Sh2b3 (SH2B adaptor protein 3) - Rat Genome Database

Name: Sh2b3
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Sh2b3 (SH2B adaptor protein 3) Rattus norvegicus

Analyze

Symbol:

Sh2b3

Name:

SH2B adaptor protein 3

RGD ID:

68411

Description:

Enables phosphate ion binding activity. Involved in negative regulation of sprouting angiogenesis and regulation of regulatory T cell differentiation. Used to study hypertension. Human ortholog(s) of this gene implicated in colorectal cancer; essential thrombocythemia; familial erythrocytosis 1; myelofibrosis; and type 1 diabetes mellitus. Orthologous to human SH2B3 (SH2B adaptor protein 3); PARTICIPATES IN erythropoietin signaling pathway; neurotrophic factor signaling pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 3H-1,2-dithiole-3-thione; bisphenol A.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

linker of T-cell receptor pathways; Lnk; lymphocyte adapter protein; lymphocyte-specific adapter protein Lnk; SH2B adapter protein 3; signal transduction protein Lnk

RGD Orthologs

Human

Mouse

Chinchilla

Bonobo

Dog

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	SH2B3 (SH2B adaptor protein 3)	HGNC	Ensembl, NCBI, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Sh2b3 (SH2B adaptor protein 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Sh2b3 (SH2B adaptor protein 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	SH2B3 (SH2B adaptor protein 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	SH2B3 (SH2B adaptor protein 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Sh2b3 (SH2B adaptor protein 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	SH2B3 (SH2B adaptor protein 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	SH2B3 (SH2B adaptor protein 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Sh2b3 (SH2B adaptor protein 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	CRCP (CGRP receptor component)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	SH2B3 (SH2B adaptor protein 3)	Alliance	DIOPT (Ensembl Compara\|HGNC\|OrthoFinder\|OrthoInspector\|SonicParanoid)
Mus musculus (house mouse):	Sh2b3 (SH2B adaptor protein 3)	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	sh2b3 (SH2B adaptor protein 3)	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector)

Allele / Splice:

Sh2b3^em1Mcwi Sh2b3^em2Mcwi

Genetic Models:

SS-Sh2b3^em1Mcwi SS-Sh2b3^em2Mcwi SS-Sh2b3^em2Mcwi-/- SS-Sh2b3^em1Mcwi-/+ SS-Sh2b3^em1Mcwi-/-

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	12	34,749,849 - 34,753,616 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	34,731,911 - 34,753,616 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	12	35,904,822 - 35,926,500 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	12	36,516,036 - 36,537,714 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	12	35,568,505 - 35,590,183 (+)	NCBI	Rnor_WKY
Rnor_6.0	12	40,261,990 - 40,265,757 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	40,244,081 - 40,265,757 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	12	42,132,947 - 42,136,714 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	12	35,954,679 - 35,958,446 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	12	35,818,066 - 35,821,834 (+)	NCBI
Celera	12	36,414,671 - 36,418,438 (+)	NCBI		Celera
Cytogenetic Map	12	q16	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Albuminuria (IMP)

chronic myeloid leukemia (ISS)

colorectal cancer (ISO)

colorectal carcinoma (ISO)

coronary artery disease (ISO)

developmental and epileptic encephalopathy 67 (ISO)

essential thrombocythemia (ISO)

familial erythrocytosis 1 (ISO)

Familial Myelofibrosis (ISO)

genetic disease (ISO)

hepatoblastoma (ISO)

Hereditary Neoplastic Syndromes (ISO)

hypertension (IMP)

Inflammation (ISO)

juvenile myelomonocytic leukemia (ISO)

multiple myeloma (ISO)

myelofibrosis (ISO)

myocardial infarction (ISO)

Myocardial Reperfusion Injury (IMP)

polycythemia (ISO)

Stroke (ISO)

systemic lupus erythematosus (ISO)

thrombocytosis (ISO)

type 1 diabetes mellitus (ISO)

vitiligo (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

1,2-dichloroethane (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2-methylcholine (ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

3H-1,2-dithiole-3-thione (EXP)

4,4'-diaminodiphenylmethane (ISO)

4,4'-sulfonyldiphenol (ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

antirheumatic drug (ISO)

arsenite(3-) (ISO)

arsenous acid (ISO)

atrazine (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

butan-1-ol (ISO)

calcitriol (ISO)

carbon nanotube (ISO)

CGP 52608 (ISO)

choline (ISO)

cisplatin (ISO)

cobalt dichloride (EXP,ISO)

copper(II) sulfate (ISO)

cyclosporin A (ISO)

dexamethasone (ISO)

diarsenic trioxide (ISO)

diazinon (ISO)

dibutyl phthalate (EXP)

dicrotophos (ISO)

dorsomorphin (ISO)

doxorubicin (ISO)

entinostat (ISO)

ethanol (EXP)

folic acid (ISO)

gentamycin (EXP)

hexachlorobenzene (EXP)

indometacin (ISO)

inulin (ISO)

isobutanol (ISO)

L-methionine (ISO)

leflunomide (ISO)

methyl methanesulfonate (ISO)

methylmercury chloride (ISO)

N-methyl-4-phenylpyridinium (ISO)

nickel atom (ISO)

oxaliplatin (ISO)

ozone (ISO)

paracetamol (EXP,ISO)

perfluorononanoic acid (ISO)

perfluorooctane-1-sulfonic acid (ISO)

pirinixic acid (ISO)

piroxicam (ISO)

prothioconazole (ISO)

quercetin (ISO)

SB 431542 (ISO)

silicon dioxide (ISO)

silver atom (ISO)

silver(0) (ISO)

Soman (EXP)

sunitinib (ISO)

temozolomide (ISO)

tert-butyl hydroperoxide (ISO)

titanium dioxide (ISO)

trichloroethene (EXP)

triptonide (ISO)

urethane (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cellular response to chemokine (ISO)

cellular response to interleukin-3 (IEA,ISO)

embryonic hemopoiesis (IEA,ISO)

erythrocyte development (IEA,ISO)

hematopoietic stem cell differentiation (IEA,ISO)

hemopoiesis (ISO)

intracellular signal transduction (IEA,ISO)

megakaryocyte development (IEA,ISO)

monocyte homeostasis (IEA,ISO)

negative regulation of cell population proliferation (IEA,ISO)

negative regulation of chemokine-mediated signaling pathway (IEA,ISO)

negative regulation of Kit signaling pathway (IEA,ISO)

negative regulation of MAP kinase activity (IEA,ISO)

negative regulation of platelet aggregation (IEA,ISO)

negative regulation of protein kinase B signaling (IEA,ISO)

negative regulation of receptor signaling pathway via JAK-STAT (ISO)

negative regulation of response to cytokine stimulus (ISO)

negative regulation of sprouting angiogenesis (IMP)

negative regulation of tyrosine phosphorylation of STAT protein (IEA,ISO)

neutrophil homeostasis (IEA,ISO)

regulation of regulatory T cell differentiation (IMP)

thrombopoietin-mediated signaling pathway (IEA,ISO)

Molecular Function

phosphate ion binding (IDA)

protein binding (ISO)

protein tyrosine kinase binding (IEA,ISO)

protein-containing complex binding (IDA)

signaling receptor complex adaptor activity (IEA,ISO)

stem cell factor receptor binding (IEA,ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

erythropoietin signaling pathway (ISO)

neurotrophic factor signaling pathway (IEA)

Phenotype Annotations Click to see Annotation Detail View

Mammalian Phenotype

decreased susceptibility to hypertension (IMP)

decreased urine albumin level (IMP)

decreased ventricle muscle contractility (IMP)

increased lymphocyte cell number (IMP)

increased monocyte cell number (IMP)

increased neutrophil cell number (IMP)

increased regulatory T cell number (IMP)

References

References - curated

#	Reference Title	Reference Citation
1.	SH2B3 Is a Genetic Determinant of Cardiac Inflammation and Fibrosis.	Flister MJ, etal., Circ Cardiovasc Genet. 2015 Apr;8(2):294-304. doi: 10.1161/CIRCGENETICS.114.000527. Epub 2015 Jan 27.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Genetic analysis of adult-onset autoimmune diabetes.	Howson JM, etal., Diabetes. 2011 Oct;60(10):2645-53. Epub 2011 Aug 26.
4.	Cloning and characterization of Lnk, a signal transduction protein that links T-cell receptor activation signal to phospholipase C gamma 1, Grb2, and phosphatidylinositol 3-kinase.	Huang X, etal., Proc Natl Acad Sci U S A 1995 Dec 5;92(25):11618-22.
5.	Rat messenger RNA for the retinal pigment epithelium-specific protein RPE65 gradually accumulates in two weeks from late embryonic days.	Manes G, etal., FEBS Lett 1998 Feb 20;423(2):133-7.
6.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
7.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
8.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
9.	LNK protein: Low expression in human colorectal carcinoma and relationship with tumor invasion.	Pan J, etal., Biomed Pharmacother. 2020 Jan;121:109467. doi: 10.1016/j.biopha.2019.109467. Epub 2019 Nov 6.
10.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
11.	PID Annotation Import Pipeline	Pipeline to import Pathway Interaction Database annotations from NCI into RGD
12.	Genome-wide association analysis of autoantibody positivity in type 1 diabetes cases.	Plagnol V, etal., PLoS Genet. 2011 Aug;7(8):e1002216. doi: 10.1371/journal.pgen.1002216. Epub 2011 Aug 4.
13.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
14.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
15.	Comprehensive gene review and curation	RGD comprehensive gene curation
16.	Mutation of SH2B3 (LNK), a genome-wide association study candidate for hypertension, attenuates Dahl salt-sensitive hypertension via inflammatory modulation.	Rudemiller NP, etal., Hypertension. 2015 May;65(5):1111-7. doi: 10.1161/HYPERTENSIONAHA.114.04736. Epub 2015 Mar 16.
17.	Tentative Sequence Identification Numbers	Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
18.	Recurrent Coding Sequence Variation Explains Only A Small Fraction of the Genetic Architecture of Colorectal Cancer.	Timofeeva MN, etal., Sci Rep. 2015 Nov 10;5:16286. doi: 10.1038/srep16286.
19.	Creation and preliminary characterization of a leptin knockout rat.	Vaira S, etal., Endocrinology. 2012 Nov;153(11):5622-8. doi: 10.1210/en.2012-1462. Epub 2012 Sep 4.

Additional References at PubMed

PMID:11805142	PMID:14612394	PMID:15337790	PMID:20404132	PMID:22028877	PMID:26101343	PMID:27430239	PMID:31799683

Genomics

Comparative Map Data

Sh2b3
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	12	34,749,849 - 34,753,616 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	34,731,911 - 34,753,616 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	12	35,904,822 - 35,926,500 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	12	36,516,036 - 36,537,714 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	12	35,568,505 - 35,590,183 (+)	NCBI	Rnor_WKY
Rnor_6.0	12	40,261,990 - 40,265,757 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	40,244,081 - 40,265,757 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	12	42,132,947 - 42,136,714 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	12	35,954,679 - 35,958,446 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	12	35,818,066 - 35,821,834 (+)	NCBI
Celera	12	36,414,671 - 36,418,438 (+)	NCBI		Celera
Cytogenetic Map	12	q16	NCBI

SH2B3
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	12	111,404,730 - 111,451,623 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	12	111,405,923 - 111,451,623 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	12	111,843,727 - 111,889,427 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	12	110,328,135 - 110,373,810 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	12	110,306,471 - 110,352,146	NCBI
Celera	12	111,470,186 - 111,515,861 (+)	NCBI		Celera
Cytogenetic Map	12	q24.12	NCBI
HuRef	12	108,858,506 - 108,903,968 (+)	NCBI		HuRef
CHM1_1	12	111,811,712 - 111,857,391 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	12	111,385,588 - 111,432,181 (+)	NCBI		T2T-CHM13v2.0

Sh2b3
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	5	121,953,544 - 121,975,706 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	5	121,953,551 - 121,975,709 (-)	Ensembl		GRCm39 Ensembl
GRCm38	5	121,815,481 - 121,837,645 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	5	121,815,488 - 121,837,646 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	5	122,267,224 - 122,286,810 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	5	122,077,832 - 122,097,418 (-)	NCBI		MGSCv36	mm8
Celera	5	118,907,377 - 118,942,299 (-)	NCBI		Celera
Cytogenetic Map	5	F	NCBI
cM Map	5	61.99	NCBI

Sh2b3
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955482	8,096,160 - 8,097,765 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955482	8,079,905 - 8,100,791 (+)	NCBI	ChiLan1.0	ChiLan1.0

SH2B3
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	12	119,467,715 - 119,514,391 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	12	108,977,344 - 109,024,029 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	12	112,371,797 - 112,418,746 (+)	NCBI	panpan1.1	PanPan1.1	panPan2

SH2B3
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	26	9,033,851 - 9,073,095 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	26	9,005,281 - 9,070,204 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	26	9,206,973 - 9,235,670 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	26	9,303,831 - 9,332,542 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	26	9,292,891 - 9,329,651 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	26	9,259,823 - 9,288,511 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	26	9,322,052 - 9,350,491 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	26	9,275,536 - 9,304,251 (+)	NCBI		UU_Cfam_GSD_1.0

Sh2b3
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	155,352,543 - 155,375,181 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936558	4,104,534 - 4,123,869 (+)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936558	4,103,898 - 4,126,883 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

SH2B3
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	14	32,623,286 - 32,664,606 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	14	32,623,286 - 32,664,606 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	14	34,618,865 - 34,660,151 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

SH2B3
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	11	106,657,601 - 106,703,940 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	11	106,670,685 - 106,700,619 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666037	138,394,084 - 138,440,116 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Sh2b3
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624747	20,730,751 - 20,759,625 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624747	20,729,142 - 20,759,631 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Sh2b3
4 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	1318
Count of miRNA genes:	274
Interacting mature miRNAs:	359
Transcripts:	ENSRNOT00000030583, ENSRNOT00000073611, ENSRNOT00000075776
Prediction methods:	Microtar, Miranda, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1598855	Bp294	Blood pressure QTL 294	3.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	1	34851688	Rat
7411660	Foco28	Food consumption QTL 28	10.9	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	1	42110980	Rat
9590086	Insglur6	Insulin/glucose ratio QTL 6	18.97	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	12	1	42110980	Rat
8694179	Bw150	Body weight QTL 150	2.9	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	12	1	42110980	Rat
7411586	Foco5	Food consumption QTL 5	5.4	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	1	42110980	Rat
7411595	Foco9	Food consumption QTL 9	4	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	1	42110980	Rat
7411545	Bw128	Body weight QTL 128	5.2	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	12	1	42110980	Rat
9590147	Scort7	Serum corticosterone level QTL 7	13.61	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	12	1	42110980	Rat
2303575	Insul14	Insulin level QTL 14	4		blood insulin amount (VT:0001560)	blood insulin level (CMO:0000349)	12	1	42450532	Rat
737979	Pia22	Pristane induced arthritis QTL 22	53.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	1	44465750	Rat
634351	Apr5	Acute phase response QTL 5	6.7		blood interleukin-6 amount (VT:0008595)	plasma interleukin-6 level (CMO:0001927)	12	1	44503507	Rat
2302042	Pia38	Pristane induced arthritis QTL 38	3.5	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	12	1	44503507	Rat
634350	Apr4	Acute phase response QTL 4	6		orosomucoid 1 amount (VT:0010541)	plasma orosomucoid 1 level (CMO:0001467)	12	1172005	46172005	Rat
8552918	Pigfal7	Plasma insulin-like growth factor 1 level QTL 7			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	5564495	46669029	Rat
7411547	Bw129	Body weight QTL 129		0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	6	5564495	46669029	Rat
7411597	Foco10	Food consumption QTL 10		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	5564495	46669029	Rat
7411641	Foco19	Food consumption QTL 19	27.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	5564495	46669029	Rat
8552964	Pigfal17	Plasma insulin-like growth factor 1 level QTL 17	3.5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	5564495	46669029	Rat
7411588	Foco6	Food consumption QTL 6		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	5564495	46669029	Rat
8552912	Pigfal6	Plasma insulin-like growth factor 1 level QTL 6	5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	5564498	46669029	Rat
10059594	Kidm46	Kidney mass QTL 46	3.79	0.025	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	12	6107579	46669029	Rat
1302792	Scl21	Serum cholesterol level QTL 21	3.8	0.0011	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	12	7196730	46669029	Rat
1549829	Scl48	Serum cholesterol level QTL 48	5		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	12	9603277	46669029	Rat
2293699	Bss49	Bone structure and strength QTL 49	5.61	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra trabecular cross-sectional area (CMO:0001692)	12	10474137	46669029	Rat
2300186	Bmd59	Bone mineral density QTL 59	7.1	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	12	10474137	46669029	Rat
1331761	Bp218	Blood pressure QTL 218	2.973		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	12	11073825	45055165	Rat
61404	Bw120	Body weight QTL 120	5.1		body mass (VT:0001259)	body mass index (BMI) (CMO:0000105)	12	12351619	46669029	Rat
1641928	Alcrsp5	Alcohol response QTL 5			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	12	12812385	46669029	Rat
2303569	Gluco44	Glucose level QTL 44	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	12812385	46669029	Rat
1549902	Bp269	Blood pressure QTL 269			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	13182736	46669029	Rat
1549912	Bp268	Blood pressure QTL 268			arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	10	13182736	46669029	Rat
2302060	Pia37	Pristane induced arthritis QTL 37	6.1	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	12	13198157	46669029	Rat
61421	Cia12	Collagen induced arthritis QTL 12	4.6		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	13635523	35682913	Rat
631543	Bp83	Blood pressure QTL 83	5.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	15550826	38478808	Rat
631560	Apr1	Acute phase response QTL 1	6.1		orosomucoid 1 amount (VT:0010541)	plasma orosomucoid 1 level (CMO:0001467)	12	19144362	46669029	Rat
737822	Alc10	Alcohol consumption QTL 10	2.2		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	12	19610870	40218516	Rat
5684888	Pia42	Pristane induced arthritis QTL 42			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	19610870	42828880	Rat
61324	Eae5	Experimental allergic encephalomyelitis QTL 5	14		nervous system integrity trait (VT:0010566)	percentage of study population developing relapsing-remitting experimental autoimmune encephalomyelitis during a period of time (CMO:0001402)	12	19610870	46669029	Rat
1298081	Cia25	Collagen induced arthritis QTL 25	4.7		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	19610889	35682913	Rat
70213	Niddm27	Non-insulin dependent diabetes mellitus QTL 27	3.72		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	19835789	38193007	Rat
7411643	Foco20	Food consumption QTL 20		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	20328819	46669029	Rat
70169	Eae13	Experimental allergic encephalomyelitis QTL 13		0.032	nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	12	24139202	36638073	Rat
1556747	Calcic1	Intracellular calcium level QTL 1		3.6	platelet calcium amount (VT:0010500)	platelet intracellular calcium level (CMO:0000922)	12	28064433	40130419	Rat
1300175	Cm5	Cardiac mass QTL 5	3.78		heart mass (VT:0007028)	heart left ventricle weight to body weight ratio (CMO:0000530)	12	28064433	45899022	Rat
1600386	Calcic2	Intracellular calcium level QTL 2		0.001	platelet physiology trait (VT:0005464)	platelet intracellular calcium level (CMO:0000922)	12	28064433	46669029	Rat
1331787	Rf41	Renal function QTL 41	2.998		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	12	28064557	40218380	Rat
631829	Alc6	Alcohol consumption QTL 6	4.7		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	12	28607526	37691617	Rat
1300162	Bp188	Blood pressure QTL 188	3.19		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	32103174	45899022	Rat

Genetic Models

This gene Sh2b3 is modified in the following models/strains

SS-Sh2b3^em1Mcwi

SS-Sh2b3^em2Mcwi

SS-Sh2b3^em2Mcwi-/-

SS-Sh2b3^em1Mcwi-/+

SS-Sh2b3^em1Mcwi-/-

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	2	43	50	34	19	34	6	9	52	34	41	11	6
Low	1		7	7		7	2	2	22	1			2
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001402348	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_031621	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473973	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000228	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JX215366	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U24652	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U24653	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U24654	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U24655	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSRNOT00000030583 ⟹ ENSRNOP00000038125

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	12	34,731,911 - 34,753,616 (+)	Ensembl
Rnor_6.0 Ensembl	12	40,244,081 - 40,265,757 (+)	Ensembl

RefSeq Acc Id:

NM_031621 ⟹ NP_113809

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	12	34,749,849 - 34,753,616 (+)	NCBI
Rnor_6.0	12	40,261,990 - 40,265,757 (+)	NCBI
Rnor_5.0	12	42,132,947 - 42,136,714 (+)	NCBI
RGSC_v3.4	12	35,954,679 - 35,958,446 (+)	RGD
Celera	12	36,414,671 - 36,418,438 (+)	RGD

Sequence:

show sequence

TCCTAGAGCTCAAAGCCCAAGCTCCAAGAGGCCTGCTCCAGCATCCAGGAGGTCCGACCCTGCA
CACGCCTGGAGATGCCGGACAACCTCTACACCTTTGTGTTGAAGGTGAGCGCCAGGGCTGTGGC
TCCTTGGGGAGACACTGCTGTCTCCTCAGGTGCAGAGCTATATGCCTCCTTTCTGCAGGTGCAG
GGCCAGACAGACATCATCTTTGAGGTGGGAGATGAACAGCAGCTGAACTCATGGCTGGCAGAAC
TCAGGGCAAGCACAGGCCTAGGGTGAGGACCTGCCCATCCCTGGTTCCCTTTGATAACCCCTGC
TGGCCCCCTTCTCACCAGCCTCTTCCCCTACAGGTTGGAGCACCTGGACACAGAGTTACCTCTT
TCCTTAGTGGCAGAGCCTGGCCCAGCTATATCCCCAAGGGGAAGCACGGACTCCCTGGACCAAG
GTATGTGCCAGATCCTTGGTCTCTGGGTGTCCTTGGACATGTGGCCCCTCTGCGGGTCACCACC
ACCATCTTTCTGCCAGGTGCTTCACCTGGGGTGATGTTGGACCCAGCCTGCCAGAAAACAGATC
ACTTCCTGTCCTGCTACCCCTGGTTCCACGGCCCCATCTCCAGGGTGAGGGCTGCACAGCTGGT
TCAGCTGCAGGGCCCTGATGCCCACGGTGTGTTCCTGGTGCGGCAGAGTGAGTCCCGGAGAGGG
GAATATGTACTCACATTCAACTTACAGGGGAGAGCCAAGCACCTCCGCCTGGTGCTCACAGAGC
GTGGACAGTGCCGGGTGCAACACCTGCACTTCCCCTCGGTGGTGGATATGCTCCGCCACTTCCA
GCGCTCCCCCATCCCACTTGAATGTGGAGCAGCCTGTGATGTCCGACTCTCTGGCTATGTGGTA
GTCGTCTCTCAGGCACCAGGTAGGAAGCCCAAAGTTGTGTCAAGGGGTGGTGTCACAGCAAGTA
CAGCACGTACAAAACTTCCTTCCTGGTTACGCCTTCTTCATGGAGTCATCCATGTTATCTCTCC
AGGTTCCTCCAACACCGTTCTCTTCCCCTTTTCCCTTCCTCACTGGGACTCAGAGCTGGGCCAT
CCCCACCTCAGCTCTGCTGGCTGTCCCCCTGGCCATGGTGCAGAGGCTCTCCGTGGCCAAGTGA
CACCTCCTGAGCAGATCTTCCACCTGGTGCCTTCTCCTGAGGAACTGGCCAACAGTCTGCGGCA
GCTGGAGCTTGAGTCTGTGAGCAGTGCCCGGGACTCAGACTATGAAATGGACTCCTCCTCACGG
AGCCACCTTCGGGCCATTGACAACCAGTACACCCCTCTCTCACAGCTGTGCAGAGAGGCAAACT
TGTGAATGTAACCATTTTCCTTCCCTCCAGAGAACTACAGGCTGCTGCTGTCAGCCTTCCCCAG
CTCAGATGTGCCTGCTTCCACCACACACAAGGCTGTCACAGGCTTCTGTCAGCCACAGCTAGCC
TGGCTTCTTCCCACTGTCTGTAGATGTAGTTCTTGTGCACAGGTGCCACTAGCTGGCACCAAGG
CCTCGTTCCCAACCCAGAGGAGGCGGGGCTGCAGGCCCAGAGCTGGCAGTGGAAACTGACAGAG
CTGATGACAGACTTCTTACCAGGTAGGGTCATCGGGAAGCACAAAACACTAACAGTCCCTGGAT
TCTCACATGGTGTCCTTCCCTGTAGCTTCATTCTGTGGCAAGTCTAAGTCCCATGTCACAGGCG
TAGGACACTTCATAATCCTGCTTCTACTCTTAGCTTTGGACAGAAGCTCTGCCAGAGGGGCAAG
CTTAAAGATCAAAAATGATTTAAACATTTTACCTCAGAGTAATTATTTTTAAAGGGTTCAGGTT
TCCACTTGATATTATAGCTTACTTCACTGCACTGCCCTGCTACCCCCTGCCACTGTAAAGTTGG
GGGGAGCTGAGTCCCCCTGCTTTGCTTACCTTGAGCCAGGCTAGCATGCTAGTGTCCTTGTCTG
CTCACCCTCAGGACAGTTGCCTGCTACGGGGTAGACACTGTCCTCCCTAATGTAGAGAATGAAG
TGTGTCACCCTCTCAGGGAAATCCAGGCAGCTTGCAGAGAGAGGAGGGTGGCAGGGGACATTCC
ACCCCAGTGCCTTATGCATTAAAAACAAAATCAGGACTGTGGTTTACAGCAGCGTTAGAGGATG
AGATGAATGGGTGGGGGAAGACAAACACAGATGGAAGGCCTCTAGGCTTCTTTAGTGAACCCAC
ATTTTACTCCCCCCAACCCCCTCCCAGCATCTAGGGGCTTAGTGAGTTTGGCCCATGCTATGAA
GAAACTCCTGTAACCGCTCCTAGGTGTTCTTATCCATACAATCTTTCCATCTAGACAGAGCCAA
AAACTGTCATCTTTCCTAAGGGATGCAGTTCACAGGGACTGGAGCAGGCTGTTCATGGCACAAA
CAGTGCTTACAGCAGTGGCTTTGGGAAACCACAACTTAATTCCTTGAACATTGAGAGGCAGCCA
TGCTGCTGCCCTGCTGCAGACAGCAGTGCTGACTCCCCCTCTGCTCACCTTGCACTCGGGAAGC
CTGCGTGGGCTTTGGTGATGGAAGCAGCTGCACCTCAGCTTCGACACCCACCACAGGTGTGGAC
CTGTGCTCATCTTAGGACAGCGCCTTCCTTCACTGCACATCAGGTATGAACCAGAGACGTGAGC
AGTAACAGCCAGTGGGCCAGGCCGGCTCTAATCCACACAGGATGCGTGGACGGCTGTGCCCTGC
ACCTGGCCAGGAGCTAAACCCACTTCAAACTTGGGGCACTCATTTCTCCTGGGCCTTCAAAGAG
AGACTTGCTAGGTGCTGTAAGCCAGCACCTTGGCCCCTTAGTGCTGGGATTCACTCACTGTGGA
CAGCTTTGTTTCAAAAAATGTCCAAGATATCAGAAAACAAGGTAAAAAAGTCTCATGACTCTGT
GACAGAGTGACAACACTAAGCCAGCACCTTTTCTTTAAGCTAAAGTAGGTCAGTTGGCTGACGG
GGACAGACGGGTACCGGGTATGAGAACTCCTGGGCCAGATACCCTGTGTCAAAGCCAGGCCCCA
CTCCCACCCTCAGCAGTGTCTTCTGGCCACACAAGGCAGGATGGGTCAGTGGCCACTAGAGACA
GAGCAGCTCAACAGTCCTGAACCCCTGCTCCCTTCTCCCGAGTACTCAACTCAGACTAACAAGC
ACCAGCACCAAAGAGTTAGGTCAACTAACCTGCCTTGTCTTTACCAGCATCCACATGGCTTTAT
CTGTATAAATCTTCTGCCTTTGATCATTTCTGGATGGTGTAGGAAAAAAGGAATAGTGACCATT
ACAGTCTTGGGCCAGACAACACTATTTTTACCTAAGTCTCTTAACCTAAATTACGTCGCCTCTT
CCTGAGGCTCAGTCTCTTGTTTAAATGTTACCTTGGTGCAAATAAAAGTGATAAACTGTCCCCC
ACTGCCTCCTGACGAGACACATCTGTCTAATGGCCAGCGTGTGGCTGGAATAAGCAGCATTGTG
ACCACAGGATCAGGGGACTTCATCTTCTATCATTAGAGCAGAAGGTATTTGGCAAATCTTTGTT
TTATGTACTGTACGAGTAACTTATTCTTGAATAATGCAAATTTTCCTACAATGTACAAATTGCT
GTATGTGAATTAAAAAGGTTTTCAGAATTACA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001389277	(Get FASTA)	NCBI Sequence Viewer
	NP_113809	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAC52348	(Get FASTA)	NCBI Sequence Viewer
	AAC52349	(Get FASTA)	NCBI Sequence Viewer
	AAC52350	(Get FASTA)	NCBI Sequence Viewer
	AAC52351	(Get FASTA)	NCBI Sequence Viewer
	AFP87272	(Get FASTA)	NCBI Sequence Viewer
	EDM13717	(Get FASTA)	NCBI Sequence Viewer
	P50745	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:

NP_113809 ⟸ NM_031621

- Sequence:

show sequence

MAGRTQGKHRPRVRTCPSLVPFDNPCWPPSHQPLPLQVGAPGHRVTSFLSGRAWPSYIPKGKHG
LPGPRYVPDPWSLGVLGHVAPLRVTTTIFLPGASPGVMLDPACQKTDHFLSCYPWFHGPISRVR
AAQLVQLQGPDAHGVFLVRQSESRRGEYVLTFNLQGRAKHLRLVLTERGQCRVQHLHFPSVVDM
LRHFQRSPIPLECGAACDVRLSGYVVVVSQAPGRKPKVVSRGGVTASTARTKLPSWLRLLHGVI
HVISPGSSNTVLFPFSLPHWDSELGHPHLSSAGCPPGHGAEALRGQVTPPEQIFHLVPSPEELA
NSLRQLELESVSSARDSDYEMDSSSRSHLRAIDNQYTPLSQLCREANL

hide sequence

RefSeq Acc Id:

ENSRNOP00000038125 ⟸ ENSRNOT00000030583

Protein Domains

SH2

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P50745-F1-model_v2	AlphaFold	P50745	1-368	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:68411	AgrOrtholog
BioCyc Gene	G2FUF-19221	BioCyc
Ensembl Genes	ENSRNOG00000028198	Ensembl, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000038125.4	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000030583.5	UniProtKB/TrEMBL
Gene3D-CATH	2.30.29.30	UniProtKB/TrEMBL
	3.30.505.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	6.10.140.110	UniProtKB/TrEMBL
InterPro	PH-like_dom_sf	UniProtKB/TrEMBL
	Phe_ZIP	UniProtKB/TrEMBL
	Phe_ZIP_sf	UniProtKB/TrEMBL
	SH2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SH2_dom_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SH2B	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SH2B3_SH2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:58838	UniProtKB/Swiss-Prot
NCBI Gene	58838	ENTREZGENE
PANTHER	PTHR10872	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR10872:SF1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Phe_ZIP	UniProtKB/TrEMBL
	SH2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Sh2b3	PhenoGen
PRINTS	SH2DOMAIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	SH2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
SMART	SH2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	PH domain-like	UniProtKB/TrEMBL
	SSF109805	UniProtKB/TrEMBL
	SSF55550	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
TIGR	TC229436
UniProt	D4ABY6	ENTREZGENE, UniProtKB/TrEMBL
	P50745	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-02-18	Sh2b3	SH2B adaptor protein 3	Lnk	linker of T-cell receptor pathways	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2002-06-10	Lnk	linker of T-cell receptor pathways			Name updated	70584	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_domains	contains a Src homology 2 (SH2) domain and a tyrosine phosphorylation site	68272
gene_function	interacts with phospholipase C gamma 1, phosphatidylinositol 3-kinase, and Grb-2 in activated T-cells	68272

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)

Mammalian Phenotype

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)

Mammalian Phenotype