Pdgfc (platelet derived growth factor C)

Advanced Search (OLGA)

Gene: Pdgfc (platelet derived growth factor C) Rattus norvegicus

Analyze

Symbol:

Pdgfc

Name:

platelet derived growth factor C

RGD ID:

68410

Description:

Predicted to enable platelet-derived growth factor receptor binding activity and protein homodimerization activity. Predicted to be involved in several processes, including platelet-derived growth factor receptor signaling pathway; positive regulation of cold-induced thermogenesis; and positive regulation of intracellular signal transduction. Predicted to act upstream of or within several processes, including cellular response to amino acid stimulus; positive regulation of fibroblast proliferation; and regulation of protein phosphorylation. Predicted to be located in several cellular components, including cell surface; cytosol; and extracellular region. Predicted to be active in extracellular space. Orthologous to human PDGFC (platelet derived growth factor C); PARTICIPATES IN platelet-derived growth factor signaling pathway; melanoma pathway; prostate cancer pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil; aflatoxin B1.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

fallotein; PDGF-C; platelet-derived growth factor C; platelet-derived growth factor, C polypeptide; rScdfg; SCDGF; spinal cord-derived growth factor; VEGF-E

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	168,613,409 - 168,791,575 (+)	NCBI		GRCr8
mRatBN7.2	2	166,316,870 - 166,493,449 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	166,316,803 - 166,493,433 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	173,505,985 - 173,680,955 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	171,520,356 - 171,702,464 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	166,129,200 - 166,311,291 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	179,952,227 - 180,126,897 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	179,952,227 - 180,128,283 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	199,362,291 - 199,537,365 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	172,635,732 - 172,811,004 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	2	172,585,837 - 172,761,110 (+)	NCBI
Celera	2	160,357,528 - 160,531,962 (+)	NCBI		Celera
Cytogenetic Map	2	q33-q34	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

COVID-19 (ISO)

Mesothelioma (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-epigallocatechin 3-gallate (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

6-propyl-2-thiouracil (EXP)

aflatoxin B1 (EXP,ISO)

all-trans-retinoic acid (ISO)

ammonium chloride (EXP)

aripiprazole (ISO)

aristolochic acid A (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

cannabidiol (ISO)

carbamazepine (ISO)

carbon nanotube (ISO)

CGP 52608 (ISO)

choline (ISO)

chromium(6+) (ISO)

cisplatin (ISO)

cobalt dichloride (EXP,ISO)

copper atom (EXP,ISO)

copper(0) (EXP,ISO)

Cuprizon (EXP)

cyclosporin A (ISO)

dexamethasone (ISO)

dibenz[a,h]anthracene (ISO)

Dibutyl phosphate (ISO)

divanadium pentaoxide (EXP)

dorsomorphin (ISO)

doxorubicin (ISO)

endosulfan (EXP)

epoxiconazole (ISO)

etoposide (ISO)

flutamide (EXP)

folic acid (ISO)

fulvestrant (ISO)

furan (EXP)

L-methionine (ISO)

lead diacetate (ISO)

manganese(II) chloride (EXP)

mercury dibromide (ISO)

methyl methanesulfonate (ISO)

N,N-diethyl-m-toluamide (EXP)

N-methyl-4-phenylpyridinium (EXP)

ozone (ISO)

panobinostat (ISO)

paracetamol (EXP)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (ISO)

permethrin (EXP)

phenobarbital (ISO)

phenylmercury acetate (ISO)

potassium chromate (ISO)

potassium dichromate (ISO)

quercetin (ISO)

rotenone (EXP,ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

SB 431542 (ISO)

silicon dioxide (ISO)

sodium arsenate (ISO)

sodium arsenite (ISO)

Soman (EXP)

sulforaphane (ISO)

tetrachloroethene (ISO)

tetrachloromethane (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

topotecan (ISO)

Tributyltin oxide (ISO)

trichloroethene (EXP)

trichostatin A (ISO)

triclosan (ISO)

triphenyl phosphate (ISO)

valproic acid (ISO)

vorinostat (ISO)

zoledronic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

activation of transmembrane receptor protein tyrosine kinase activity (ISO)

animal organ morphogenesis (ISO)

bone development (ISO)

cellular response to amino acid stimulus (ISO)

digestive tract development (ISO)

fibroblast proliferation (ISO)

platelet-derived growth factor receptor signaling pathway (IBA,ISO)

positive regulation of cell division (IEA)

positive regulation of cell migration (IBA)

positive regulation of cell population proliferation (IBA,ISO)

positive regulation of cold-induced thermogenesis (ISO,ISS)

positive regulation of ERK1 and ERK2 cascade (IBA)

positive regulation of fibroblast proliferation (ISO)

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction (IBA)

regulation of peptidyl-tyrosine phosphorylation (ISO)

signal transduction (IEA)

Cellular Component

cell surface (ISO)

cytosol (IEA,ISO)

extracellular region (IEA,ISO)

extracellular space (IBA,ISO)

membrane (IEA)

nucleus (IEA)

plasma membrane (IEA,ISO)

Molecular Function

growth factor activity (IEA)

platelet-derived growth factor receptor binding (IBA,ISO)

protein binding (ISO)

protein homodimerization activity (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

melanoma pathway (IEA)

platelet-derived growth factor signaling pathway (ISO)

prostate cancer pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Expression patterns of PDGF-A, -B, -C and -D and the PDGF-receptors alpha and beta in activated rat hepatic stellate cells (HSC).	Breitkopf K, etal., Cytokine. 2005 Sep 7;31(5):349-57.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Molecular cloning of SCDGF-B, a novel growth factor homologous to SCDGF/PDGF-C/fallotein.	Hamada T, etal., Biochem Biophys Res Commun 2001 Jan 26;280(3):733-7.
4.	The expression of SCDGF/PDGF-C/fallotein and SCDGF-B/PDGF-D in the rat central nervous system.	Hamada T, etal., Mech Dev 2002 Mar;112(1-2):161-4.
5.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
6.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
7.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
8.	PID Annotation Import Pipeline	Pipeline to import Pathway Interaction Database annotations from NCI into RGD
9.	GOA pipeline	RGD automated data pipeline
10.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
11.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
12.	Endothelial PDGF-CC regulates angiogenesis-dependent thermogenesis in beige fat.	Seki T, etal., Nat Commun. 2016 Aug 5;7:12152. doi: 10.1038/ncomms12152.

Additional References at PubMed

PMID:10806482	PMID:11940581	PMID:15234987	PMID:15247255	PMID:15361870	PMID:15372073	PMID:18272536	PMID:19199708	PMID:19213942	PMID:19249599	PMID:20548288	PMID:22565577
PMID:23376485	PMID:23938297	PMID:28338461

Genomics

Comparative Map Data

Pdgfc
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	168,613,409 - 168,791,575 (+)	NCBI		GRCr8
mRatBN7.2	2	166,316,870 - 166,493,449 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	166,316,803 - 166,493,433 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	173,505,985 - 173,680,955 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	171,520,356 - 171,702,464 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	166,129,200 - 166,311,291 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	179,952,227 - 180,126,897 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	179,952,227 - 180,128,283 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	199,362,291 - 199,537,365 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	172,635,732 - 172,811,004 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	2	172,585,837 - 172,761,110 (+)	NCBI
Celera	2	160,357,528 - 160,531,962 (+)	NCBI		Celera
Cytogenetic Map	2	q33-q34	NCBI

PDGFC
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	4	156,760,454 - 156,971,799 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	4	156,760,454 - 156,971,799 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	4	157,681,606 - 157,892,951 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	4	157,902,214 - 158,111,996 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	4	158,040,368 - 158,250,151	NCBI
Celera	4	155,025,774 - 155,235,563 (-)	NCBI		Celera
Cytogenetic Map	4	q32.1	NCBI
HuRef	4	153,433,623 - 153,643,623 (-)	NCBI		HuRef
CHM1_1	4	157,660,122 - 157,869,922 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	4	160,106,105 - 160,317,463 (-)	NCBI		T2T-CHM13v2.0

Pdgfc
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	3	80,943,723 - 81,121,347 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	3	80,943,723 - 81,121,347 (+)	Ensembl		GRCm39 Ensembl
GRCm38	3	81,036,416 - 81,214,040 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	3	81,036,416 - 81,214,040 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	3	80,840,338 - 81,017,953 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	3	81,122,343 - 81,299,958 (+)	NCBI		MGSCv36	mm8
Celera	3	81,066,860 - 81,242,401 (+)	NCBI		Celera
Cytogenetic Map	3	E3	NCBI
cM Map	3	35.73	NCBI

Pdgfc
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955471	10,418,455 - 10,500,668 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955471	10,318,683 - 10,500,624 (+)	NCBI	ChiLan1.0	ChiLan1.0

PDGFC
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	3	154,652,310 - 154,863,474 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	4	155,007,121 - 155,219,104 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	4	149,105,330 - 149,317,254 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	4	160,921,353 - 161,132,308 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	4	160,922,827 - 161,131,960 (-)	Ensembl	panpan1.1		panPan2

PDGFC
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	15	54,143,637 - 54,239,962 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	15	54,145,381 - 54,345,830 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	15	54,484,878 - 54,682,918 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	15	54,865,056 - 55,063,272 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	15	54,865,080 - 55,064,935 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	15	54,105,044 - 54,303,114 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	15	54,213,698 - 54,411,745 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	15	54,528,725 - 54,726,824 (-)	NCBI		UU_Cfam_GSD_1.0

Pdgfc
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405301	35,991,126 - 36,189,515 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936576	3,357,424 - 3,554,890 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936576	3,357,399 - 3,555,828 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

PDGFC
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	8	45,578,002 - 45,808,748 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	8	45,579,065 - 45,808,789 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	8	47,676,639 - 47,817,552 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

PDGFC
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	7	103,345,122 - 103,562,961 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	7	103,344,895 - 103,562,962 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666037	83,027,150 - 83,244,526 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Pdgfc
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624848	1,484,947 - 1,674,641 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624848	1,484,904 - 1,674,410 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Pdgfc
1179 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	39
Count of miRNA genes:	38
Interacting mature miRNAs:	39
Transcripts:	ENSRNOT00000015081
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1578648	Bss11	Bone structure and strength QTL 11	4.7		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	2	114837527	211674221	Rat
1358356	Srcrt1	Stress Responsive Cort QTL1	3.66		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	2	161699179	222436696	Rat
1298074	Bp164	Blood pressure QTL 164		0.003	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	42804607	202447032	Rat
6907363	Bp357	Blood pressure QTL 357	4.1	0.002	arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	129540907	174540907	Rat
1354648	Bp239	Blood pressure QTL 239		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	66118463	226797303	Rat
1354649	Kidm17	Kidney mass QTL 17	2.9		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	2	81754530	227146641	Rat
1298076	Bp166	Blood pressure QTL 166		0.0009	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	136445150	202447032	Rat
1554319	Bmd2	Bone mineral density QTL 2	13.4	0.0001	lumbar vertebra area (VT:0010570)	lumbar vertebra cross-sectional area (CMO:0001689)	2	114837675	212549332	Rat
12879836	Kidm61	Kidney mass QTL 61		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	152413072	185122374	Rat
1581569	Uae32	Urinary albumin excretion QTL 32		0.0001	urine protein amount (VT:0005160)	urine albumin excretion rate (CMO:0000757)	2	78665619	219826953	Rat
10043136	Iddm54	Insulin dependent diabetes mellitus QTL 54	3.4	0.0001	blood glucose amount (VT:0000188)	age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140)	2	143657411	190602963	Rat
12879837	Am2	Aortic mass QTL 2		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	2	152413072	185122374	Rat
12879838	Cm86	Cardiac mass QTL 86		0.002	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	2	152413072	185122374	Rat
1302793	Bw16	Body weight QTL 16	5	0.0001	body mass (VT:0001259)	body weight (CMO:0000012)	2	157142209	202446871	Rat
61467	Bp14	Blood pressure QTL 14	2.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	43154682	202446871	Rat
12879839	Cm85	Cardiac mass QTL 85		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	2	152413072	185122374	Rat
70175	BpQTLCluster3	Blood pressure QTL cluster 3	4.128		arterial blood pressure trait (VT:2000000)	absolute change in systolic blood pressure (CMO:0000607)	2	135552573	202446871	Rat
1358900	Bw48	Body weight QTL 48	4.88		body mass (VT:0001259)	body weight (CMO:0000012)	2	157142078	211086598	Rat
12879845	Cm89	Cardiac mass QTL 89		0.008	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	2	152413072	175950118	Rat
1359030	Bp277	Blood pressure QTL 277			arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	114837527	185876470	Rat
12879846	Cm90	Cardiac mass QTL 90		0.011	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	2	152413072	175950118	Rat
12879847	Am4	Aortic mass QTL 4		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	2	152413072	175950118	Rat
1331760	Bp206	Blood pressure QTL 206	3.62454		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	56043031	202447032	Rat
12879840	Bw179	Body weight QTL 179		0.005	body mass (VT:0001259)	body weight (CMO:0000012)	2	152413072	185122374	Rat
1581502	Esta3	Estrogen-induced thymic atrophy QTL 3			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	2	136916935	189599348	Rat
1359032	Hrtrt18	Heart rate QTL 18			heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	2	157142078	192625452	Rat
2301966	Bp322	Blood pressure QTL 322	3.58		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	150540301	202447032	Rat
1298080	Bp163	Blood pressure QTL 163		0.02	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	66118275	202447032	Rat
8662832	Vetf7	Vascular elastic tissue fragility QTL 7	3.5		aorta elastin amount (VT:0003905)	aorta wall extracellular elastin dry weight to aorta wall dry weight ratio (CMO:0002002)	2	81689826	221035911	Rat
1298085	Bp165	Blood pressure QTL 165		0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	42804607	202447032	Rat
1359022	Ppulsi1	Prepulse inhibition QTL 1	3.63		prepulse inhibition trait (VT:0003088)	acoustic startle response measurement (CMO:0001519)	2	136916935	213594495	Rat
1641891	Alcrsp17	Alcohol response QTL 17			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	2	149559561	249053267	Rat
724534	Uae6	Urinary albumin excretion QTL 6	10		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	2	78665619	249053267	Rat
61374	Edpm2	Estrogen-dependent pituitary mass QTL 2	4.42	0.86	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	2	76539322	202447032	Rat
8662843	Vetf9	Vascular elastic tissue fragility QTL 9	2.05		thoracic aorta molecular composition trait (VT:0010568)	aorta wall extracellular elastin dry weight to aorta wall extracellular collagen weight ratio (CMO:0002003)	2	157142078	226277316	Rat
631501	Bp101	Blood pressure QTL 101	2.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	150341684	202446871	Rat
2301415	Cm67	Cardiac mass QTL 67		0.003	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	2	152413072	175950118	Rat
1331794	Bp202	Blood pressure QTL 202	3.66819		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	141194931	223265385	Rat
71113	Cari2	Carrageenan-induced inflammation QTL 2	2.7	0.009	hypodermis integrity trait (VT:0010550)	inflammatory exudate volume (CMO:0001429)	2	141596551	202447032	Rat
1331805	Cm29	Cardiac mass QTL 29	3.50746		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	2	141194931	223265385	Rat
11565180	Kidm56	Kidney mass QTL 56		0.003	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	152413072	175950118	Rat
634308	Sach6	Saccharin preference QTL 6	4.9		taste sensitivity trait (VT:0001986)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	2	112456140	212696837	Rat
1598805	Memor8	Memory QTL 8	3		exploratory behavior trait (VT:0010471)	average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674)	2	150341585	189039377	Rat
11565181	Bw176	Body weight QTL 176		0.002	body mass (VT:0001259)	body weight (CMO:0000012)	2	152413072	175950118	Rat
1358917	Cm42	Cardiac mass QTL 42	2.82		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	203928301	Rat
724568	Uae13	Urinary albumin excretion QTL 13	4.4		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	2	143157029	210020885	Rat
1358913	Cm41	Cardiac mass QTL 41	2.73		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	203928301	Rat
1300165	Rf9	Renal function QTL 9	3.28		kidney glomerulus integrity trait (VT:0010546)	index of glomerular damage (CMO:0001135)	2	133914684	202447032	Rat
61401	Niddm2	Non-insulin dependent diabetes mellitus QTL 2	4.54		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	2	144599348	189599348	Rat
631507	Bp105	Blood pressure QTL 105		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	112456140	212696837	Rat
1641925	Alcrsp2	Alcohol response QTL 2			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	2	149559561	221167075	Rat
1354609	Niddm62	Non-insulin dependent diabetes mellitus QTL 62	4.72	0.000006	insulin secretion trait (VT:0003564)	plasma insulin level (CMO:0000342)	2	150540301	202447032	Rat
631520	Bp73	Blood pressure QTL 73		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	147686913	168355276	Rat
1598833	Bp295	Blood pressure QTL 295	3.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	147798556	192798556	Rat
1354622	Kidm16	Kidney mass QTL 16	3		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	2	81754530	222436696	Rat
631266	Bp132	Blood pressure QTL 132		0.0005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	46123260	202447032	Rat
7488927	Bp365	Blood pressure QTL 365		0.008	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	162765032	207765032	Rat
7488925	Bp364	Blood pressure QTL 364		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	160564068	205564068	Rat
2293843	Kiddil6	Kidney dilation QTL 6	3.1		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	2	42804607	182042367	Rat
2306901	Bp337	Blood pressure QTL 337		0.01	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	164073756	227146641	Rat
1354605	Rf48	Renal function QTL 48	2.9		blood creatinine amount (VT:0005328)	plasma creatinine level (CMO:0000537)	2	74786664	206665859	Rat
6903312	Bw112	Body weight QTL 112	3.2	0.0013	body mass (VT:0001259)	body weight (CMO:0000012)	2	143657569	184114274	Rat
1354601	Slep1	Serum leptin concentration QTL 1	5.39		blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	2	43171017	184114403	Rat

Markers in Region

D2Chm24

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	166,334,196 - 166,334,439 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	179,969,364 - 179,969,608	NCBI	Rnor6.0
Rnor_5.0	2	199,379,428 - 199,379,672	UniSTS	Rnor5.0
RGSC_v3.4	2	172,652,869 - 172,653,113	UniSTS	RGSC3.4
Celera	2	160,374,661 - 160,374,905	UniSTS
Cytogenetic Map	2	q33	UniSTS

BM384420

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	166,403,059 - 166,403,237 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	180,038,703 - 180,038,880	NCBI	Rnor6.0
Rnor_5.0	2	199,448,835 - 199,449,012	UniSTS	Rnor5.0
RGSC_v3.4	2	172,721,667 - 172,721,844	UniSTS	RGSC3.4
Celera	2	160,443,548 - 160,443,725	UniSTS
RH 3.4 Map	2	1078.8	UniSTS
Cytogenetic Map	2	q33	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_031317	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039103196	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039103197	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039103198	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AB033830	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AC128488	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF508348	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473976	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000002	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000015081 ⟹ ENSRNOP00000015081

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	166,316,803 - 166,493,433 (+)	Ensembl
Rnor_6.0 Ensembl	2	179,952,227 - 180,126,897 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000082273 ⟹ ENSRNOP00000068678

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	166,376,803 - 166,493,433 (+)	Ensembl
Rnor_6.0 Ensembl	2	180,012,414 - 180,128,283 (+)	Ensembl

RefSeq Acc Id:

NM_031317 ⟹ NP_112607

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	168,615,168 - 168,790,184 (+)	NCBI
mRatBN7.2	2	166,317,060 - 166,492,058 (+)	NCBI
Rnor_6.0	2	179,952,227 - 180,126,897 (+)	NCBI
Rnor_5.0	2	199,362,291 - 199,537,365 (+)	NCBI
RGSC_v3.4	2	172,635,732 - 172,811,004 (+)	RGD
Celera	2	160,357,528 - 160,531,962 (+)	RGD

Sequence:

show sequence

ATGCTCCTCCTCGGCCTCCTCCTGCTGACATCTGCCCTGGCCGGCCAGAGAACCGGGACTCGGG
CTGAGTCCAACCTGAGCAGCAAGTTGCAGCTCTCCAGCGACAAGGAGCAGAACGGAGTGCAAGA
TCCCCGGCATGAGAGAGTTGTCACTATATCTGGTAATGGGAGCATCCACAGCCCGAAGTTTCCT
CATACCTACCCAAGAAATACGGTGCTGGTCTGGAGATTAGTGGCAGTAGATGAAAATGTGCGGA
TCCAGCTGACATTTGATGAGAGATTTGGGCTGGAAGACCCAGAGGACGATCTATGCAAGTATGA
TTTTGTAGAAGTTGAGGAGCCCAGTGATGGAAGTGTATTAGGACGCTGGTGTGGTTCTGGGACT
GTGCCAGGAAAGCAGACTTCTAAAGGAAATCATATCAGGATAAGATTTGTATCTGATGAGTATT
TCCCATCTGAACCCGGATTCTGCATCCACTACAGTATTATCATGCCACAAGTCACAGAAACTAC
GAGTCCTTCAGTGTTGCCCCCTTCAGCTTTGTCATTGGACCTGCTCAATAATGCTGTGACTGCC
TTCAGTACTGTGGAAGAGCTGATTCGGTTCCTAGAGCCAGATCGATGGCAGATAGACTTGGACA
GCCTCTACAAGCCAACATGGCCGCTTTTGGGCAAAGCTTTCCTGTATGGGAAAAAAAGCAAAGC
GGTGAATCTGAACCTTCTCAAAGAAGAGGTAAAACTTTACAGCTGCACACCCCGGAACTTCTCT
GTGTCCATACGGGAAGAGCTAAAGAGGACAGACACCATATTCTGGCCAGGTTGTCTCCTGGTCA
AGCGCTGTGGAGGAAATTGTGCCTGTTGCCTCCATAATTGCAATGAATGTCAGTGTGTCCCACG
TAAAGTTACAAAAAAGTACCATGAGGTCCTTCAGTTGAGACCAAAAATTGGAGTCAAGGGATTG
CATAAGTCGCTCACCGATGTGGCCCTGGAACACCATGAGGAATGTGACTGTGTGTGTAGAGGAA
ACACAGAAGGGTAACTGCAACCTTCACGGCAGCACTCATCTGCACTGGCATTCTGCGTCCCCCA
CGAGCAACCCTCATCCCCACTAGGATTT

hide sequence

RefSeq Acc Id:

XM_039103196 ⟹ XP_038959124

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	168,613,409 - 168,791,575 (+)	NCBI
mRatBN7.2	2	166,316,870 - 166,493,449 (+)	NCBI

RefSeq Acc Id:

XM_039103197 ⟹ XP_038959125

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	168,615,484 - 168,791,575 (+)	NCBI
mRatBN7.2	2	166,317,368 - 166,493,449 (+)	NCBI

RefSeq Acc Id:

XM_039103198 ⟹ XP_038959126

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	168,615,484 - 168,791,575 (+)	NCBI
mRatBN7.2	2	166,317,370 - 166,493,449 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_112607	(Get FASTA)	NCBI Sequence Viewer
	XP_038959124	(Get FASTA)	NCBI Sequence Viewer
	XP_038959125	(Get FASTA)	NCBI Sequence Viewer
	XP_038959126	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAM47265	(Get FASTA)	NCBI Sequence Viewer
	BAB19969	(Get FASTA)	NCBI Sequence Viewer
	EDM00857	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000015081.3
	ENSRNOP00000068678.1
	ENSRNOP00055001825
	ENSRNOP00060008801
	ENSRNOP00065043156
GenBank Protein	Q9EQX6	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_112607 ⟸ NM_031317
- Peptide Label:	precursor
- UniProtKB:	Q8K429 (UniProtKB/Swiss-Prot), Q9EQX6 (UniProtKB/Swiss-Prot), A6J5T2 (UniProtKB/TrEMBL), A0A0G2JTE4 (UniProtKB/TrEMBL)
- Sequence:	show sequence MLLLGLLLLTSALAGQRTGTRAESNLSSKLQLSSDKEQNGVQDPRHERVVTISGNGSIHSPKFP HTYPRNTVLVWRLVAVDENVRIQLTFDERFGLEDPEDDLCKYDFVEVEEPSDGSVLGRWCGSGT VPGKQTSKGNHIRIRFVSDEYFPSEPGFCIHYSIIMPQVTETTSPSVLPPSALSLDLLNNAVTA FSTVEELIRFLEPDRWQIDLDSLYKPTWPLLGKAFLYGKKSKAVNLNLLKEEVKLYSCTPRNFS VSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPRKVTKKYHEVLQLRPKIGVKGL HKSLTDVALEHHEECDCVCRGNTEG hide sequence

Ensembl Acc Id:

ENSRNOP00000068678 ⟸ ENSRNOT00000082273

Ensembl Acc Id:

ENSRNOP00000015081 ⟸ ENSRNOT00000015081

RefSeq Acc Id:	XP_038959124 ⟸ XM_039103196
- Peptide Label:	isoform X1

RefSeq Acc Id:	XP_038959125 ⟸ XM_039103197
- Peptide Label:	isoform X1

RefSeq Acc Id:	XP_038959126 ⟸ XM_039103198
- Peptide Label:	isoform X1

Protein Domains

CUB Platelet-derived growth factor (PDGF) family

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q9EQX6-F1-model_v2	AlphaFold	Q9EQX6	1-345	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:68410	AgrOrtholog
BioCyc Gene	G2FUF-52704	BioCyc
Ensembl Genes	ENSRNOG00000010695	Ensembl, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ENSRNOG00055001486	UniProtKB/Swiss-Prot
	ENSRNOG00060007117	UniProtKB/Swiss-Prot
	ENSRNOG00065030449	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000015081.5	UniProtKB/Swiss-Prot
	ENSRNOT00000082273.2	UniProtKB/TrEMBL
	ENSRNOT00055002407	UniProtKB/Swiss-Prot
	ENSRNOT00060011691	UniProtKB/Swiss-Prot
	ENSRNOT00065052511	UniProtKB/Swiss-Prot
Gene3D-CATH	2.10.90.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	2.60.120.290	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	CUB_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Cystine-knot_cytokine	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PDGF/VEGF_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Sperma_CUB_dom_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:79429	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
NCBI Gene	79429	ENTREZGENE
PANTHER	PLATELET-DERIVED GROWTH FACTOR	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR11633:SF5	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	CUB	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PDGF	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Pdgfc	PhenoGen
PROSITE	CUB	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PDGF_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000010695	RatGTEx
	ENSRNOG00055001486	RatGTEx
	ENSRNOG00060007117	RatGTEx
	ENSRNOG00065030449	RatGTEx
SMART	CUB	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PDGF	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF49854	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SSF57501	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A0G2JTE4	ENTREZGENE, UniProtKB/TrEMBL
	A6J5T2	ENTREZGENE, UniProtKB/TrEMBL
	PDGFC_RAT	UniProtKB/Swiss-Prot
	Q8K429	ENTREZGENE
	Q9EQX6	ENTREZGENE
UniProt Secondary	Q8K429	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-08-29	Pdgfc	platelet derived growth factor C	Pdgfc	platelet-derived growth factor, C polypeptide	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2002-06-10	Pdgfc	platelet-derived growth factor, C polypeptide			Name updated	70584	APPROVED

RGD Curation Notes

Note Type	Note	Reference

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - CTD

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)

Send us a Message

Imported Disease Annotations - CTD

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)