Dio3 (iodothyronine deiodinase 3)

Advanced Search (OLGA)

Gene: Dio3 (iodothyronine deiodinase 3) Rattus norvegicus

Analyze

Symbol:

Dio3

Name:

iodothyronine deiodinase 3

RGD ID:

68420

Description:

Predicted to enable thyroxine 5'-deiodinase activity and thyroxine 5-deiodinase activity. Involved in brown fat cell proliferation and response to hypoxia. Predicted to be located in intracellular membrane-bounded organelle. Biomarker of congestive heart failure and fetal alcohol spectrum disorder. Orthologous to human DIO3 (iodothyronine deiodinase 3); INTERACTS WITH (+)-schisandrin B; 2,6-dinitrotoluene; 6-propyl-2-thiouracil.

Type:

protein-coding

RefSeq Status:

REVIEWED

Previously known as:

5DIII; deiodinase iodothyronine type 3; deiodinase iodothyronine type III; deiodinase, iodothyronine, type 3; deiodinase, iodothyronine, type III; DIOIII; thyroxine 5-deiodinase; type 3 DI; type III iodothyronine deiodinase; type-III 5'-deiodinase

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	DIO3 (iodothyronine deiodinase 3)	HGNC	HomoloGene, NCBI, Panther
Mus musculus (house mouse):	Dio3 (deiodinase, iodothyronine type III)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Dio3 (iodothyronine deiodinase 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	DIO3 (iodothyronine deiodinase 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	DIO3 (iodothyronine deiodinase 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Dio3 (iodothyronine deiodinase 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	DIO3 (iodothyronine deiodinase 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	DIO3 (iodothyronine deiodinase 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Dio3 (iodothyronine deiodinase 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	DIO3 (iodothyronine deiodinase 3)	Alliance	DIOPT (HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Dio3 (deiodinase, iodothyronine type III)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	dio3	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)

Candidate Gene For:

Thshl1

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	6	135,107,072 - 135,108,933 (+)	NCBI		GRCr8
mRatBN7.2	6	129,285,747 - 129,287,608 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	6	129,285,749 - 129,286,660 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	6	129,464,249 - 129,466,110 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	6	129,760,113 - 129,761,974 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	6	129,123,269 - 129,125,130 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	6	134,627,278 - 134,629,139 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	6	134,627,278 - 134,629,138 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	6	143,766,523 - 143,768,383 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
Celera	6	126,858,528 - 126,860,389 (+)	NCBI		Celera
Cytogenetic Map	6	q32	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

autism spectrum disorder (ISO)

Breast Neoplasms (ISO)

congestive heart failure (IEP)

fetal alcohol spectrum disorder (IEP)

Neoplasm Metastasis (ISO)

papillary thyroid carcinoma (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-catechin (ISO)

(+)-schisandrin B (EXP)

17beta-estradiol (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2,6-dinitrotoluene (EXP)

2-Ethylhexyl acrylate (ISO)

2-palmitoylglycerol (ISO)

3,3',5,5'-tetrabromobisphenol A (ISO)

3,3',5-triiodo-L-thyronine (ISO)

4,4'-diaminodiphenylmethane (ISO)

4,5-dichloro-2-n-octyl-3(2H)-isothiazolone (ISO)

5-aza-2'-deoxycytidine (ISO)

6-propyl-2-thiouracil (EXP,ISO)

7,12-dimethyltetraphene (ISO)

8-Br-cAMP (EXP)

9-cis-retinoic acid (ISO)

acetamide (EXP)

actinomycin D (EXP)

all-trans-retinoic acid (EXP,ISO)

alpha-hexylcinnamaldehyde (ISO)

alpha-linolenic acid (ISO)

ammonium chloride (EXP)

Aurothioglucose (ISO)

benzalkonium chloride (ISO)

benzo[a]pyrene (EXP,ISO)

beta-lapachone (ISO)

bicalutamide (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

Bisphenol A diglycidyl ether (ISO)

C60 fullerene (EXP)

captafol (ISO)

chlordecone (ISO)

chlorothalonil (ISO)

chlorpyrifos (ISO)

choline (ISO)

cisplatin (EXP)

clothianidin (ISO)

colforsin daropate hydrochloride (EXP)

copper atom (EXP)

copper(0) (EXP)

Cuprizon (EXP)

cycloheximide (EXP)

Cyclopamine (ISO)

DDE (ISO)

decabromodiphenyl ether (ISO)

dexamethasone (ISO)

Didecyldimethylammonium (ISO)

diethyl hydrogen phosphate (EXP)

diiodine (ISO)

dinocap (ISO)

disodium selenite (EXP)

dorsomorphin (ISO)

entinostat (ISO)

Ethylenethiourea (ISO)

fenvalerate (EXP)

fipronil (EXP,ISO)

flavonoids (EXP)

fluazinam (ISO)

fluoxetine (EXP)

folic acid (ISO)

furan (EXP)

glyphosate (EXP)

hydrogen peroxide (EXP)

L-methionine (ISO)

Licochalcone B (ISO)

lidocaine (EXP)

linoleic acid (ISO)

lipopolysaccharide (EXP)

lithocholic acid (ISO)

masoprocol (ISO)

methoxychlor (EXP)

methylmercury chloride (ISO)

methyltrioctylammonium chloride (ISO)

mono(2-ethylhexyl) phthalate (ISO)

morin (ISO)

N-acetyl-L-cysteine (EXP)

N1'-[2-[[5-[(dimethylamino)methyl]-2-furanyl]methylthio]ethyl]-N1-methyl-2-nitroethene-1,1-diamine (EXP)

naphthalene (ISO)

octhilinone (ISO)

ozone (ISO)

pentachlorophenol (EXP)

perfluorooctane-1-sulfonic acid (EXP)

perfluorooctanoic acid (EXP)

phenobarbital (EXP)

phorbol 13-acetate 12-myristate (EXP,ISO)

phthalaldehyde (ISO)

pioglitazone (ISO)

potassium bromate (ISO)

pravastatin (EXP,ISO)

propiconazole (EXP)

quinoxyfen (ISO)

ranitidine (EXP)

resveratrol (ISO)

S-butyl-DL-homocysteine (S,R)-sulfoximine (EXP)

SB 203580 (EXP,ISO)

SB 431542 (ISO)

sodium arsenite (ISO)

streptozocin (ISO)

Tetrachlorobisphenol A (ISO)

tetrachloromethane (EXP)

thioacetamide (EXP)

thyroxine (EXP)

titanium dioxide (EXP,ISO)

triadimefon (EXP)

triflumizole (ISO)

triptonide (ISO)

valproic acid (ISO)

vemurafenib (ISO)

xanthohumol (ISO)

zoxamide (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

apoptotic process (ISO)

brown fat cell proliferation (IEP)

hormone biosynthetic process (IEA)

positive regulation of multicellular organism growth (ISO)

response to hypoxia (IEP)

retinal cone cell apoptotic process (ISO)

retinal cone cell development (ISO)

thyroid hormone catabolic process (ISO)

thyroid hormone metabolic process (IBA,ISO,TAS)

Cellular Component

endosome membrane (IEA)

intracellular membrane-bounded organelle (ISO)

plasma membrane (IEA)

Molecular Function

thyroxine 5'-deiodinase activity (IBA,ISO,TAS)

thyroxine 5-deiodinase activity (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Cloning and expression of a cDNA for a mammalian type III iodothyronine deiodinase.	Croteau W, etal., J Biol Chem 1995 Jul 14;270(28):16569-75.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
4.	Gene expression from the imprinted Dio3 locus is associated with cell proliferation of cultured brown adipocytes.	Hernandez A, etal., Endocrinology. 2007 Aug;148(8):3968-76. Epub 2007 May 17.
5.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
6.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
7.	GOA pipeline	RGD automated data pipeline
8.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
9.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
10.	Comprehensive gene review and curation	RGD comprehensive gene curation
11.	Hypoxia-inducible factor induces local thyroid hormone inactivation during hypoxic-ischemic disease in rats.	Simonides WS, etal., J Clin Invest. 2008 Mar;118(3):975-83.
12.	Tentative Sequence Identification Numbers	Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
13.	Low-dose thyroxine attenuates autism-associated adverse effects of fetal alcohol in male offspring's social behavior and hippocampal gene expression.	Tunc-Ozcan E, etal., Alcohol Clin Exp Res. 2013 Nov;37(11):1986-95. doi: 10.1111/acer.12183. Epub 2013 Jun 13.

Additional References at PubMed

PMID:12399446	PMID:12586753	PMID:12959985	PMID:16410833	PMID:17628010	PMID:18566113	PMID:18787028	PMID:19916870	PMID:20203194	PMID:21429942	PMID:22723689	PMID:23586759
PMID:25002520	PMID:33746903	PMID:39238408

Genomics

Comparative Map Data

Dio3
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	6	135,107,072 - 135,108,933 (+)	NCBI		GRCr8
mRatBN7.2	6	129,285,747 - 129,287,608 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	6	129,285,749 - 129,286,660 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	6	129,464,249 - 129,466,110 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	6	129,760,113 - 129,761,974 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	6	129,123,269 - 129,125,130 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	6	134,627,278 - 134,629,139 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	6	134,627,278 - 134,629,138 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	6	143,766,523 - 143,768,383 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
Celera	6	126,858,528 - 126,860,389 (+)	NCBI		Celera
Cytogenetic Map	6	q32	NCBI

DIO3
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	14	101,561,495 - 101,563,452 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	14	101,560,139 - 101,563,452 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	14	102,027,832 - 102,029,789 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	14	101,097,441 - 101,099,542 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	14	101,097,440 - 101,099,540	NCBI
Celera	14	82,082,777 - 82,084,878 (+)	NCBI		Celera
Cytogenetic Map	14	q32.31	NCBI
HuRef	14	82,210,257 - 82,212,139 (+)	NCBI		HuRef
CHM1_1	14	101,966,169 - 101,968,270 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	14	95,796,749 - 95,798,706 (+)	NCBI		T2T-CHM13v2.0

Dio3
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	12	110,245,664 - 110,247,531 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	12	110,245,502 - 110,247,531 (+)	Ensembl		GRCm39 Ensembl
GRCm38	12	110,279,230 - 110,281,097 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	12	110,279,068 - 110,281,097 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	12	111,517,440 - 111,519,307 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	12	110,727,040 - 110,728,902 (+)	NCBI		MGSCv36	mm8
Celera	12	111,469,979 - 111,471,846 (+)	NCBI		Celera
Cytogenetic Map	12	F1	NCBI
cM Map	12	60.56	NCBI

Dio3
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955538	1,042,949 - 1,045,038 (+)	NCBI	ChiLan1.0	ChiLan1.0

DIO3
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	15	102,720,139 - 102,722,215 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	14	101,936,634 - 101,938,710 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	14	82,188,126 - 82,190,220 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	14	101,496,027 - 101,497,958 (+)	NCBI	panpan1.1	PanPan1.1	panPan2

DIO3
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	8	69,696,779 - 69,698,880 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	8	69,212,787 - 69,214,888 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	8	69,976,717 - 69,978,827 (+)	NCBI		ROS_Cfam_1.0
UMICH_Zoey_3.1	8	69,640,338 - 69,642,442 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	8	69,705,306 - 69,707,410 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	8	70,104,995 - 70,107,102 (+)	NCBI		UU_Cfam_GSD_1.0

Dio3
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	4,838,557 - 4,840,570 (-)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936604	5,241,877 - 5,243,910 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

DIO3
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa10.2	7	130,202,342 - 130,204,449 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

DIO3
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	24	79,538,264 - 79,544,448 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666053	66,683,231 - 66,685,324 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Dio3
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624734	2,611,864 - 2,613,932 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Dio3
2 total Variants

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
12801411	Schws8	Schwannoma susceptibility QTL 8			nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	6	94968928	139968928	Rat
4145118	Mcs26	Mammary carcinoma susceptibility QTL 26		0.0001	mammary gland integrity trait (VT:0010552)	post-insult time to mammary tumor formation (CMO:0000345)	6	106752656	132339866	Rat
1331799	Bp211	Blood pressure QTL 211	3.66407		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	6	72202632	130919985	Rat
1581563	Uae33	Urinary albumin excretion QTL 33			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	72227641	130729205	Rat
10054138	Gmadr3	Adrenal mass QTL 3	3.68	0.00045	adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	6	85140138	130140138	Rat
1641917	Colcr5	Colorectal carcinoma resistance QTL 5	3.18	0.0009	intestine integrity trait (VT:0010554)	benign colorectal tumor number (CMO:0001795)	6	122549046	137801795	Rat
61414	Pia3	Pristane induced arthritis QTL 3	4.5		joint integrity trait (VT:0010548)	post-insult time to onset of experimental arthritis (CMO:0001450)	6	94968928	137848904	Rat
71111	Iddm8	Insulin dependent diabetes mellitus QTL 8	1.9	0.002	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	6	105156861	140994061	Rat
1358355	Srcrt4	Stress Responsive Cort QTL 4	6.39		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	6	100364669	140994061	Rat
724513	Uae14	Urinary albumin excretion QTL 14	6.5		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	85311061	133478515	Rat
2303624	Vencon5	Ventilatory control QTL 5	4.45		respiration trait (VT:0001943)	minute ventilation (CMO:0000132)	6	88047916	133047916	Rat
731173	Uae22	Urinary albumin excretion QTL 22	10.1		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	65531555	140994061	Rat
61329	Eae9	Experimental allergic encephalomyelitis QTL 9	3.7		body mass (VT:0001259)	change in body weight (CMO:0002045)	6	122549046	140994061	Rat
10054123	Srcrt6	Stress Responsive Cort QTL 6	2.5	0.0043	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	6	85140138	130140138	Rat
724536	Uae7	Urinary albumin excretion QTL 7	3.5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	6	72202632	130729475	Rat
737976	Pia24	Pristane induced arthritis QTL 24			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	6	112636280	140994061	Rat
2312560	Pur20	Proteinuria QTL 20	2.1	0.005	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	6	125628133	137801795	Rat
2313399	Anxrr28	Anxiety related response QTL 28			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	6	100671796	132340886	Rat
1298087	Iddm18	Insulin dependent diabetes mellitus QTL 18		0.0001	urine glucose amount (VT:0001758)	percentage of study population developing diabetes mellitus during a period of time (CMO:0001114)	6	116506292	130245370	Rat
1581550	Pur8	Proteinuria QTL 8			urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	6	72227641	130729205	Rat
2290393	Uae37	Urinary albumin excretion QTL 37		0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	65531555	140994061	Rat
8552796	Vie3	Viral induced encephalitis QTL 3	2.6		brain integrity trait (VT:0010579)	encephalitis incidence/prevalence measurement (CMO:0002361)	6	96833997	140994061	Rat
1300076	Glom8	Glomerulus QTL 8	7	9e-09	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli directly contacting the kidney surface (CMO:0001001)	6	86894788	131894788	Rat
2293085	Iddm29	Insulin dependent diabetes mellitus QTL 29	7.66		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	6	122549046	140286318	Rat

Markers in Region

RH128338

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	6	129,286,330 - 129,287,557 (+)	MAPPER	mRatBN7.2
Rnor_6.0	6	134,627,862 - 134,629,088	NCBI	Rnor6.0
Rnor_5.0	6	143,767,107 - 143,768,333	UniSTS	Rnor5.0
Celera	6	126,859,112 - 126,860,338	UniSTS
RH 3.4 Map	6	785.19	UniSTS

UniSTS:489530

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	6	129,285,776 - 129,287,221 (+)	MAPPER	mRatBN7.2
Rnor_6.0	6	134,627,308 - 134,628,752	NCBI	Rnor6.0
Rnor_5.0	6	143,766,553 - 143,767,997	UniSTS	Rnor5.0
Celera	6	126,858,558 - 126,860,002	UniSTS

UniSTS:532166

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	6	129,286,009 - 129,286,137 (+)	MAPPER	mRatBN7.2
Rnor_6.0	6	134,627,541 - 134,627,668	NCBI	Rnor6.0
Rnor_5.0	6	143,766,786 - 143,766,913	UniSTS	Rnor5.0
Celera	6	126,858,791 - 126,858,918	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	8	28	113	75	72	44	12	44	6	159	61	93	40	57	28

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_017210	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BM414881	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474034	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000006	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U24282	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000078113

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	6	129,285,749 - 129,286,660 (+)	Ensembl
Rnor_6.0 Ensembl	6	134,627,278 - 134,629,138 (+)	Ensembl

RefSeq Acc Id:

NM_017210 ⟹ NP_058906

RefSeq Status:

REVIEWED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	135,107,072 - 135,108,933 (+)	NCBI
mRatBN7.2	6	129,285,747 - 129,287,608 (+)	NCBI
Rnor_6.0	6	134,627,278 - 134,629,139 (+)	NCBI
Rnor_5.0	6	143,766,523 - 143,768,383 (+)	NCBI
Celera	6	126,858,528 - 126,860,389 (+)	NCBI

Sequence:

show sequence

AGATGCCTCGCCAGGCCGCCTCGAGGTTGGTGGTCGGAGAAGGTGAAGGGCCCCCGGGGGCTTC
GGGGCCCGCGGCCACCATGCTGCGCTCCCTGCTGCTTCACTCTCTGAGGCTCTGCGCCCAGACC
GCCTCGTGCCTCGTGCTGTTCCCGCGCTTCCTAGGCACGGCCTTCATGCTCTGGCTTTTAGATT
TCTTGTGCATCCGCAAGCATTTCCTGCGCCGTCGTCATCCTGACCACCCCGAGCCCGAAGTAGA
GCTCAACAGTGAAGGTGAGGAGATGCCCCCTGACGACCCACCCATCTGCGTATCCGACGACAAC
CGGCTGTGCACCCTGGCCTCTCTGAAGGCCGTGTGGCATGGCCAGAAGTTGGATTTCTTCAAGC
AGGCCCATGAGGGTGGCCCAGCACCTAACTCGGAGGTCGTCCGGCCTGATGGCTTCCAGAGCCA
GCGCATCCTCGACTACGCACAAGGGACCCGCCCGTTGGTGCTCAATTTTGGCAGCTGTACCTGA
CCACCGTTCATGGCGCGGATGAGCGCCTTCCAGCGCCTGGTCACCAAGTACCAGCGCGACGTTG
ACTTCCTTATCATCTACATCGAGGAAGCCCACCCATCCGATGGCTGGGTCACCACAGATTCACC
CTACGTCATCCCACAGCACCGCAGCTTGGAGGACCGTGTCAGCGCAGCAAGAGTACTTCAGCAA
GGCGCACCTGGCTGTGCTCTGGTTCTGGACACGATGGCCAACTCCAGCAGTTCCGCATATGGTG
CCTATTTTGAGCGCCTCTACGTCATCCAGAGCGGCACCATCATGTACCAGGGAGGCCGTGGCCC
CGACGGTTACCAGGTGTCTGAGTTGCGCACTTGGTTGGAGCGCTATGACGAGCAGTTGCATGGT
ACTAGGCCACGTCGACTCTAAAAAACCAAGGGACAAGTGACTGAATTGGTGGGCTGGGTCTTCT
GGGCCTTCGAAGCTCATGTGCGAATGCTCCAAAAGAAGTCAAGGTTTTCAGGGGTCCCGTGACA
CAGATGAGCACAGCCACAGAACTCAGGCTGAGTCTGGCTAACTTGAGACTCTGCTATAGTGACT
CCCTTTTGGTACTTTTTGGCTTGCTTTCTGGAGCATTGCTGTGGCTAGAACTGGCAACTTTGTC
CCTGCTGAAGTTTACCTGCTGGACTTTCTGACACCTGCTCCCCAGCGCTATTTCAGCAAAGCGC
AATAAGTCGCCAGCATCTCACAGCTCGGGACTTGTTGGCCACGCCCGCGCGCCCTGAGCGCAGC
TGGGTTCCAGCAGCGCCTCCGGCTCTAGCTAGTTGCCTGGCACCCACCTGTCGAGAGCAGGGAG
TCCTGCTGCTTTTGTGTTTATTTCTTATCCCTGGGTTGGGGGAGGGGCTCAAGATAAAGGGTGG
GCAGGGTAATTTCCCCGCCTAGCTTTAGGTGCGCTGGAACCCTGGCTGCTGATGACGAACCGCC
TCTAACTGGGCTTGACCACGGGTCGGCTCTGAATTGCAGAGGGGCTCGAAACAGCGCCTAAAGT
AAGAGGGGGAAAGTGCTCTGGGTTCCACGGGGAACCGTCAAAAACAGGGTGAAAGAGGGACATG
GTAAGGGGTGGGCTTCAGGACCAAAGGAAGCGGCTTGGGGCACTGGCGAGGTTCGCAGGTCCCC
AAGAGGGAGGCTAGGACTCCTTGGAGAAGGGATTAATTGGTTCGAAGACAAGGAGATGGGGAAG
AGCCTGGGAGTCCTAAGCAGAAAGAGCGGGTTGTGGGGTGGGGTGAAAACCAGTCAGTGAATGT
TGTGTTGGAAACGTTCCTTGTGTATAAACTTTTAAGTTACAATAATAAAGACTTGAAGGAAGTT
GCTCTG

hide sequence

Protein Sequences


Protein RefSeqs	NP_058906	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAC52241	(Get FASTA)	NCBI Sequence Viewer
	EDL97515	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000093110.1
	ENSRNOP00055045604
	ENSRNOP00060041087
	ENSRNOP00065042289
GenBank Protein	P49897	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_058906 ⟸ NM_017210

- UniProtKB:

P49897 (UniProtKB/Swiss-Prot)

- Sequence:

show sequence

MPRQAASRLVVGEGEGPPGASGPAATMLRSLLLHSLRLCAQTASCLVLFPRFLGTAFMLWLLDF
LCIRKHFLRRRHPDHPEPEVELNSEGEEMPPDDPPICVSDDNRLCTLASLKAVWHGQKLDFFKQ
AHEGGPAPNSEVVRPDGFQSQRILDYAQGTRPLVLNFGSCTUPPFMARMSAFQRLVTKYQRDVD
FLIIYIEEAHPSDGWVTTDSPYVIPQHRSLEDRVSAARVLQQGAPGCALVLDTMANSSSSAYGA
YFERLYVIQSGTIMYQGGRGPDGYQVSELRTWLERYDEQLHGTRPRRL

hide sequence

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:68420	AgrOrtholog
BioCyc Gene	G2FUF-35897	BioCyc
BioCyc Pathway	PWY-6260 [thyroid hormone metabolism I (via deiodination)]	BioCyc
	PWY-6261 [thyroid hormone metabolism II (via conjugation and/or degradation)]	BioCyc
BioCyc Pathway Image	PWY-6260	BioCyc
	PWY-6261	BioCyc
Ensembl Genes	ENSRNOG00000052017	Ensembl, UniProtKB/Swiss-Prot
	ENSRNOG00055031874	UniProtKB/Swiss-Prot
	ENSRNOG00060028324	UniProtKB/Swiss-Prot
	ENSRNOG00065029732	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000078113.2	UniProtKB/Swiss-Prot
	ENSRNOT00055055172	UniProtKB/Swiss-Prot
	ENSRNOT00060049227	UniProtKB/Swiss-Prot
	ENSRNOT00065051353	UniProtKB/Swiss-Prot
Gene3D-CATH	Glutaredoxin	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	Iodothyronine_deiodinase	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Iodothyronine_deiodinase_AS	UniProtKB/Swiss-Prot
	Iodothyronine_deiodinase_I/III	UniProtKB/Swiss-Prot
	Thioredoxin-like_sf	UniProtKB/Swiss-Prot
KEGG Report	rno:29475	UniProtKB/Swiss-Prot
NCBI Gene	29475	ENTREZGENE
PANTHER	IODOTHYRONINE DEIODINASE	UniProtKB/TrEMBL, UniProtKB/Swiss-Prot
	THYROXINE 5-DEIODINASE	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	T4_deiodinase	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Dio3	PhenoGen
PIRSF	IOD	UniProtKB/Swiss-Prot
	IODI_III	UniProtKB/Swiss-Prot
PROSITE	T4_DEIODINASE	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000052017	RatGTEx
	ENSRNOG00055031874	RatGTEx
	ENSRNOG00060028324	RatGTEx
	ENSRNOG00065029732	RatGTEx
Superfamily-SCOP	SSF52833	UniProtKB/Swiss-Prot
TIGR	TC238557
UniProt	A6KBL6_RAT	UniProtKB/TrEMBL
	IOD3_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-10-26	Dio3	iodothyronine deiodinase 3	Dio3	deiodinase, iodothyronine, type III	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2003-04-09	Dio3	deiodinase, iodothyronine, type III		deiodinase, iodothyronine, type 3	Name updated	629478	APPROVED
2002-06-10	Dio3	deiodinase, iodothyronine, type 3			Name updated	70584	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_expression	mRNA expressed in placenta and several fetal tissues during embryonic development	68236
gene_function	catalyzes the inner ring deiodination of the prohormone thyroxine (T4) and of the bioactive hormone 3,3',5-triiodothyronine (T3) to 3,3'-T2 inactive metabolites	68236
gene_homology	cDNA displays significant homology with amphibian (Xenopus laevis)	68236

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - CTD

BioCyc Pathways

Send us a Message

Imported Disease Annotations - CTD

BioCyc Pathways