA	CTD	PMID:21570461\|PMID:28922406
Cldn3	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	EXP		6480464	Tetrachlorodibenzodioxin affects the expression of CLDN3 mRNA	CTD	PMID:22298810\|PMID:32109520
Cldn3	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	ISO	RGD:68632	6480464	Tetrachlorodibenzodioxin results in increased expression of CLDN3 mRNA	CTD	PMID:21296121
Cldn3	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	EXP		6480464	Tetrachlorodibenzodioxin results in decreased expression of CLDN3 mRNA	CTD	PMID:16054898
Cldn3	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	EXP		6480464	Tetrachlorodibenzodioxin results in increased expression of CLDN3 mRNA	CTD	PMID:16960034
Cldn3	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	ISO	RGD:68633	6480464	Tetrachlorodibenzodioxin results in increased expression of CLDN3 mRNA	CTD	PMID:16960034
Cldn3	Rat	2,3,7,8-Tetrachlorodibenzofuran	increases expression	EXP		6480464	2,3,7,8-tetrachlorodibenzofuran results in increased expression of CLDN3 mRNA	CTD	PMID:32109520
Cldn3	Rat	2,4-dibromophenyl 2,4,5-tribromophenyl ether	affects expression	ISO	RGD:68633	6480464	2,2',4,4',5-brominated diphenyl ether affects the expression of CLDN3 mRNA	CTD	PMID:38648751
Cldn3	Rat	2,4-dinitrotoluene	affects expression	EXP		6480464	2,4-dinitrotoluene affects the expression of CLDN3 mRNA	CTD	PMID:21346803
Cldn3	Rat	3-Nitrobenzanthrone	decreases expression	ISO	RGD:68632	6480464	3-nitrobenzanthrone results in decreased expression of CLDN3 mRNA	CTD	PMID:34036453
Cldn3	Rat	4,4'-diaminodiphenylmethane	decreases expression	ISO	RGD:68633	6480464	4,4'-diaminodiphenylmethane results in decreased expression of CLDN3 mRNA	CTD	PMID:18648102
Cldn3	Rat	4,4'-sulfonyldiphenol	increases expression	ISO	RGD:68633	6480464	bisphenol S results in increased expression of CLDN3 mRNA	CTD	PMID:30951980
Cldn3	Rat	4,4'-sulfonyldiphenol	decreases expression	ISO	RGD:68633	6480464	bisphenol S results in decreased expression of CLDN3 mRNA	CTD	PMID:39298647
Cldn3	Rat	4-hydroxyphenyl retinamide	increases expression	ISO	RGD:68632	6480464	Fenretinide results in increased expression of CLDN3 mRNA	CTD	PMID:16671099
Cldn3	Rat	4-hydroxyphenyl retinamide	increases expression	ISO	RGD:68633	6480464	Fenretinide results in increased expression of CLDN3 mRNA	CTD	PMID:28973697
Cldn3	Rat	5-aza-2'-deoxycytidine	increases expression	ISO	RGD:68632	6480464	Decitabine results in increased expression of CLDN3 mRNA; Decitabine results in increased expression of CLDN3 more ...	CTD	PMID:16367923\|PMID:17986852
Cldn3	Rat	5-aza-2'-deoxycytidine	multiple interactions	ISO	RGD:68632	6480464	[Decitabine co-treated with trichostatin A] inhibits the reaction [MBD2 protein binds to CLDN3 promoter]; [Decitabine more ...	CTD	PMID:17986852
Cldn3	Rat	6-propyl-2-thiouracil	increases expression	EXP		6480464	Propylthiouracil results in increased expression of CLDN3 mRNA	CTD	PMID:24780913
Cldn3	Rat	7,12-dimethyltetraphene	increases expression	EXP		6480464	9,10-Dimethyl-1,2-benzanthracene results in increased expression of CLDN3 mRNA	CTD	PMID:12097258
Cldn3	Rat	aflatoxin B1	decreases expression	ISO	RGD:68633	6480464	Aflatoxin B1 results in decreased expression of CLDN3 mRNA	CTD	PMID:19770486
Cldn3	Rat	aflatoxin B1	decreases expression	ISO	RGD:68632	6480464	Aflatoxin B1 results in decreased expression of CLDN3 mRNA	CTD	PMID:27153755
Cldn3	Rat	all-trans-retinoic acid	multiple interactions	ISO	RGD:68633	6480464	[bisphenol F co-treated with Tretinoin] results in decreased expression of CLDN3 mRNA	CTD	PMID:30951980
Cldn3	Rat	ammonium chloride	affects expression	EXP		6480464	Ammonium Chloride affects the expression of CLDN3 mRNA	CTD	PMID:16483693
Cldn3	Rat	antigen	multiple interactions	ISO	RGD:68633	6480464	[deoxynivalenol results in increased susceptibility to Antigens] which results in decreased expression of CLDN3 mRNA; more ...	CTD	PMID:28935500
Cldn3	Rat	arsane	decreases expression	ISO	RGD:68632	6480464	Arsenic results in decreased expression of CLDN3 protein	CTD	PMID:36861143
Cldn3	Rat	arsenic atom	decreases expression	ISO	RGD:68632	6480464	Arsenic results in decreased expression of CLDN3 protein	CTD	PMID:36861143
Cldn3	Rat	arsenite(3-)	multiple interactions	ISO	RGD:68632	6480464	arsenite promotes the reaction [G3BP1 protein binds to CLDN3 mRNA]	CTD	PMID:32406909
Cldn3	Rat	benzo[a]pyrene	decreases expression	ISO	RGD:68632	6480464	Benzo(a)pyrene results in decreased expression of CLDN3 mRNA	CTD	PMID:20106945\|PMID:32234424
Cldn3	Rat	benzo[a]pyrene	decreases methylation	ISO	RGD:68632	6480464	Benzo(a)pyrene results in decreased methylation of CLDN3 5' UTR	CTD	PMID:27901495
Cldn3	Rat	benzo[a]pyrene	increases expression	ISO	RGD:68632	6480464	Benzo(a)pyrene results in increased expression of CLDN3 mRNA	CTD	PMID:31255691
Cldn3	Rat	benzo[a]pyrene	decreases expression	ISO	RGD:68633	6480464	Benzo(a)pyrene results in decreased expression of CLDN3 mRNA	CTD	PMID:19770486
Cldn3	Rat	bexarotene	increases expression	EXP		6480464	bexarotene results in increased expression of CLDN3 mRNA	CTD	PMID:16648578
Cldn3	Rat	bisphenol A	affects expression	EXP		6480464	bisphenol A affects the expression of CLDN3 mRNA	CTD	PMID:25181051
Cldn3	Rat	bisphenol A	decreases expression	ISO	RGD:68633	6480464	bisphenol A results in decreased expression of CLDN3 mRNA	CTD	PMID:33221593
Cldn3	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of CLDN3 mRNA	CTD	PMID:34947998
Cldn3	Rat	bisphenol A	increases expression	ISO	RGD:68633	6480464	bisphenol A results in increased expression of CLDN3 mRNA	CTD	PMID:30951980\|PMID:32156529
Cldn3	Rat	bisphenol F	multiple interactions	ISO	RGD:68633	6480464	[bisphenol F co-treated with Tretinoin] results in decreased expression of CLDN3 mRNA	CTD	PMID:30951980
Cldn3	Rat	bisphenol F	decreases expression	ISO	RGD:68633	6480464	bisphenol F results in decreased expression of CLDN3 mRNA	CTD	PMID:38685157
Cldn3	Rat	bisphenol F	increases expression	ISO	RGD:68633	6480464	bisphenol F results in increased expression of CLDN3 mRNA	CTD	PMID:30951980
Cldn3	Rat	bromobenzene	decreases expression	EXP		6480464	bromobenzene results in decreased expression of CLDN3 mRNA	CTD	PMID:32479839
Cldn3	Rat	butanal	increases expression	ISO	RGD:68632	6480464	butyraldehyde results in increased expression of CLDN3 mRNA	CTD	PMID:26079696
Cldn3	Rat	cadmium dichloride	increases methylation	EXP		6480464	Cadmium Chloride results in increased methylation of CLDN3 promoter	CTD	PMID:22457795
Cldn3	Rat	cadmium dichloride	multiple interactions	ISO	RGD:68633	6480464	MT3 affects the reaction [Cadmium Chloride affects the expression of CLDN3 mRNA]	CTD	PMID:20371981
Cldn3	Rat	caffeine	increases phosphorylation	ISO	RGD:68632	6480464	Caffeine results in increased phosphorylation of CLDN3 protein	CTD	PMID:35688186
Cldn3	Rat	calcitriol	increases expression	ISO	RGD:68632	6480464	Calcitriol results in increased expression of CLDN3 mRNA	CTD	PMID:26485663
Cldn3	Rat	capecitabine	increases response to substance	ISO	RGD:68632	6480464	CLDN3 protein results in increased susceptibility to Capecitabine	CTD	PMID:16734730
Cldn3	Rat	carbamazepine	affects expression	ISO	RGD:68632	6480464	Carbamazepine affects the expression of CLDN3 mRNA	CTD	PMID:25979313
Cldn3	Rat	ciguatoxin CTX1B	affects expression	ISO	RGD:68633	6480464	Ciguatoxins affects the expression of CLDN3 mRNA	CTD	PMID:18353800
Cldn3	Rat	cisplatin	increases import	ISO	RGD:68632	6480464	CLDN3 protein results in increased import of Cisplatin	CTD	PMID:23053666
Cldn3	Rat	cisplatin	increases response to substance	ISO	RGD:68632	6480464	CLDN3 protein results in increased susceptibility to Cisplatin	CTD	PMID:23053666
Cldn3	Rat	cisplatin	multiple interactions	ISO	RGD:68632	6480464	[CLDN3 protein results in increased expression of SLC31A1 protein] which results in increased import of more ...	CTD	PMID:23053666
Cldn3	Rat	clofibrate	decreases expression	ISO	RGD:68633	6480464	Clofibrate results in decreased expression of CLDN3 mRNA	CTD	PMID:17585979
Cldn3	Rat	copper atom	multiple interactions	ISO	RGD:68632	6480464	[CLDN3 protein results in increased abundance of Copper] promotes the reaction [[TYR protein results in more ...	CTD	PMID:20971185\|PMID:23053666
Cldn3	Rat	copper atom	increases expression	EXP		6480464	Copper results in increased expression of CLDN3 mRNA	CTD	PMID:30556269
Cldn3	Rat	copper atom	increases abundance	ISO	RGD:68632	6480464	CLDN3 protein results in increased abundance of Copper	CTD	PMID:23053666
Cldn3	Rat	copper atom	multiple interactions	ISO	RGD:68633	6480464	[ATP7A gene mutant form results in increased abundance of Copper] which results in decreased expression more ...	CTD	PMID:15467011
Cldn3	Rat	copper(0)	multiple interactions	ISO	RGD:68632	6480464	[CLDN3 protein results in increased abundance of Copper] promotes the reaction [[TYR protein results in more ...	CTD	PMID:20971185\|PMID:23053666
Cldn3	Rat	copper(0)	increases expression	EXP		6480464	Copper results in increased expression of CLDN3 mRNA	CTD	PMID:30556269
Cldn3	Rat	copper(0)	increases abundance	ISO	RGD:68632	6480464	CLDN3 protein results in increased abundance of Copper	CTD	PMID:23053666
Cldn3	Rat	copper(0)	multiple interactions	ISO	RGD:68633	6480464	[ATP7A gene mutant form results in increased abundance of Copper] which results in decreased expression more ...	CTD	PMID:15467011
Cldn3	Rat	cordycepin	decreases expression	ISO	RGD:68632	6480464	cordycepin results in decreased expression of CLDN3 mRNA; cordycepin results in decreased expression of CLDN3 more ...	CTD	PMID:22246470
Cldn3	Rat	coumarin	decreases expression	ISO	RGD:68632	6480464	coumarin analog results in decreased expression of CLDN3 mRNA	CTD	PMID:32578917
Cldn3	Rat	cyclosporin A	decreases expression	ISO	RGD:68632	6480464	Cyclosporine results in decreased expression of CLDN3 mRNA	CTD	PMID:20106945
Cldn3	Rat	deoxynivalenol	increases expression	ISO	RGD:68633	6480464	deoxynivalenol results in increased expression of CLDN3 mRNA	CTD	PMID:24568843
Cldn3	Rat	deoxynivalenol	multiple interactions	ISO	RGD:68633	6480464	[deoxynivalenol results in increased susceptibility to Antigens] which results in decreased expression of CLDN3 mRNA	CTD	PMID:28935500
Cldn3	Rat	deoxynivalenol	affects expression	ISO	RGD:68633	6480464	deoxynivalenol affects the expression of CLDN3 protein	CTD	PMID:24568843
Cldn3	Rat	deoxynivalenol	increases expression	ISO	RGD:68632	6480464	deoxynivalenol results in increased expression of CLDN3 mRNA	CTD	PMID:24568843
Cldn3	Rat	deoxynivalenol	multiple interactions	ISO	RGD:68632	6480464	deoxynivalenol results in decreased expression of and affects the localization of CLDN3 protein	CTD	PMID:24568843
Cldn3	Rat	dexamethasone	multiple interactions	ISO	RGD:68633	6480464	Dexamethasone inhibits the reaction [lipopolysaccharide, Escherichia coli O111 B4 results in decreased expression of CLDN3 more ...	CTD	PMID:38729284
Cldn3	Rat	diallyl disulfide	decreases expression	ISO	RGD:68632	6480464	diallyl disulfide results in decreased expression of CLDN3 mRNA; diallyl disulfide results in decreased expression more ...	CTD	PMID:20600798
Cldn3	Rat	diallyl trisulfide	decreases expression	ISO	RGD:68632	6480464	diallyl trisulfide results in decreased expression of CLDN3 mRNA; diallyl trisulfide results in decreased expression more ...	CTD	PMID:24084732
Cldn3	Rat	dibenzo[a,l]pyrene	increases expression	ISO	RGD:68632	6480464	dibenzo(a,l)pyrene results in increased expression of CLDN3 mRNA	CTD	PMID:31255691
Cldn3	Rat	dicrotophos	decreases expression	ISO	RGD:68632	6480464	dicrotophos results in decreased expression of CLDN3 mRNA	CTD	PMID:28302478
Cldn3	Rat	dicyclanil	increases expression	ISO	RGD:68633	6480464	dicyclanil results in increased expression of CLDN3 mRNA	CTD	PMID:15664270
Cldn3	Rat	diethyl phthalate	decreases expression	EXP		6480464	diethyl phthalate results in decreased expression of CLDN3 mRNA	CTD	PMID:32341500
Cldn3	Rat	diethylstilbestrol	decreases expression	ISO	RGD:68633	6480464	Diethylstilbestrol results in decreased expression of CLDN3 mRNA	CTD	PMID:15149470
Cldn3	Rat	dioxygen	increases expression	ISO	RGD:68632	6480464	Oxygen deficiency results in increased expression of CLDN3 mRNA	CTD	PMID:26516004
Cldn3	Rat	doxifluridine	increases response to substance	ISO	RGD:68632	6480464	CLDN3 protein results in increased susceptibility to doxifluridine	CTD	PMID:16734730
Cldn3	Rat	endosulfan	increases expression	EXP		6480464	Endosulfan results in increased expression of CLDN3 mRNA	CTD	PMID:29391264
Cldn3	Rat	epoxiconazole	increases expression	ISO	RGD:68633	6480464	epoxiconazole results in increased expression of CLDN3 mRNA	CTD	PMID:35436446
Cldn3	Rat	folic acid	multiple interactions	ISO	RGD:68633	6480464	[1,2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of CLDN3 mRNA	CTD	PMID:22206623
Cldn3	Rat	Forsythiaside	multiple interactions	ISO	RGD:68633	6480464	forsythiaside inhibits the reaction [lipopolysaccharide, Escherichia coli O111 B4 results in decreased expression of CLDN3 more ...	CTD	PMID:38729284
Cldn3	Rat	fumonisin B1	multiple interactions	ISO	RGD:68632	6480464	illite inhibits the reaction [fumonisin B1 results in decreased expression of CLDN3 mRNA]	CTD	PMID:27153755
Cldn3	Rat	fumonisin B1	decreases expression	ISO	RGD:68632	6480464	fumonisin B1 results in decreased expression of CLDN3 mRNA	CTD	PMID:27153755
Cldn3	Rat	furan	increases methylation	EXP		6480464	furan results in increased methylation of CLDN3 gene	CTD	PMID:22079235
Cldn3	Rat	genistein	decreases methylation	EXP		6480464	Genistein results in decreased methylation of CLDN3 gene	CTD	PMID:28505145
Cldn3	Rat	glycidol	increases expression	EXP		6480464	glycidol results in increased expression of CLDN3 mRNA	CTD	PMID:24395379
Cldn3	Rat	hydrogen peroxide	affects expression	ISO	RGD:68632	6480464	Hydrogen Peroxide affects the expression of CLDN3 mRNA	CTD	PMID:20044591
Cldn3	Rat	isoflavones	decreases expression	ISO	RGD:68632	6480464	Isoflavones results in decreased expression of CLDN3 mRNA	CTD	PMID:17374662
Cldn3	Rat	kojic acid	decreases expression	ISO	RGD:68632	6480464	kojic acid results in decreased expression of CLDN3 mRNA	CTD	PMID:16595896
Cldn3	Rat	lipopolysaccharide	multiple interactions	ISO	RGD:68632	6480464	[S-(1,2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of CLDN3 mRNA	CTD	PMID:35811015
Cldn3	Rat	lipopolysaccharide	decreases expression	ISO	RGD:68632	6480464	Lipopolysaccharides results in decreased expression of CLDN3 mRNA	CTD	PMID:35811015
Cldn3	Rat	loxoprofen	increases expression	ISO	RGD:68632	6480464	loxoprofen metabolite results in increased expression of CLDN3 protein; loxoprofen results in increased expression of more ...	CTD	PMID:34506768
Cldn3	Rat	melanins	multiple interactions	ISO	RGD:68632	6480464	[CLDN3 protein results in increased abundance of Copper] promotes the reaction [[TYR protein results in more ...	CTD	PMID:23053666
Cldn3	Rat	menadione	affects expression	ISO	RGD:68632	6480464	Vitamin K 3 affects the expression of CLDN3 mRNA	CTD	PMID:20044591
Cldn3	Rat	metacetamol	decreases expression	ISO	RGD:68633	6480464	3-hydroxyacetanilide results in decreased expression of CLDN3 mRNA	CTD	PMID:18544908
Cldn3	Rat	metformin	decreases expression	EXP		6480464	Metformin results in decreased expression of CLDN3 mRNA	CTD	PMID:31324951
Cldn3	Rat	N-methyl-4-phenylpyridinium	increases expression	ISO	RGD:68632	6480464	1-Methyl-4-phenylpyridinium results in increased expression of CLDN3 mRNA	CTD	PMID:24810058
Cldn3	Rat	naphthalene	increases expression	ISO	RGD:68633	6480464	naphthalene results in increased expression of CLDN3 mRNA	CTD	PMID:18978301
Cldn3	Rat	nickel atom	multiple interactions	ISO	RGD:68632	6480464	trichostatin A inhibits the reaction [Nickel affects the expression of CLDN3 mRNA]	CTD	PMID:14575637
Cldn3	Rat	nickel atom	affects expression	ISO	RGD:68632	6480464	Nickel affects the expression of CLDN3 mRNA	CTD	PMID:14575637
Cldn3	Rat	nitrofen	increases expression	EXP		6480464	nitrofen results in increased expression of CLDN3 mRNA	CTD	PMID:33484710
Cldn3	Rat	ochratoxin A	multiple interactions	ISO	RGD:68632	6480464	illite affects the reaction [ochratoxin A results in decreased expression of CLDN3 mRNA]	CTD	PMID:27153755
Cldn3	Rat	ochratoxin A	multiple interactions	ISO	RGD:68633	6480464	[ochratoxin A results in increased susceptibility to Antigens] which results in decreased expression of CLDN3 more ...	CTD	PMID:28935500
Cldn3	Rat	ochratoxin A	decreases expression	ISO	RGD:68632	6480464	ochratoxin A results in decreased expression of CLDN3 mRNA	CTD	PMID:27153755
Cldn3	Rat	ozone	increases expression	ISO	RGD:68632	6480464	Ozone results in increased expression of CLDN3 mRNA	CTD	PMID:23033980
Cldn3	Rat	paclitaxel	decreases response to substance	ISO	RGD:68632	6480464	CLDN3 protein results in decreased susceptibility to Paclitaxel	CTD	PMID:16734730
Cldn3	Rat	palmitoyl ethanolamide	decreases expression	ISO	RGD:68632	6480464	palmidrol results in decreased expression of CLDN3 mRNA	CTD	PMID:31054246
Cldn3	Rat	palmitoyl ethanolamide	multiple interactions	ISO	RGD:68632	6480464	[TNF protein co-treated with IFNG protein co-treated with palmidrol] results in decreased expression of CLDN3 more ...	CTD	PMID:31054246
Cldn3	Rat	paracetamol	affects expression	ISO	RGD:68633	6480464	Acetaminophen affects the expression of CLDN3 mRNA	CTD	PMID:17562736
Cldn3	Rat	paracetamol	decreases expression	ISO	RGD:68632	6480464	Acetaminophen results in decreased expression of CLDN3 mRNA	CTD	PMID:29067470
Cldn3	Rat	paracetamol	decreases expression	ISO	RGD:68633	6480464	Acetaminophen results in decreased expression of CLDN3 mRNA	CTD	PMID:18544908
Cldn3	Rat	patulin	affects localization	ISO	RGD:68632	6480464	Patulin affects the localization of CLDN3 protein	CTD	PMID:19013514
Cldn3	Rat	pentachlorophenol	decreases expression	ISO	RGD:68633	6480464	Pentachlorophenol results in decreased expression of CLDN3 mRNA	CTD	PMID:23892564
Cldn3	Rat	pentanal	increases expression	ISO	RGD:68632	6480464	pentanal results in increased expression of CLDN3 mRNA	CTD	PMID:26079696
Cldn3	Rat	phenobarbital	decreases expression	EXP		6480464	Phenobarbital results in decreased expression of CLDN3 mRNA	CTD	PMID:19162173
Cldn3	Rat	PhIP	multiple interactions	EXP		6480464	[2-amino-1-methyl-6-phenylimidazo(4,5-b)pyridine co-treated with Dietary Fats] results in decreased expression of CLDN3 mRNA	CTD	PMID:12097258
Cldn3	Rat	pirinixic acid	multiple interactions	ISO	RGD:68632	6480464	[pirinixic acid binds to and results in increased activity of PPARA protein] which results in more ...	CTD	PMID:19710929
Cldn3	Rat	pirinixic acid	decreases expression	ISO	RGD:68633	6480464	pirinixic acid results in decreased expression of CLDN3 mRNA	CTD	PMID:18445702
Cldn3	Rat	pregnenolone 16alpha-carbonitrile	decreases expression	EXP		6480464	Pregnenolone Carbonitrile results in decreased expression of CLDN3 mRNA	CTD	PMID:19162173
Cldn3	Rat	progesterone	affects expression	ISO	RGD:68633	6480464	Progesterone affects the expression of CLDN3 mRNA	CTD	PMID:17251523
Cldn3	Rat	propanal	increases expression	ISO	RGD:68632	6480464	propionaldehyde results in increased expression of CLDN3 mRNA	CTD	PMID:26079696
Cldn3	Rat	pyridaben	decreases expression	ISO	RGD:68633	6480464	pyridaben results in decreased expression of CLDN3 mRNA	CTD	PMID:22563483
Cldn3	Rat	rotenone	increases expression	EXP		6480464	Rotenone results in increased expression of CLDN3 mRNA	CTD	PMID:28374803
Cldn3	Rat	S-(1,2-dichlorovinyl)-L-cysteine	multiple interactions	ISO	RGD:68632	6480464	[S-(1,2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of CLDN3 mRNA	CTD	PMID:35811015
Cldn3	Rat	sanguinarine	decreases expression	ISO	RGD:68632	6480464	sanguinarine results in decreased expression of CLDN3 protein	CTD	PMID:19063874
Cldn3	Rat	sodium arsenite	decreases expression	ISO	RGD:68632	6480464	sodium arsenite results in decreased expression of CLDN3 mRNA; sodium arsenite results in decreased expression more ...	CTD	PMID:25879800\|PMID:34032870
Cldn3	Rat	sodium arsenite	decreases expression	ISO	RGD:68633	6480464	sodium arsenite results in decreased expression of CLDN3 mRNA	CTD	PMID:37682722
Cldn3	Rat	sodium arsenite	increases expression	ISO	RGD:68632	6480464	sodium arsenite results in increased expression of CLDN3 mRNA	CTD	PMID:29301061\|PMID:38568856
Cldn3	Rat	T-2 toxin	multiple interactions	ISO	RGD:68632	6480464	illite inhibits the reaction [T-2 Toxin results in decreased expression of CLDN3 mRNA]	CTD	PMID:27153755
Cldn3	Rat	T-2 toxin	decreases expression	ISO	RGD:68632	6480464	T-2 Toxin results in decreased expression of CLDN3 mRNA	CTD	PMID:27153755
Cldn3	Rat	tamoxifen	affects expression	ISO	RGD:68633	6480464	Tamoxifen affects the expression of CLDN3 mRNA	CTD	PMID:20937368
Cldn3	Rat	tetrachloroethene	decreases expression	ISO	RGD:68633	6480464	Tetrachloroethylene results in decreased expression of CLDN3 mRNA	CTD	PMID:28973375
Cldn3	Rat	tetrachloromethane	decreases expression	EXP		6480464	Carbon Tetrachloride results in decreased expression of CLDN3 mRNA	CTD	PMID:31150632
Cldn3	Rat	tetrachloromethane	decreases expression	ISO	RGD:68633	6480464	Carbon Tetrachloride results in decreased expression of CLDN3 mRNA	CTD	PMID:31919559
Cldn3	Rat	tetrachloromethane	multiple interactions	EXP		6480464	schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of CLDN3 mRNA]	CTD	PMID:31150632
Cldn3	Rat	thioacetamide	decreases expression	EXP		6480464	Thioacetamide results in decreased expression of CLDN3 mRNA	CTD	PMID:34492290
Cldn3	Rat	thiram	increases expression	ISO	RGD:68632	6480464	Thiram results in increased expression of CLDN3 mRNA	CTD	PMID:38568856
Cldn3	Rat	titanium dioxide	decreases methylation	ISO	RGD:68633	6480464	titanium dioxide results in decreased methylation of CLDN3 gene	CTD	PMID:35295148
Cldn3	Rat	titanium dioxide	decreases expression	ISO	RGD:68633	6480464	titanium dioxide results in decreased expression of CLDN3 mRNA	CTD	PMID:32333507
Cldn3	Rat	trichostatin A	multiple interactions	ISO	RGD:68632	6480464	[decitabine co-treated with trichostatin A] inhibits the reaction [MBD2 protein binds to CLDN3 promoter]; [decitabine more ...	CTD	PMID:14575637\|PMID:17986852
Cldn3	Rat	triclosan	decreases expression	ISO	RGD:68632	6480464	Triclosan results in decreased expression of CLDN3 mRNA	CTD	PMID:30510588
Cldn3	Rat	triptonide	increases expression	ISO	RGD:68633	6480464	triptonide results in increased expression of CLDN3 mRNA	CTD	PMID:33045310
Cldn3	Rat	tunicamycin	increases expression	ISO	RGD:68632	6480464	Tunicamycin results in increased expression of CLDN3 mRNA	CTD	PMID:22378314
Cldn3	Rat	valproic acid	increases methylation	ISO	RGD:68632	6480464	Valproic Acid results in increased methylation of CLDN3 gene	CTD	PMID:29154799
Cldn3	Rat	vancomycin	decreases expression	ISO	RGD:68633	6480464	Vancomycin results in decreased expression of CLDN3 mRNA	CTD	PMID:18930951
Cldn3	Rat	vinclozolin	increases methylation	EXP		6480464	vinclozolin results in increased methylation of CLDN3 gene	CTD	PMID:31682807
Cldn3	Rat	zoledronic acid	increases expression	ISO	RGD:68632	6480464	zoledronic acid results in increased expression of CLDN3 mRNA	CTD	PMID:20977926

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Cldn3	Rat	actin cytoskeleton organization	involved_in	ISO	RGD:68632	1624291	PMID:27593915	RGD	PMID:27593915
Cldn3	Rat	actin cytoskeleton organization	involved_in	IEA	UniProtKB:O15551\|ensembl:ENSP00000378577	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Cldn3	Rat	bicellular tight junction assembly	involved_in	IBA	PANTHER:PTN000243505\|UniProtKB:O15551\|UniProtKB:O95832	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Cldn3	Rat	bicellular tight junction assembly	involved_in	IEA	UniProtKB:O15551\|ensembl:ENSP00000378577	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Cldn3	Rat	bicellular tight junction assembly	involved_in	ISO	RGD:68632	1624291	PMID:20655293, PMID:25849148	RGD	PMID:20655293\|PMID:25849148
Cldn3	Rat	calcium-independent cell-cell adhesion via plasma membrane cell-adhesion molecules	involved_in	ISS	UniProtKB:Q9Z0G9	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Cldn3	Rat	calcium-independent cell-cell adhesion via plasma membrane cell-adhesion molecules	involved_in	IEA	UniProtKB:Q9Z0G9\|ensembl:ENSMUSP00000091799	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Cldn3	Rat	calcium-independent cell-cell adhesion via plasma membrane cell-adhesion molecules	involved_in	ISO	RGD:68633	1624291	PMID:10508613	RGD	PMID:10508613
Cldn3	Rat	cell adhesion	involved_in	IBA	MGI:106925\|MGI:1276109\|MGI:1276110\|MGI:1329044\|PANTHER:PTN000243505\|ZFIN:ZDB-GENE-001103-5	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Cldn3	Rat	cell junction assembly	involved_in	ISO	RGD:68632	1624291	PMID:27593915	RGD	PMID:27593915
Cldn3	Rat	cell junction assembly	involved_in	IEA	UniProtKB:O15551\|ensembl:ENSP00000378577	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Cldn3	Rat	cell junction maintenance	involved_in	ISO	RGD:68633	1624291	PMID:12734665	RGD	PMID:12734665
Cldn3	Rat	cell junction maintenance	involved_in	IEA	UniProtKB:Q9Z0G9\|ensembl:ENSMUSP00000091799	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Cldn3	Rat	cell-cell junction maintenance	involved_in	IEA	UniProtKB:O15551\|ensembl:ENSP00000378577	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Cldn3	Rat	cell-cell junction maintenance	involved_in	ISO	RGD:68632	1624291	PMID:36008380	RGD	PMID:36008380
Cldn3	Rat	epithelial cell morphogenesis	involved_in	ISS	UniProtKB:Q9Z0G9	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Cldn3	Rat	epithelial cell morphogenesis	involved_in	IEA	UniProtKB:Q9Z0G9\|ensembl:ENSMUSP00000091799	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Cldn3	Rat	epithelial cell morphogenesis	involved_in	ISO	RGD:68633	1624291	PMID:22696678	RGD	PMID:22696678
Cldn3	Rat	establishment of endothelial blood-brain barrier	involved_in	ISO	RGD:68633	1624291	PMID:12734665	RGD	PMID:12734665
Cldn3	Rat	establishment of endothelial blood-brain barrier	involved_in	IEA	UniProtKB:Q9Z0G9\|ensembl:ENSMUSP00000091799	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Cldn3	Rat	negative regulation of cell migration	involved_in	ISO	RGD:68632	1624291	PMID:27593915	RGD	PMID:27593915
Cldn3	Rat	negative regulation of cell migration	involved_in	IEA	UniProtKB:O15551\|ensembl:ENSP00000378577	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Cldn3	Rat	negative regulation of cell population proliferation	involved_in	ISO	RGD:68632	1624291	PMID:27593915	RGD	PMID:27593915
Cldn3	Rat	negative regulation of cell population proliferation	involved_in	IEA	UniProtKB:O15551\|ensembl:ENSP00000378577	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Cldn3	Rat	negative regulation of gene expression	involved_in	ISO	RGD:68632	1624291	PMID:27593915	RGD	PMID:27593915
Cldn3	Rat	negative regulation of gene expression	involved_in	IEA	UniProtKB:O15551\|ensembl:ENSP00000378577	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Cldn3	Rat	negative regulation of phosphate transmembrane transport	involved_in	IEA	UniProtKB:O15551\|ensembl:ENSP00000378577	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Cldn3	Rat	negative regulation of phosphate transmembrane transport	involved_in	ISO	RGD:68632	1624291	PMID:36008380	RGD	PMID:36008380
Cldn3	Rat	positive regulation of cell migration	involved_in	ISO	RGD:68632	1624291	PMID:16103090	RGD	PMID:16103090
Cldn3	Rat	positive regulation of cell migration	involved_in	IEA	UniProtKB:O15551\|ensembl:ENSP00000378577	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Cldn3	Rat	positive regulation of gene expression	involved_in	ISO	RGD:68632	1624291	PMID:27593915	RGD	PMID:27593915
Cldn3	Rat	positive regulation of gene expression	involved_in	IEA	UniProtKB:O15551\|ensembl:ENSP00000378577	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Cldn3	Rat	positive regulation of wound healing	involved_in	ISO	RGD:68632	1624291	PMID:16103090	RGD	PMID:16103090
Cldn3	Rat	positive regulation of wound healing	involved_in	IEA	UniProtKB:O15551\|ensembl:ENSP00000378577	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Cldn3	Rat	regulation of cell morphogenesis	involved_in	ISO	RGD:68632	1624291	PMID:16103090	RGD	PMID:16103090
Cldn3	Rat	regulation of cell morphogenesis	involved_in	IEA	UniProtKB:O15551\|ensembl:ENSP00000378577	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Cldn3	Rat	regulation of membrane permeability	involved_in	ISO	RGD:68632	1624291	PMID:20655293	RGD	PMID:20655293
Cldn3	Rat	regulation of membrane permeability	involved_in	IEA	UniProtKB:O15551\|ensembl:ENSP00000378577	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Cldn3	Rat	regulation of transepithelial transport	involved_in	ISO	RGD:68632	1624291	PMID:27593915	RGD	PMID:27593915
Cldn3	Rat	regulation of transepithelial transport	involved_in	IEA	UniProtKB:O15551\|ensembl:ENSP00000378577	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Cldn3	Rat	response to ethanol		IEP		11344881		RGD
Cldn3	Rat	response to Gram-positive bacterium		IEP		2324672	Bifidobacterium bifidum	RGD
Cldn3	Rat	response to hypoxia	involved_in	ISO	RGD:68632	1624291	PMID:15174142	RGD	PMID:15174142
Cldn3	Rat	response to hypoxia	involved_in	IEA	UniProtKB:O15551\|ensembl:ENSP00000378577	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Cldn3	Rat	retinal pigment epithelium development	involved_in	ISO	RGD:68632	1624291	PMID:27593915	RGD	PMID:27593915
Cldn3	Rat	retinal pigment epithelium development	involved_in	IEA	UniProtKB:O15551\|ensembl:ENSP00000378577	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Cldn3	Rat	anchoring junction	located_in	IEA	UniProtKB-KW:KW-0965	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Cldn3	Rat	apical junction complex	located_in	ISO	RGD:68632	1624291	PMID:27593915	RGD	PMID:27593915
Cldn3	Rat	apical junction complex	located_in	IEA	UniProtKB:O15551\|ensembl:ENSP00000378577	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Cldn3	Rat	apicolateral plasma membrane	located_in	IEA	UniProtKB:Q9Z0G9\|ensembl:ENSMUSP00000091799	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Cldn3	Rat	apicolateral plasma membrane	located_in	ISO	RGD:68633	1624291	PMID:9892664	RGD	PMID:9892664
Cldn3	Rat	bicellular tight junction		IDA		727233		RGD
Cldn3	Rat	bicellular tight junction	located_in	IEA	UniProtKB-SubCell:SL-0265	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Cldn3	Rat	bicellular tight junction	located_in	IEA	InterPro:IPR003549\|InterPro:IPR006187	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Cldn3	Rat	bicellular tight junction	located_in	IEA	UniProtKB:O15551\|ensembl:ENSP00000378577	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Cldn3	Rat	bicellular tight junction	located_in	IEA	UniProtKB:Q9Z0G9\|ensembl:ENSMUSP00000091799	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Cldn3	Rat	bicellular tight junction	located_in	IEA	UniProtKB-KW:KW-0796	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Cldn3	Rat	bicellular tight junction	is_active_in	IBA	MGI:106925\|MGI:1276109\|MGI:1276110\|MGI:1276112\|MGI:1313314\|MGI:1329044\|MGI:1859284\|MGI:1859285\|MGI:1859286\|MGI:1860425\|MGI:1913100\|MGI:1913101\|MGI:2148742\|MGI:3033992\|PANTHER:PTN000243505\|RGD:620322\|RGD:68422\|RGD:68425\|UniProtKB:O00501\|UniProtKB:O14493\|UniProtKB:O15551\|UniProtKB:O95832\|UniProtKB:Q2HJ22\|UniProtKB:Q8N6F1\|UniProtKB:Q98SR2\|ZFIN:ZDB-GENE-040426-1305\|ZFIN:ZDB-GENE-040718-145	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Cldn3	Rat	bicellular tight junction	located_in	ISO	RGD:68633	1624291	PMID:16520537, PMID:22155109, PMID:22275141, PMID:22696678, PMID:24889144, PMID:9892664	RGD	PMID:16520537\|PMID:22155109\|PMID:22275141\|PMID:22696678\|PMID:24889144\|PMID:9892664
Cldn3	Rat	bicellular tight junction	located_in	ISO	RGD:68632	1624291	PMID:25849148	RGD	PMID:25849148
Cldn3	Rat	bicellular tight junction	located_in	ISS	UniProtKB:Q9Z0G9	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Cldn3	Rat	cell-cell junction	located_in	ISO	RGD:68633	1624291	PMID:12734665	RGD	PMID:12734665
Cldn3	Rat	cell-cell junction	located_in	IEA	UniProtKB:O15551\|ensembl:ENSP00000378577	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Cldn3	Rat	cell-cell junction	located_in	IEA	UniProtKB:Q9Z0G9\|ensembl:ENSMUSP00000091799	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Cldn3	Rat	cell-cell junction	located_in	ISO	RGD:68632	1624291	PMID:18774778	RGD	PMID:18774778
Cldn3	Rat	lateral plasma membrane		IDA		2325127		RGD
Cldn3	Rat	lateral plasma membrane	located_in	IEA	UniProtKB:Q9Z0G9\|ensembl:ENSMUSP00000091799	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Cldn3	Rat	lateral plasma membrane	located_in	ISO	RGD:68633	1624291	PMID:22275141	RGD	PMID:22275141
Cldn3	Rat	membrane	located_in	IEA	InterPro:IPR004031	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Cldn3	Rat	membrane	located_in	IEA	UniProtKB-KW:KW-0472	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Cldn3	Rat	plasma membrane	located_in	ISO	RGD:68633	1624291	PMID:24588076	RGD	PMID:24588076
Cldn3	Rat	plasma membrane	located_in	IEA	UniProtKB-KW:KW-1003	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Cldn3	Rat	plasma membrane	located_in	IEA	UniProtKB:Q9Z0G9\|ensembl:ENSMUSP00000091799	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Cldn3	Rat	plasma membrane	located_in	IEA	UniProtKB-SubCell:SL-0039	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Cldn3	Rat	plasma membrane	is_active_in	IBA	MGI:1276109\|MGI:1276112\|MGI:1313314\|MGI:1329044\|MGI:1859284\|MGI:1859285\|MGI:1859286\|MGI:1860425\|MGI:1913100\|MGI:1913101\|MGI:1913102\|MGI:1913103\|MGI:1929209\|MGI:3033992\|MGI:3712484\|PANTHER:PTN000243505\|RGD:1307932\|RGD:68422\|RGD:68425\|RGD:68431\|RGD:68432\|UniProtKB:O00501\|UniProtKB:O14493\|UniProtKB:O75508\|UniProtKB:O95471\|UniProtKB:O95484\|UniProtKB:O95832\|UniProtKB:P56747\|UniProtKB:P56750\|UniProtKB:P56880\|UniProtKB:P78369\|UniProtKB:Q8N6F1	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Cldn3	Rat	protein-containing complex	part_of	ISO	RGD:68632	1624291	PMID:25849148	RGD	PMID:25849148
Cldn3	Rat	protein-containing complex	part_of	IEA	UniProtKB:O15551\|ensembl:ENSP00000378577	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Cldn3	Rat	tight junction	located_in	ISO	RGD:68632	1624291	PMID:20655293, PMID:30734065	RGD	PMID:20655293\|PMID:30734065
Cldn3	Rat	tight junction	located_in	IEA	UniProtKB:Q9Z0G9\|ensembl:ENSMUSP00000091799	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Cldn3	Rat	tight junction	located_in	IEA	UniProtKB:O15551\|ensembl:ENSP00000378577	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Cldn3	Rat	tight junction	located_in	ISO	RGD:68633	1624291	PMID:24588076, PMID:36008380	RGD	PMID:24588076\|PMID:36008380

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Cldn3	Rat	cell-cell adhesion mediator activity	enables	ISO	RGD:68632	1624291	PMID:27593915	RGD	PMID:27593915
Cldn3	Rat	cell-cell adhesion mediator activity	enables	IEA	UniProtKB:O15551\|ensembl:ENSP00000378577	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Cldn3	Rat	identical protein binding	enables	ISS	UniProtKB:O15551	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Cldn3	Rat	identical protein binding	enables	IEA	UniProtKB:O15551\|ensembl:ENSP00000378577	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Cldn3	Rat	identical protein binding	enables	IEA	UniProtKB:Q9Z0G9\|ensembl:ENSMUSP00000091799	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Cldn3	Rat	identical protein binding	enables	ISO	RGD:68633	1624291	UniProtKB:Q9Z0G9 PMID:10562289	RGD	PMID:10562289
Cldn3	Rat	identical protein binding	enables	ISS	UniProtKB:Q9Z0G9	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Cldn3	Rat	identical protein binding	enables	ISO	RGD:68632	1624291	UniProtKB:O15551 PMID:25849148, PMID:28028216, PMID:36008380	RGD	PMID:25849148\|PMID:28028216\|PMID:36008380
Cldn3	Rat	protein binding	enables	ISO	RGD:68632	1624291	UniProtKB:O95832\|UniProtKB:P57739\|UniProtKB:Q8N6F1-2 PMID:25849148, PMID:28028216, PMID:36008380	RGD	PMID:25849148\|PMID:28028216\|PMID:36008380
Cldn3	Rat	protein binding	enables	ISO	RGD:68633	1624291	UniProtKB:O88551\|UniProtKB:O88552\|UniProtKB:P01558\|UniProtKB:P39447\|UniProtKB:Q9QXY1\|UniProtKB:Q9Z0U1 PMID:10562289, PMID:10601346, PMID:25678664	RGD	PMID:10562289\|PMID:10601346\|PMID:25678664
Cldn3	Rat	structural molecule activity	enables	IEA	InterPro:IPR003549\|InterPro:IPR006187	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Cldn3	Rat	structural molecule activity	enables	ISO	RGD:68632	1624291	PMID:36008380	RGD	PMID:36008380
Cldn3	Rat	structural molecule activity	enables	IEA	UniProtKB:O15551\|ensembl:ENSP00000378577	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107

Molecular Pathway Annotations Click to see Annotation Detail View

Imported Annotations - KEGG (archival)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Cldn3	Rat	hepatitis C pathway		IEA		6907045		KEGG	rno:05160

Disease Annotations Click to see Annotation Detail View

allergic rhinitis (ISO)

autism spectrum disorder (ISO)

autistic disorder (ISO)

Intestinal Reperfusion Injury (IEP)

intestinal volvulus (ISO)

Neurodevelopmental Disorders (ISO)

peptic esophagitis (IEP)

pleomorphic xanthoastrocytoma (ISO)

Prostatic Neoplasms (ISO)

schizophrenia (ISO)

Stomach Neoplasms (ISO)

supravalvular aortic stenosis (ISO)

Volvulus Of Midgut (ISO)

Williams-Beuren syndrome (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (ISO)

17beta-hydroxy-17-methylestra-4,9,11-trien-3-one (ISO)

2,2',5,5'-tetrachlorobiphenyl (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

2,4-dinitrotoluene (EXP)

3-Nitrobenzanthrone (ISO)

4,4'-diaminodiphenylmethane (ISO)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

5-aza-2'-deoxycytidine (ISO)

6-propyl-2-thiouracil (EXP)

7,12-dimethyltetraphene (EXP)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

ammonium chloride (EXP)

antigen (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

benzo[a]pyrene (ISO)

bexarotene (EXP)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

bromobenzene (EXP)

butanal (ISO)

cadmium dichloride (EXP,ISO)

caffeine (ISO)

calcitriol (ISO)

capecitabine (ISO)

carbamazepine (ISO)

ciguatoxin CTX1B (ISO)

cisplatin (ISO)

clofibrate (ISO)

copper atom (EXP,ISO)

copper(0) (EXP,ISO)

cordycepin (ISO)

coumarin (ISO)

cyclosporin A (ISO)

deoxynivalenol (ISO)

dexamethasone (ISO)

diallyl disulfide (ISO)

diallyl trisulfide (ISO)

dibenzo[a,l]pyrene (ISO)

dicrotophos (ISO)

dicyclanil (ISO)

diethyl phthalate (EXP)

diethylstilbestrol (ISO)

dioxygen (ISO)

doxifluridine (ISO)

endosulfan (EXP)

epoxiconazole (ISO)

folic acid (ISO)

Forsythiaside (ISO)

fumonisin B1 (ISO)

furan (EXP)

genistein (EXP)

glycidol (EXP)

hydrogen peroxide (ISO)

isoflavones (ISO)

kojic acid (ISO)

lipopolysaccharide (ISO)

loxoprofen (ISO)

melanins (ISO)

menadione (ISO)

metacetamol (ISO)

metformin (EXP)

N-methyl-4-phenylpyridinium (ISO)

naphthalene (ISO)

nickel atom (ISO)

nitrofen (EXP)

ochratoxin A (ISO)

ozone (ISO)

paclitaxel (ISO)

palmitoyl ethanolamide (ISO)

paracetamol (ISO)

patulin (ISO)

pentachlorophenol (ISO)

pentanal (ISO)

phenobarbital (EXP)

PhIP (EXP)

pirinixic acid (ISO)

pregnenolone 16alpha-carbonitrile (EXP)

progesterone (ISO)

propanal (ISO)

pyridaben (ISO)

rotenone (EXP)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

sanguinarine (ISO)

sodium arsenite (ISO)

T-2 toxin (ISO)

tamoxifen (ISO)

tetrachloroethene (ISO)

tetrachloromethane (EXP,ISO)

thioacetamide (EXP)

thiram (ISO)

titanium dioxide (ISO)

trichostatin A (ISO)

triclosan (ISO)

triptonide (ISO)

tunicamycin (ISO)

valproic acid (ISO)

vancomycin (ISO)

vinclozolin (EXP)

zoledronic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

actin cytoskeleton organization (IEA,ISO)

bicellular tight junction assembly (IBA,IEA,ISO)

calcium-independent cell-cell adhesion via plasma membrane cell-adhesion molecules (IEA,ISO,ISS)

cell adhesion (IBA)

cell junction assembly (IEA,ISO)

cell junction maintenance (IEA,ISO)

cell-cell junction maintenance (IEA,ISO)

epithelial cell morphogenesis (IEA,ISO,ISS)

establishment of endothelial blood-brain barrier (IEA,ISO)

negative regulation of cell migration (IEA,ISO)

negative regulation of cell population proliferation (IEA,ISO)

negative regulation of gene expression (IEA,ISO)

negative regulation of phosphate transmembrane transport (IEA,ISO)

positive regulation of cell migration (IEA,ISO)

positive regulation of gene expression (IEA,ISO)

positive regulation of wound healing (IEA,ISO)

regulation of cell morphogenesis (IEA,ISO)

regulation of membrane permeability (IEA,ISO)

regulation of transepithelial transport (IEA,ISO)

response to ethanol (IEP)

response to Gram-positive bacterium (IEP)

response to hypoxia (IEA,ISO)

retinal pigment epithelium development (IEA,ISO)

Cellular Component

anchoring junction (IEA)

apical junction complex (IEA,ISO)

apicolateral plasma membrane (IEA,ISO)

bicellular tight junction (IBA,IDA,IEA,ISO,ISS)

cell-cell junction (IEA,ISO)

lateral plasma membrane (IDA,IEA,ISO)

membrane (IEA)

plasma membrane (IBA,IEA,ISO)

protein-containing complex (IEA,ISO)

tight junction (IEA,ISO)

Molecular Function

cell-cell adhesion mediator activity (IEA,ISO)

identical protein binding (IEA,ISO,ISS)

protein binding (ISO)

structural molecule activity (IEA,ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

hepatitis C pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Isolation and characterization of transcripts induced by androgen withdrawal and apoptotic cell death in the rat ventral prostate.	Briehl MM and Miesfeld RL, Mol Endocrinol 1991 Oct;5(10):1381-8.
2.	Chronic alcohol ingestion alters claudin expression in the alveolar epithelium of rats.	Fernandez AL, etal., Alcohol. 2007 Aug;41(5):371-9.
3.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
5.	Bifidobacterium bifidum improves intestinal integrity in a rat model of necrotizing enterocolitis.	Khailova L, etal., Am J Physiol Gastrointest Liver Physiol. 2009 Aug 27.
6.	Altered distribution of tight junction proteins after intestinal ischaemia/reperfusion injury in rats.	Li Q, etal., J Cell Mol Med. 2009 Sep;13(9B):4061-76. Epub 2009 Nov 19.
7.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
8.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
9.	Dissociation and dispersion of claudin-3 from the tight junction could be one of the most sensitive indicators of reflux esophagitis in a rat model of the disease.	Oguro M, etal., J Gastroenterol. 2011 May;46(5):629-38. doi: 10.1007/s00535-011-0390-1. Epub 2011 Mar 5.
10.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
11.	Heterogeneity in expression and subcellular localization of claudins 2, 3, 4, and 5 in the rat liver, pancreas, and gut.	Rahner C, etal., Gastroenterology 2001 Feb;120(2):411-22.
12.	GOA pipeline	RGD automated data pipeline
13.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
14.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
15.	Tentative Sequence Identification Numbers	Tentative Sequence Data IDs. TIGR Gene Index, Rat Data

Additional References at PubMed

PMID:9892664	PMID:10508613	PMID:10562289	PMID:12734665	PMID:15174142	PMID:15489334	PMID:16103090	PMID:16520537	PMID:18036336	PMID:18774778	PMID:19525861	PMID:19765733
PMID:20655293	PMID:21515662	PMID:22155109	PMID:22275141	PMID:22696678	PMID:23376485	PMID:24889144	PMID:24928064	PMID:25475725	PMID:25649016	PMID:25849148	PMID:27038183
PMID:27593915	PMID:30734065

Genomics

Comparative Map Data

Cldn3
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	12	27,345,075 - 27,346,547 (-)	NCBI		GRCr8
mRatBN7.2	12	21,708,538 - 21,710,010 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	21,708,398 - 21,711,001 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	12	22,849,399 - 22,850,871 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	12	23,461,727 - 23,463,199 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	12	22,529,747 - 22,531,219 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	12	21,831,341 - 21,832,813 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	21,831,342 - 21,832,813 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	12	23,849,259 - 23,850,731 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
Celera	12	23,471,431 - 23,472,903 (-)	NCBI		Celera
Cytogenetic Map	12	q12	NCBI

CLDN3
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	7	73,768,997 - 73,770,270 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	7	73,768,997 - 73,770,270 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	7	73,183,327 - 73,184,600 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	7	72,821,263 - 72,822,512 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	7	72,627,978 - 72,629,227	NCBI
Celera	7	68,661,514 - 68,662,787 (-)	NCBI		Celera
Cytogenetic Map	7	q11.23	NCBI
HuRef	7	69,065,982 - 69,067,255 (-)	NCBI		HuRef
CHM1_1	7	73,329,029 - 73,330,302 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	7	74,969,874 - 74,971,147 (-)	NCBI		T2T-CHM13v2.0
CRA_TCAGchr7v2	7	72,516,399 - 72,517,672 (-)	NCBI

Cldn3
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	5	135,015,068 - 135,016,330 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	5	135,015,068 - 135,016,326 (+)	Ensembl		GRCm39 Ensembl
GRCm38	5	134,986,214 - 134,987,476 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	5	134,986,214 - 134,987,472 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	5	135,462,084 - 135,463,342 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	5	135,270,841 - 135,272,099 (+)	NCBI		MGSCv36	mm8
Celera	5	131,997,044 - 131,998,302 (+)	NCBI		Celera
Cytogenetic Map	5	G2	NCBI
cM Map	5	74.93	NCBI

CLDN3
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	6	91,123,883 - 91,130,587 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	7	139,393,595 - 139,395,219 (+)	NCBI		NHGRI_mPanPan1
PanPan1.1	7	80,924,338 - 80,925,761 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	7	80,924,731 - 80,925,393 (-)	Ensembl	panpan1.1		panPan2

CLDN3
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	6	6,534,229 - 6,535,237 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	6	8,231,695 - 8,232,703 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	6	6,349,000 - 6,350,005 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	6	6,348,948 - 6,350,256 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	6	6,338,822 - 6,339,825 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	6	6,286,583 - 6,287,588 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	6	6,450,257 - 6,451,264 (+)	NCBI		UU_Cfam_GSD_1.0

Cldn3
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409344	131,083,239 - 131,084,510 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936543	2,951,086 - 2,953,956 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936543	2,952,054 - 2,953,313 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CLDN3
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	3	11,019,073 - 11,020,102 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	3	11,019,073 - 11,020,102 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	3	10,715,404 - 10,716,250 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

CLDN3
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	28	9,301,312 - 9,303,496 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	28	9,302,446 - 9,303,108 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666070	7,203,761 - 7,205,348 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Cldn3
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624740	14,065,478 - 14,066,137 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624740	14,065,172 - 14,066,432 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Cldn3
8 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	66
Count of miRNA genes:	61
Interacting mature miRNAs:	62
Transcripts:	ENSRNOT00000075280
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
631560	Apr1	Acute phase response QTL 1	6.1		orosomucoid 1 amount (VT:0010541)	plasma orosomucoid 1 level (CMO:0001467)	12	19144362	46669029	Rat
8552964	Pigfal17	Plasma insulin-like growth factor 1 level QTL 17	3.5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	5564495	46669029	Rat
61324	Eae5	Experimental allergic encephalomyelitis QTL 5	14		nervous system integrity trait (VT:0010566)	percentage of study population developing relapsing-remitting experimental autoimmune encephalomyelitis during a period of time (CMO:0001402)	12	19610870	46669029	Rat
9590147	Scort7	Serum corticosterone level QTL 7	13.61	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	12	1	42110980	Rat
1549829	Scl48	Serum cholesterol level QTL 48	5		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	12	9603277	46669029	Rat
61331	Eau2	Experimental allergic uveoretinitis QTL 2		0.0005	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	12	8525423	28064601	Rat
737822	Alc10	Alcohol consumption QTL 10	2.2		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	12	19610870	40218516	Rat
2293684	Bmd26	Bone mineral density QTL 26	4.4	0.0002	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	12	15872653	32974238	Rat
6893681	Bw109	Body weight QTL 109	2.3	0.004	body mass (VT:0001259)	body weight (CMO:0000012)	12	1	23297788	Rat
1302792	Scl21	Serum cholesterol level QTL 21	3.8	0.0011	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	12	7196730	46669029	Rat
1598855	Bp294	Blood pressure QTL 294	3.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	1	34851688	Rat
10755457	Coatc14	Coat color QTL 14		0.01759	coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	12	1	22591684	Rat
1331761	Bp218	Blood pressure QTL 218	2.973		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	12	11073825	45055165	Rat
8694179	Bw150	Body weight QTL 150	2.9	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	12	1	42110980	Rat
7411545	Bw128	Body weight QTL 128	5.2	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	12	1	42110980	Rat
7411547	Bw129	Body weight QTL 129		0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	6	5564495	46669029	Rat
1300157	Rf21	Renal function QTL 21	4.4		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	12	9318216	32103380	Rat
737979	Pia22	Pristane induced arthritis QTL 22	53.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	1	44465750	Rat
1298081	Cia25	Collagen induced arthritis QTL 25	4.7		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	19610889	35682913	Rat
2300186	Bmd59	Bone mineral density QTL 59	7.1	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	12	10474137	46669029	Rat
7411660	Foco28	Food consumption QTL 28	10.9	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	1	42110980	Rat
1331755	Bp219	Blood pressure QTL 219	3.041		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	12	11073825	28064557	Rat
70213	Niddm27	Non-insulin dependent diabetes mellitus QTL 27	3.72		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	19835789	38193007	Rat
2306789	Ean6	Experimental allergic neuritis QTL 6	4.9		nervous system integrity trait (VT:0010566)	experimental autoimmune neuritis severity score (CMO:0001528)	12	19610870	24139202	Rat
7411641	Foco19	Food consumption QTL 19	27.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	5564495	46669029	Rat
7411643	Foco20	Food consumption QTL 20		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	20328819	46669029	Rat
5684888	Pia42	Pristane induced arthritis QTL 42			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	19610870	42828880	Rat
1549912	Bp268	Blood pressure QTL 268			arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	10	13182736	46669029	Rat
2302060	Pia37	Pristane induced arthritis QTL 37	6.1	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	12	13198157	46669029	Rat
1641928	Alcrsp5	Alcohol response QTL 5			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	12	12812385	46669029	Rat
8552912	Pigfal6	Plasma insulin-like growth factor 1 level QTL 6	5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	5564498	46669029	Rat
10059594	Kidm46	Kidney mass QTL 46	3.79	0.025	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	12	6107579	46669029	Rat
1581516	Cm56	Cardiac mass QTL 56	4.2	0.05	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	12	1	29333307	Rat
9590086	Insglur6	Insulin/glucose ratio QTL 6	18.97	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	12	1	42110980	Rat
8552918	Pigfal7	Plasma insulin-like growth factor 1 level QTL 7			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	5564495	46669029	Rat
1549902	Bp269	Blood pressure QTL 269			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	13182736	46669029	Rat
61404	Bw120	Body weight QTL 120	5.1		body mass (VT:0001259)	body mass index (BMI) (CMO:0000105)	12	12351619	46669029	Rat
1331786	Kidm11	Kidney mass QTL 11	3.571		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	12	11073825	24234895	Rat
2293699	Bss49	Bone structure and strength QTL 49	5.61	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra trabecular cross-sectional area (CMO:0001692)	12	10474137	46669029	Rat
634351	Apr5	Acute phase response QTL 5	6.7		blood interleukin-6 amount (VT:0008595)	plasma interleukin-6 level (CMO:0001927)	12	1	44503507	Rat
634350	Apr4	Acute phase response QTL 4	6		orosomucoid 1 amount (VT:0010541)	plasma orosomucoid 1 level (CMO:0001467)	12	1172005	46172005	Rat
61416	Pia4	Pristane induced arthritis QTL 4	8.4		joint integrity trait (VT:0010548)	arthritic paw count (CMO:0001460)	12	13635523	30827399	Rat
631521	Pia12	Pristane induced arthritis QTL 12	8.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	20259417	23672083	Rat
7387292	Kidm42	Kidney mass QTL 42	3.03	0.0004	kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	12	1	36247923	Rat
61421	Cia12	Collagen induced arthritis QTL 12	4.6		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	13635523	35682913	Rat
2303569	Gluco44	Glucose level QTL 44	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	12812385	46669029	Rat
7411586	Foco5	Food consumption QTL 5	5.4	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	1	42110980	Rat
2303575	Insul14	Insulin level QTL 14	4		blood insulin amount (VT:0001560)	blood insulin level (CMO:0000349)	12	1	42450532	Rat
7411588	Foco6	Food consumption QTL 6		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	5564495	46669029	Rat
2302042	Pia38	Pristane induced arthritis QTL 38	3.5	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	12	1	44503507	Rat
7411595	Foco9	Food consumption QTL 9	4	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	1	42110980	Rat
7411597	Foco10	Food consumption QTL 10		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	5564495	46669029	Rat
2293086	Iddm30	Insulin dependent diabetes mellitus QTL 30	3.82		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	8449490	28302290	Rat
631543	Bp83	Blood pressure QTL 83	5.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	15550826	38478808	Rat

Markers in Region

RH144525

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	12	21,709,640 - 21,709,809 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	21,832,444 - 21,832,612	NCBI	Rnor6.0
Rnor_5.0	12	23,850,362 - 23,850,530	UniSTS	Rnor5.0
Celera	12	23,472,534 - 23,472,702	UniSTS
RH 3.4 Map	12	344.3	UniSTS

RH139762

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	12	21,708,690 - 21,708,878 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	21,831,494 - 21,831,681	NCBI	Rnor6.0
Rnor_5.0	12	23,849,412 - 23,849,599	UniSTS	Rnor5.0
Celera	12	23,471,584 - 23,471,771	UniSTS
RH 3.4 Map	12	310.6	UniSTS

Cldn3

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	12	21,708,910 - 21,709,570 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	21,831,714 - 21,832,373	NCBI	Rnor6.0
Rnor_5.0	12	23,849,632 - 23,850,291	UniSTS	Rnor5.0
Celera	12	23,471,804 - 23,472,463	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	9	18	104	86	88	57	21	57	6	175	56	87	45	59	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_031700	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AJ011656	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC062411	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473973	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000012	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M74067	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000075280 ⟹ ENSRNOP00000064411

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	12	21,708,398 - 21,711,001 (-)	Ensembl
Rnor_6.0 Ensembl	12	21,831,342 - 21,832,813 (-)	Ensembl

RefSeq Acc Id:

NM_031700 ⟹ NP_113888

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	27,345,075 - 27,346,547 (-)	NCBI
mRatBN7.2	12	21,708,538 - 21,710,010 (-)	NCBI
Rnor_6.0	12	21,831,341 - 21,832,813 (-)	NCBI
Rnor_5.0	12	23,849,259 - 23,850,731 (-)	NCBI
Celera	12	23,471,431 - 23,472,903 (-)	RGD

Sequence:

show sequence

CCCCATCCCCACCCACACGCACACACATATATAGTTCTGCATTGAGGTTGGTTCTAGCTAATTC
CTTTCTCCCATGGTGAAGAGGGTTGGGGAGTACCGATCGGACTGGACGGGACACACGTCACTGT
CCCCTGGGCCAGAAGAGCGAGCTCCGCCCTCCTCCTCTGGGCACCAAGCTAAGTCCAACCCACC
CCATCCCAGAGCCAACCCAGTCTCAGAAAGACGTCTCCAAAGCCACAGGCAGGTGCAGGGGCAG
TCTCCGTGCGAGCCCCGGGAAAGGAGCCGTTAGCGTGCTCCGTCCATTGCCATCCACCGGTCGT
TCCCGGCGACAGACCTCCGTCAACTTTTGAAGGGGAGTTGGTTCTCAGGTCCAGCGGCCGCGAT
CCCTGGTCTCCCAGCCTACGGAGTTACCCGGCGGAGCCGGTTCAAGTCCAGCAGCCATGTCCAT
GGGCCTGGAGATCACCGGCACGTCGCTGGCCGTGCTGGGCTGGCTGTGCACCATCGTGTGCTGC
GCCCTTCCCATGTGGCGCGTTTCGGCATTCATCGGCAGCAGCATCATCACGGCGCAGATCACCT
GGGAAGGCCTGTGGATGAACTGCGTGGTGCAGAGCACCGGCCAGATGCAGTGCAAGATGTACGA
CTCGCTGCTGGCCCTGCCGCAGGACCTCCAGGCCGCCCGAGCTCTCATCGTGGTGTCTATCCTA
CTGGCAGCCTTCGGGCTCCTCGTGGCGCTCGTGGGGGCCCAGTGTACCAACTGCGTACAAGATG
AGACGGCCAAGGCCAAGATCACCATCGTGGCGGGAGTGCTTTTCCTGTTGGCGGCTGTGCTCAC
CTTAGTGCCGGTGTCCTGGTCCGCCAACACCATCATCCGGGATTTTTATAACCCGCTGGTACCT
GAGGCCCAGAAGCGAGAGATGGGAACTGGGTTGTACGTGGGCTGGGCTGCCGCCGCGCTGCAAT
TGCTAGGGGGCGCCTTGCTGTGTTGCTCCTGCCCACCACGCGAGAAGTACGCACCCACCAAGAT
CCTCTATTCCGCGCCGCGATCCACCGGCCCTGGCACCGGTACCGGCACCGCCTATGACCGTAAG
GACTACGTCTGAGAGGCCGGGTGCGCGCACACCGCACCATCACCACTACCAACCGTCGATGTAC
CCCACCCGTCCAGCGTGCAGCCTCGCCTCAGAGACCACCCCACCTTCCAGATGGTTACAGACGC
CACGCAGTCTGCTTGCTAGGCTGGAAGAGGACAGACAGCCTGGCGTCCCCTTTTCTCCGGTTGC
CACCTGATTACCTGGCCTAGGAACTGTCCAAGTCGAATGGACAAAGACACCTCGCCCTTCCCAA
GTACAGGGTTGGGGTGGCCATCGCAGCTACTTGCCAGCCCCGCAGCCAGAAGGCTCATAGTGGG
CAGAGACAGGCAAACTATAAAAAGGGCCGTTTCGTATTTTTCAATAAAAGCCTTTCGTTTTTGC
AAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_113888	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA41760	(Get FASTA)	NCBI Sequence Viewer
	AAH62411	(Get FASTA)	NCBI Sequence Viewer
	CAA09727	(Get FASTA)	NCBI Sequence Viewer
	EDM13403	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000064411
	ENSRNOP00000064411.1
GenBank Protein	Q63400	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_113888 ⟸ NM_031700

- UniProtKB:

Q63400 (UniProtKB/Swiss-Prot), A6J0G4 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MSMGLEITGTSLAVLGWLCTIVCCALPMWRVSAFIGSSIITAQITWEGLWMNCVVQSTGQMQCK
MYDSLLALPQDLQAARALIVVSILLAAFGLLVALVGAQCTNCVQDETAKAKITIVAGVLFLLAA
VLTLVPVSWSANTIIRDFYNPLVPEAQKREMGTGLYVGWAAAALQLLGGALLCCSCPPREKYAP
TKILYSAPRSTGPGTGTGTAYDRKDYV

hide sequence

Ensembl Acc Id:

ENSRNOP00000064411 ⟸ ENSRNOT00000075280

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q63400-F1-model_v2	AlphaFold	Q63400	1-219	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13698505

Promoter ID:

EPDNEW_R9030

Type:

initiation region

Name:

Cldn3_1

Description:

claudin 3

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	12	21,832,559 - 21,832,619	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:68425	AgrOrtholog
BioCyc Gene	G2FUF-19598	BioCyc
Ensembl Genes	ENSRNOG00000046007	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000075280	ENTREZGENE
	ENSRNOT00000075280.3	UniProtKB/Swiss-Prot
Gene3D-CATH	1.20.140.150	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:5623891	IMAGE-MGC_LOAD
InterPro	Claudin	UniProtKB/Swiss-Prot
	Claudin3	UniProtKB/Swiss-Prot
	Claudin_CS	UniProtKB/Swiss-Prot
	PMP22/EMP/MP20/Claudin	UniProtKB/Swiss-Prot
KEGG Report	rno:65130	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:72392	IMAGE-MGC_LOAD
NCBI Gene	65130	ENTREZGENE
PANTHER	PTHR12002	UniProtKB/Swiss-Prot
Pfam	PMP22_Claudin	UniProtKB/Swiss-Prot
PhenoGen	Cldn3	PhenoGen
PRINTS	CLAUDIN	UniProtKB/Swiss-Prot
	CLAUDIN3	UniProtKB/Swiss-Prot
PROSITE	CLAUDIN	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000046007	RatGTEx
TIGR	TC205531
UniProt	A6J0G4	ENTREZGENE, UniProtKB/TrEMBL
	CLD3_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2002-06-10	Cldn3	claudin 3			Name updated	70584	APPROVED

RGD Curation Notes

Note Type	Note	Reference

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Annotations - KEGG (archival)