Ctbp2 (C-terminal binding protein 2)

Advanced Search (OLGA)

Gene: Ctbp2 (C-terminal binding protein 2) Rattus norvegicus

Analyze

Symbol:

Ctbp2

Name:

C-terminal binding protein 2

RGD ID:

68372

Description:

Predicted to enable several functions, including nuclear retinoic acid receptor binding activity; transcription coregulator activity; and transcription corepressor binding activity. Predicted to be a structural constituent of presynaptic active zone. Predicted to be involved in regulation of DNA-templated transcription; synaptic vesicle docking; and white fat cell differentiation. Predicted to act upstream of or within cellular response to leukemia inhibitory factor; positive regulation of retinoic acid receptor signaling pathway; and positive regulation of transcription by RNA polymerase II. Predicted to be located in ribbon synapse. Predicted to be part of transcription repressor complex. Predicted to be active in several cellular components, including photoreceptor ribbon synapse; presynaptic active zone cytoplasmic component; and presynaptic cytosol. Orthologous to human CTBP2 (C-terminal binding protein 2); PARTICIPATES IN chronic myeloid leukemia pathway; Notch signaling pathway; Wnt signaling pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 3,4-methylenedioxymethamphetamine; 6-propyl-2-thiouracil.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

C-terminal-binding protein 2

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	CTBP2 (C-terminal binding protein 2)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Ctbp2 (C-terminal binding protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Ctbp2 (C-terminal binding protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	CTBP2 (C-terminal binding protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	CTBP2 (C-terminal binding protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Ctbp2 (C-terminal binding protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	CTBP2 (C-terminal binding protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	CTBP2 (C-terminal binding protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Ctbp2 (C-terminal binding protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	CTBP1 (C-terminal binding protein 1)	HGNC	OrthoDB
Homo sapiens (human):	SSTR2 (somatostatin receptor 2)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	CTBP2 (C-terminal binding protein 2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Ctbp2 (C-terminal binding protein 2)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	ctbp2a (C-terminal binding protein 2a)	Alliance	DIOPT (OrthoFinder\|PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	CtBP	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	ctbp-1	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	ctbp2	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	197,208,536 - 197,348,802 (-)	NCBI		GRCr8
mRatBN7.2	1	187,782,064 - 187,918,115 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	187,782,682 - 187,920,222 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	196,132,185 - 196,161,990 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	203,309,199 - 203,338,992 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	195,982,314 - 196,012,104 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	205,001,354 - 205,030,565 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	205,001,396 - 205,040,755 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	211,993,864 - 212,023,075 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	192,463,615 - 192,492,935 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	192,613,495 - 192,642,816 (-)	NCBI
Celera	1	185,527,008 - 185,555,539 (-)	NCBI		Celera
Cytogenetic Map	1	q41	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Neoplasm Invasiveness (ISO)

Neoplastic Cell Transformation (ISO)

Prostatic Neoplasms (ISO)

Pulmonary Atresia (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

3,4-methylenedioxymethamphetamine (EXP)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4-hydroxyphenyl retinamide (ISO)

4-methylthio-2-oxobutanoic acid (ISO)

5-fluorouracil (ISO)

6-propyl-2-thiouracil (EXP)

acetamide (EXP)

aflatoxin B1 (ISO)

Aflatoxin B2 alpha (ISO)

all-trans-retinoic acid (ISO)

alpha-Zearalanol (EXP)

amitrole (EXP)

ammonium chloride (EXP)

aristolochic acid A (ISO)

Aroclor 1254 (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

arsenous acid (ISO)

asbestos (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

benzo[e]pyrene (ISO)

bis(2-chloroethyl) sulfide (EXP)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

bucladesine (ISO)

carbamazepine (ISO)

CGP 52608 (ISO)

chlorpyrifos (ISO)

choline (ISO)

copper atom (EXP)

copper(0) (EXP)

copper(II) sulfate (ISO)

Cuprizon (EXP)

cyclosporin A (ISO)

dexamethasone (ISO)

diarsenic trioxide (ISO)

diclofenac (ISO)

dorsomorphin (ISO)

elemental selenium (ISO)

entinostat (ISO)

enzyme inhibitor (ISO)

folic acid (ISO)

fulvestrant (ISO)

furan (EXP)

genistein (ISO)

gentamycin (EXP)

glyphosate (ISO)

indometacin (ISO)

irinotecan (ISO)

ivermectin (ISO)

L-methionine (ISO)

menadione (ISO)

methamphetamine (ISO)

methapyrilene (ISO)

methimazole (EXP)

Muraglitazar (EXP)

nickel atom (ISO)

Nor-9-carboxy-delta9-THC (ISO)

ozone (ISO)

paracetamol (EXP,ISO)

perfluorooctanoic acid (EXP,ISO)

pregnenolone 16alpha-carbonitrile (EXP)

pyruvic acid (ISO)

SB 431542 (ISO)

selenium atom (ISO)

sodium arsenite (ISO)

sulfadimethoxine (EXP)

Tesaglitazar (EXP)

tetrachloromethane (ISO)

thioacetamide (EXP)

trichostatin A (ISO)

triphenyl phosphate (ISO)

triptonide (ISO)

troglitazone (EXP)

urethane (ISO)

valproic acid (ISO)

vinclozolin (EXP)

vitamin E (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cellular response to leukemia inhibitory factor (ISO)

maintenance of presynaptic active zone structure (IEA)

negative regulation of DNA-templated transcription (IEA,ISO,ISS)

positive regulation of retinoic acid receptor signaling pathway (ISO)

positive regulation of transcription by RNA polymerase II (ISO)

regulation of transcription by RNA polymerase II (IBA)

synaptic vesicle docking (ISO)

white fat cell differentiation (ISO,ISS)

Cellular Component

GABA-ergic synapse (ISO)

glutamatergic synapse (ISO)

nucleus (IBA,IEA,ISO,ISS)

photoreceptor ribbon synapse (ISO)

presynaptic active zone cytoplasmic component (ISO)

presynaptic cytosol (ISO)

ribbon synapse (ISO)

synapse (ISO)

transcription repressor complex (ISO,ISS)

Molecular Function

chromatin binding (ISO)

DNA-binding transcription factor binding (IBA)

identical protein binding (ISO)

NAD binding (IEA)

nuclear retinoic acid receptor binding (ISO)

oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor (IEA)

protein binding (ISO)

protein kinase binding (ISO)

protein-containing complex binding (ISO)

structural constituent of presynaptic active zone (ISO)

transcription coactivator activity (IBA,ISO)

transcription coregulator binding (IBA,ISO)

transcription corepressor activity (IBA,IEA,ISO)

transcription corepressor binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

chronic myeloid leukemia pathway (IEA)

Notch signaling pathway (IEA)

Wnt signaling pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
5.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
6.	GOA pipeline	RGD automated data pipeline
7.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
8.	RIBEYE, a component of synaptic ribbons: a protein's journey through evolution provides insight into synaptic ribbon function.	Schmitz F, etal., Neuron 2000 Dec;28(3):857-72.
9.	Tentative Sequence Identification Numbers	Tentative Sequence Data IDs. TIGR Gene Index, Rat Data

Additional References at PubMed

PMID:10567582	PMID:12444977	PMID:16702210	PMID:18483224	PMID:19932743	PMID:20368623	PMID:20439489	PMID:22745816	PMID:22871113	PMID:23138653	PMID:23393140	PMID:23775127
PMID:25447313	PMID:26929012	PMID:31518606	PMID:35969153

Genomics

Comparative Map Data

Ctbp2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	197,208,536 - 197,348,802 (-)	NCBI		GRCr8
mRatBN7.2	1	187,782,064 - 187,918,115 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	187,782,682 - 187,920,222 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	196,132,185 - 196,161,990 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	203,309,199 - 203,338,992 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	195,982,314 - 196,012,104 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	205,001,354 - 205,030,565 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	205,001,396 - 205,040,755 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	211,993,864 - 212,023,075 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	192,463,615 - 192,492,935 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	192,613,495 - 192,642,816 (-)	NCBI
Celera	1	185,527,008 - 185,555,539 (-)	NCBI		Celera
Cytogenetic Map	1	q41	NCBI

CTBP2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	10	124,984,317 - 125,162,463 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	10	124,984,317 - 125,161,170 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	10	126,672,886 - 126,849,599 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	10	126,666,408 - 126,839,614 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	10	126,667,390 - 126,706,443	NCBI
Celera	10	120,450,227 - 120,623,304 (-)	NCBI		Celera
Cytogenetic Map	10	q26.13	NCBI
HuRef	10	120,363,415 - 120,486,611 (-)	NCBI		HuRef
CHM1_1	10	126,958,181 - 127,131,354 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	10	125,865,353 - 126,042,062 (-)	NCBI		T2T-CHM13v2.0

Ctbp2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	7	132,588,727 - 132,726,048 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	7	132,589,292 - 132,726,083 (-)	Ensembl		GRCm39 Ensembl
GRCm38	7	132,986,998 - 133,124,009 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	7	132,987,563 - 133,124,354 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	7	140,178,694 - 140,315,166 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	7	132,825,913 - 132,961,691 (-)	NCBI		MGSCv36	mm8
Celera	7	132,792,998 - 132,952,787 (-)	NCBI		Celera
Cytogenetic Map	7	F3	NCBI
cM Map	7	76.32	NCBI

Ctbp2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955477	2,922,334 - 3,082,406 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955477	2,922,334 - 3,082,088 (-)	NCBI	ChiLan1.0	ChiLan1.0

CTBP2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	8	136,838,857 - 137,011,618 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	10	136,844,222 - 137,016,902 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	10	121,550,194 - 121,722,828 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	10	125,814,926 - 125,985,395 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	10	125,814,926 - 125,901,248 (-)	Ensembl	panpan1.1		panPan2

CTBP2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	28	34,259,912 - 34,415,113 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	28	34,260,856 - 34,415,696 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	28	34,321,769 - 34,478,865 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	28	34,817,289 - 34,974,135 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	28	34,817,450 - 34,972,963 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	28	34,374,411 - 34,531,531 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	28	34,365,420 - 34,522,841 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	28	34,617,559 - 34,774,970 (-)	NCBI		UU_Cfam_GSD_1.0

Ctbp2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024407213	12,300,041 - 12,388,004 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936486	13,173,301 - 13,261,259 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936486	13,173,280 - 13,261,257 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CTBP2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	14	134,329,941 - 134,487,755 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	14	134,329,312 - 134,488,805 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	14	145,880,742 - 145,990,152 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

CTBP2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	9	117,635,124 - 117,806,908 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666048	78,992,159 - 79,163,189 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Ctbp2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624737	22,003,871 - 22,165,257 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624737	22,135,046 - 22,166,580 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Ctbp2
760 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	306
Count of miRNA genes:	149
Interacting mature miRNAs:	192
Transcripts:	ENSRNOT00000023404, ENSRNOT00000023574
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1578778	Pur4	Proteinuria QTL 4	3.3	0.003	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	1	150700247	252085048	Rat
1354646	Kidm18	Kidney mass QTL 18	5.7		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	151162512	256448636	Rat
1578780	Cm52	Cardiac mass QTL 52	3.3	0.0001	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	1	81591954	219808434	Rat
1354652	Kidm20	Kidney mass QTL 20	4.3		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	177227632	256448636	Rat
2302378	Insul11	Insulin level QTL 11	3.25		blood insulin amount (VT:0001560)	serum insulin level (CMO:0000358)	1	144267353	251128347	Rat
1354653	Despr9	Despair related QTL 9		0.00019	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	1	167909849	212909849	Rat
2293673	Bss27	Bone structure and strength QTL 27	18.63	0.0001	femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	1	171629477	216629477	Rat
2293677	Bss41	Bone structure and strength QTL 41	9.38	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra cross-sectional area (CMO:0001689)	1	171629477	216629477	Rat
1302787	Stl25	Serum triglyceride level QTL 25	2.7	0.0073	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	1	180359209	210702199	Rat
70160	Bw18	Body weight QTL 18	5.7		body mass (VT:0001259)	body weight (CMO:0000012)	1	144267353	196383668	Rat
1549830	Bss1	Bone structure and strength QTL 1	4.8		femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	1	172609619	217609619	Rat
7794788	Mcs32	Mammary carcinoma susceptibility QTL 32	2.61		mammary gland integrity trait (VT:0010552)	mammary tumor incidence/prevalence measurement (CMO:0000946)	1	115540693	238914717	Rat
70163	Bw20	Body weight QTL 20	5.1		body mass (VT:0001259)	body weight (CMO:0000012)	1	174133260	219133260	Rat
1578763	Kidm29	Kidney mass QTL 29	3.3	0.0001	kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	1	179567751	260522016	Rat
1354624	Cm35	Cardiac mass QTL35	5.7		heart left ventricle mass (VT:0007031)	calculated heart weight (CMO:0000073)	1	177227632	256448636	Rat
1558658	Bw59	Body weight QTL 59	3.5	0.0003	body mass (VT:0001259)	body weight (CMO:0000012)	1	178784622	223784622	Rat
631838	Niddm36	Non-insulin dependent diabetes mellitus QTL 36		0.01	insulin secretion trait (VT:0003564)	calculated pancreatic islet insulin release measurement (CMO:0001217)	1	184550676	229550676	Rat
1354636	Lmblg1	Limb length QTL 1	6.4		tibia length (VT:0004357)	tibia length (CMO:0000450)	1	151162512	201278233	Rat
1549837	Hcar15	Hepatocarcinoma resistance QTL 15		0.05	liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	153136852	260522016	Rat
2293689	Bss47	Bone structure and strength QTL 47	7.25	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra trabecular cross-sectional area (CMO:0001692)	1	171629477	216629477	Rat
1598853	Memor3	Memory QTL 3	4.5		exploratory behavior trait (VT:0010471)	total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443)	1	143506580	212458660	Rat
61341	Bp26	Blood pressure QTL 26			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	169537671	214537671	Rat
1354634	Kidm12	Kidney mass QTL 12	3.9		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	1	151162512	201278233	Rat
4889428	Stresp24	Stress response QTL 24		0.05	heart pumping trait (VT:2000009)	absolute change in electrocardiographic low frequency R-R spectral component to high frequency R-R spectral component ratio (CMO:0002162)	1	155866514	200866514	Rat
1578759	Uae30	Urinary albumin excretion QTL 30	3.3	0.003	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	150700247	252085048	Rat
61343	Bp28	Blood pressure QTL 28			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	151646613	196646613	Rat
2293693	Bss22	Bone structure and strength QTL 22	33.52	0.0001	femur morphology trait (VT:0000559)	femur cross-sectional area (CMO:0001661)	1	171629477	216629477	Rat
2300161	Bmd43	Bone mineral density QTL 43	8.4	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	1	171629477	216629477	Rat
1300145	Rf7	Renal function QTL 7	2.96		urine creatinine amount (VT:0010540)	urine creatinine level (CMO:0000125)	1	185145134	221264292	Rat
61347	Bp197	Blood pressure QTL 197	4.2		arterial blood pressure trait (VT:2000000)	blood pressure measurement (CMO:0000003)	1	158633083	203633083	Rat
8655655	Arrd2	Age-related retinal degeneration QTL 2	7.79		retinal layer morphology trait (VT:0003727)	percentage of study population developing retinopathy during a period of time (CMO:0002453)	1	183970203	243914901	Rat
61348	Bp30	Blood pressure QTL 30	2.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	144017057	197814409	Rat
2303622	Vencon6	Ventilatory control QTL 6		0.001	respiration trait (VT:0001943)	respiration rate (CMO:0000289)	1	154561505	199561505	Rat
631214	Bw61	Body weight QTL61	3.4	0.0001	intramuscular adipose amount (VT:0010044)	intramuscular fat area (CMO:0001162)	1	173108781	218108781	Rat
7771612	Cm80	Cardiac mass QTL 80	8.4		heart left ventricle mass (VT:0007031)	heart left ventricle weight (CMO:0000776)	1	149448574	221264292	Rat
731168	Bp154	Blood pressure QTL 154	3.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	94642644	214537671	Rat
631205	Bp196	Blood pressure QTL 196	4	0.0001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	118944897	199050459	Rat
2300174	Bmd42	Bone mineral density QTL 42	8.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	bone mineral density (CMO:0001226)	1	171629477	216629477	Rat
737828	Hcas3	Hepatocarcinoma susceptibility QTL 3	4.9		liver integrity trait (VT:0010547)	liver tumorous lesion volume to total liver volume ratio (CMO:0001082)	1	144267353	222987745	Rat
1331749	Hrtrt11	Heart rate QTL 11	2.973		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	1	94494440	198211706	Rat
1354661	Bw33	Body weight QTL 33	5.2		body mass (VT:0001259)	body weight (CMO:0000012)	1	151162512	256448636	Rat
1358886	Bp260	Blood pressure QTL 260	3.67		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	151162766	225824951	Rat
737977	Bp160	Blood pressure QTL 160		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	181133855	226133855	Rat
2293654	Bss30	Bone structure and strength QTL 30	32.65	0.0001	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	1	171629477	216629477	Rat
724531	Uae5	Urinary albumin excretion QTL 5	4		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	1	150700142	252085212	Rat
2300187	Bmd41	Bone mineral density QTL 41	8.9	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	1	171629477	216629477	Rat
1359018	Hrtrt20	Heart rate QTL 20	3.08		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	1	185356336	202902618	Rat
70209	Niddm23	Non-insulin dependent diabetes mellitus QTL 23	2.82		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	94494440	198324465	Rat
1354580	Scort1	Serum corticosterone level QTL 1	3.4		blood corticosterone amount (VT:0005345)	blood corticosterone level (CMO:0001172)	1	156677124	256448636	Rat
634312	Bp143	Blood pressure QTL 143	3	0.0002	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	182623426	219932796	Rat
1358294	Bw37	Body weight QTL 37	5	0.000011	body mass (VT:0001259)	body weight (CMO:0000012)	1	171310381	216310381	Rat
61378	Bp43	Blood pressure QTL 43	22.6		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	181746937	196383668	Rat
634314	Niddm44	Non-insulin dependent diabetes mellitus QTL 44			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	49393289	199050459	Rat
724559	Pancm1	Pancreatic morphology QTL 1	7.1		islet of Langerhans morphology trait (VT:0005215)	pancreatic islet damage composite score (CMO:0001156)	1	181759564	214537555	Rat
2312420	Pur17	Proteinuria QTL 17	7.1	0.0001	urine protein amount (VT:0005160)	urine total protein excretion rate (CMO:0000756)	1	156677124	218753816	Rat
10059600	Bp378	Blood pressure QTL 378	3.08	0.05	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	176869060	221869060	Rat
1354591	Cm36	Cardiac mass QTL 36	4.1		heart left ventricle mass (VT:0007031)	calculated heart weight (CMO:0000073)	1	102813953	201278233	Rat
2312558	Glom17	Glomerulus QTL 17	3.9	0.001	kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	1	166532971	191278129	Rat
7421630	Bp362	Blood pressure QTL 362		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	118608292	241799120	Rat
10059597	Bp377	Blood pressure QTL 377	3.42	0.025	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32737458	199368955	Rat
619613	Bp77	Blood pressure QTL 77		0.01	arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	164747424	209747424	Rat
619614	Bp78	Blood pressure QTL 78		0.001	arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	169112897	197261052	Rat
2312564	Glom18	Glomerulus QTL 18	2.4	0.003	kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	1	185356336	231689108	Rat
634321	Hc1	Hypercalciuria QTL 1	2.91		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	1	178810256	240830002	Rat
724562	Rends1	Renal damage susceptibility QTL 1		0.05	kidney glomerulus integrity trait (VT:0010546)	index of glomerular damage (CMO:0001135)	1	169537671	214537671	Rat
2292222	Bp307	Blood pressure QTL 307	3.06	0.0014	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	164310393	213533942	Rat
2292220	Bp306	Blood pressure QTL 306	3.47	0.00087	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	164310393	243914901	Rat
1354615	Cm32	Cardiac mass QTL 32	5.2		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	1	102813953	201278233	Rat
1600380	Niddm70	Non-insulin dependent diabetes mellitus QTL 70	3.1	0.0008	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	1	176550523	221550523	Rat
1354610	Bw34	Body weight QTL 34	4.1		body mass (VT:0001259)	body weight (CMO:0000012)	1	151162512	256448636	Rat
1354620	Kidm19	Kidney mass QTL 19	4		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	151162512	201278233	Rat
8655855	Arrd3	Age-related retinal degeneration QTL 3	3.07		lens clarity trait (VT:0001304)	cataract incidence/prevalence measurement (CMO:0001585)	1	183970203	243914901	Rat
1354618	Kidm15	Kidney mass QTL 15	5		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	1	156677124	201278233	Rat
6903303	Scl34	Serum cholesterol QTL 34	2.5	0.0033	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	1	180359209	218108781	Rat
631549	Bp89	Blood pressure QTL 89	5.7		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	123350581	201284552	Rat
2293083	Iddm25	Insulin dependent diabetes mellitus QTL 25	4.18		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	181829673	224569684	Rat
1354606	Bp246	Blood pressure QTL 246	3.6		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	1	102813953	218753816	Rat
738032	Hcas5	Hepatocarcinoma susceptibility QTL 5	3.12		liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	176426412	257976495	Rat
1354602	Bw35	Body weight QTL 35	12.2		body mass (VT:0001259)	body weight (CMO:0000012)	1	151162512	201278233	Rat
2325725	Eae31	Experimental allergic encephalomyelitis QTL 31			nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis severity score (CMO:0001419)	1	178810256	188377506	Rat
631670	Iddm10	Insulin dependent diabetes mellitus QTL 10	1.9		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	1	174133260	196383668	Rat

Markers in Region

RH130239

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	187,782,920 - 187,783,110 (+)	MAPPER	mRatBN7.2
mRatBN7.2	19	687,892 - 688,078 (+)	MAPPER	mRatBN7.2
Rnor_6.0	19	896,204 - 896,389	NCBI	Rnor6.0
Rnor_6.0	1	205,001,635 - 205,001,824	NCBI	Rnor6.0
Rnor_5.0	19	896,860 - 897,045	UniSTS	Rnor5.0
Rnor_5.0	1	211,994,145 - 211,994,334	UniSTS	Rnor5.0
RGSC_v3.4	1	192,463,896 - 192,464,085	UniSTS	RGSC3.4
RGSC_v3.4	19	645,674 - 645,859	UniSTS	RGSC3.4
Celera	19	683,662 - 683,847	UniSTS
Celera	1	185,527,289 - 185,527,478	UniSTS
Cytogenetic Map	1	q41	UniSTS
Cytogenetic Map	19	p14	UniSTS

RH144529

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	187,808,280 - 187,808,420 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	205,026,998 - 205,027,137	NCBI	Rnor6.0
Rnor_5.0	1	212,019,508 - 212,019,647	UniSTS	Rnor5.0
RGSC_v3.4	1	192,489,368 - 192,489,507	UniSTS	RGSC3.4
Celera	1	185,551,972 - 185,552,111	UniSTS
RH 3.4 Map	1	1432.7	UniSTS
Cytogenetic Map	1	q41	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_053335	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039092139	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039092148	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039092153	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039092156	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039092159	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039092165	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039092169	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039092172	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039092175	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063275150	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063275154	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063275156	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063275168	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063275191	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063275196	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063275206	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF222712	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473953	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ234649	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000023404 ⟹ ENSRNOP00000023404

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	187,782,682 - 187,811,850 (-)	Ensembl
Rnor_6.0 Ensembl	1	205,001,396 - 205,030,567 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000023574 ⟹ ENSRNOP00000023574

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	187,782,682 - 187,808,038 (-)	Ensembl
Rnor_6.0 Ensembl	1	205,001,761 - 205,040,755 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000099382 ⟹ ENSRNOP00000093562

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	187,782,682 - 187,799,466 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000100484 ⟹ ENSRNOP00000090975

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	187,784,759 - 187,799,466 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000114061 ⟹ ENSRNOP00000090411

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	187,782,682 - 187,920,222 (-)	Ensembl

RefSeq Acc Id:

NM_053335 ⟹ NP_445787

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	197,212,133 - 197,241,903 (-)	NCBI
mRatBN7.2	1	187,782,064 - 187,811,848 (-)	NCBI
Rnor_6.0	1	205,001,354 - 205,030,565 (-)	NCBI
Rnor_5.0	1	211,993,864 - 212,023,075 (-)	NCBI
RGSC_v3.4	1	192,463,615 - 192,492,935 (-)	RGD
Celera	1	185,527,008 - 185,555,539 (-)	RGD

Sequence:

show sequence

GAATTCGGCACGAGGAAAGGCCTCCTCCCCACCTCTGCTGTATTGCTTTGCTCTGCCAATGCCG
GTTCCCAGCAGGCACATCAACATTGGCCGTTCTCAGAGCTGGGATGCCGCTGGCTGGTATGAGG
GCCCTTGGGAGAATGCTGGCCCTCCAGGGAGGAGAAGTTCTCTGACTTATGGCCCTGGAGAAGG
GGTCTGGTGTGAGCTGGTAAACCACCGTGCCCAGGACACTGAGTCCTGCCTGTCCCGGGAAGCT
TTTTATAACTCACTGGCATCAAGAAAGGGCTCCGTGCCTGACTTCACCTTCTACGACAGCAGGC
AGGCAGTGATGTCTGGCCGTGGCTCCGTGCTGCCACAAGACTACTATGGCGACCCATCCAGGGG
CACCAGGGTACCCAAGGAGCCTCCCTTCTATCGGGACCCAGGAACCAGCCGGCCGGTGCCCAGC
TACGGAGTGCTGGGCAGCAGAATACCATGGGAGCAGGTACAAGGCCAGTTACCTGCTCTGCAGG
ATGCTGGCCACCTGTACCGGGAATCTGGGAGTAAAACTGTCCTGCATGGGCAGCGGACACACTG
CAGGGCTCCATCTCCTGGGAGGTATGGAAGGGAACAACCTGATTCTAGATTAGGGATAGAGGTA
CCCACCTATTCCCCCAACTCCAGCCAGGTCTACAACGATATCTGCGAAAGACCCGTTGACTCTA
CCCATGCCAGACAGGTGGCCCCAACATGCCTGGTTGTGGACCCCAGCTCGACCGCCCCTACTGA
GAACAGCACGGGGGTGGCCCCAGGTTCCCTGAATAGAGGCTACGGGCCTACCCGAGAAAGCATC
CATTCAAAGCTGGCTTATGAGAATTATGAAGCCGACTTGTCAACATTCCAAGGACCCGGGGGCA
AGAGGACCGTCTACCCTGAGTTTTTGGCCCTGCTGAGGGCAGAGGGTGTGGCAGAGGCTACCCT
GGCAGCCCTGTTACAACAAGGCTTTGACTCCCCAGCTGTCTTGGCCACCCTAGAGGATGCTGAC
ATCAAGTCTGTTGCCCCCAACCTGGGCCAGGCCCGTGTCCTGAGCCGCCTGGTCAGCAGCTGCA
GGACAGAGATGCAGTTTCGGCGACAGGACCGGACAGGCCCTCCACCCCGCCATCGGTCCAGTAG
CTTCAGCCACCGAAGTGAGCTGCTGCCCAATGACACGGCCTCGCTGGGGACCACAGCACTGCAG
TTTCACCCAGCTGGACCTTTGCAGACACCCTCTCCCCGAGGTGGAGATCTAGGTCGCCGCCCCT
CCAGTGCACCTTCCCAGCACCTCCTGGAGACAGCAGCTACTTACTCTGCCCCAGTGGTGGGGTC
CCAGACTCCCCACTTACCCTCCAACTCTGGATATAGCTCTCCTACCCCTTGTGCCCTAACAGCA
CGACTGGCCTCCTCCTACCCTTCACAAGCTGGGGTAGCCTTGACTGCTAACCCAGGCCCCTCTG
TCCCCCTTCACTCAAGTCCCAGAACAGCCTATTCCACCTCCTACACGGTGCCCATGGAACTGCT
TAAGAGGGAACGCAGTGTGACCGCCTCTCCGCTGCCCAGCCCCCATGCCAGCCCCCAGCTTCTG
CGGAAACCTGGAGCAGCCCCCGTGGAGCCGGCTGCCCTGCCACCAGTCAGGCAAAGTCTCCACA
CACCTCATCCGCCATACCAGAAGGTGGCCCGGCGGACAGGGGCTCCCATCATCGTGTCAACCAT
GCTAACACCAGAACCAAGTATCCGCCCCCAGATCATGAACGGCCCCCTGCACCCCCGCCCCCTA
GTGGCACTGCTGGATGGCAGAGACTGCACTGTGGAAATGCCCATCCTGAAGGACCTGGCCACTG
TGGCCTTCTGTGATGCACAGTCCACTCAGGAAATCCATGAGAAGGTATTGAATGAGGCTGTGGG
CGCCATGATGTACCACACCATCACTCTCACCCGGGAAGACCTGGAGAAGTTCAAGGCCCTGAGA
GTGATTGTTCGAATCGGTAGTGGCTACGACAATGTGGACATCAAGGCTGCTGGCGAACTCGGAA
TCGCCGTGTGCAACATCCCATCTGCTGCAGTGGAGGAGACAGCAGATTCGACAGTCTGCCATAT
CCTCAATCTGTATCGGCGGAACACATGGCTGTACCAGGCCCTACGAGAAGGCACGCGGGTACAA
AGCGTGGAACAGATCCGTGAGGTCGCCTCAGGAGCTGCTCGGATCCGAGGGGAAACACTGGGCC
TCATTGGCTTTGGTCGCACTGGGCAGGCAGTTGCTGTTCGAGCCAAGGCCTTTGGATTCAGCGT
CATATTTTATGACCCCTACTTACAGGATGGGATAGAGCGGTCTCTGGGCGTGCAAAGGGTCTAC
ACCCTGCAGGACTTGTTATATCAGAGCGACTGTGTCTCCTTGCACTGCAATCTGAATGAACACA
ACCACCACCTCATCAATGACTTCACCATCAAGCAGATGAGGCAAGGAGCATTCCTTGTGAATGC
AGCCCGAGGTGGCCTGGTGGATGAGAAAGCCTTAGCTCAGGCCCTCAAAGAGGGCAGGATACGA
GGCGCTGCTCTGGATGTGCATGAGTCTGAGCCCTTCAGCTTTGCTCAGGGCCCATTGAAGGATG
CTCCAAATCTCATCTGCACACCACACACAGCCTGGTACAGCGAACAAGCATCACTAGAGATGAG
GGAAGCAGCTGCCACGGAGATCCGCCGAGCAATCACAGGTCGCATTCCAGAAAGCTTACGAAAC
TGTGTCAACAAAGAATTCTTTGTTACTTCAACTCCTTGGTCAGTCATTGACCAGCAAGCAATTC
ATCCTGAGCTCAATGGTGCCACATACAGGTATCCACCAGGCATTGTAGGTGTGGCTCCAGGAGG
GCTTCCTCCAGCTATGGAAGGGATCATCCCTGGAGGCATCCCTGTGACTCACAACCTCCCCACT
GTGGCACACCCTTCCCAAGCTCCCTCCCCAAACCAGCCCACAAAACACGGGGACAATCGAGAGC
ACCCCAACGAGCAATAGCAGAGAATACGTGAAGGTAATCATTCAGATAAACTTGGGACCAAGAG
ACAGTAGAAAACGGATGAATTTGATGGTCTTTTAAACTGATCCTGGACATCACTGATACTGCAG
TGTGAAAGCTACAAAAGCTAGAAAACAAGATGGTATCTGCTTCCAGAAGTGTGGAAAGACTAGG
ACGTGATTATTAACGACCAACTTCTGTTATTGTGTGTTAAGTTTTTCATCTGTGCATCAAATCA
CAAAGAATAGAGCTTTTCCTTTATCAATCAATCCCCTGGGCACAGCAGGTCCTGCGCAGCTTGT
TGTAGAATGTTGCATCAAGAGCTCCGAATATCAATAAAAAAAATTGAGAGGAAATCCCCATCAA
GGCTAGTCCCTTTGGTCTTCAGGGGCTGGTGCCTCCTTTGCTGATAGGAAGATTAAAAATAAGA
CAAGATGGGGAGGACATTGTTTGCTGGTGTAGACATCTCCGCGCACAGGATTGAAGAGGTAAAA
GCTCCTGTACAGAAGGTTTCACATCTGAGCAGCAAAGTCGGTTGTGAGTTCAGTAAAACCCTCT
GATGACACAAAACAAAAACAACAAACAAACAAAAAAAAAAAAAAAAAACTCGAG

hide sequence

RefSeq Acc Id:

XM_039092139 ⟹ XP_038948067

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	197,212,959 - 197,238,109 (-)	NCBI
mRatBN7.2	1	187,782,070 - 187,808,033 (-)	NCBI

RefSeq Acc Id:

XM_039092148 ⟹ XP_038948076

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	197,212,959 - 197,348,155 (-)	NCBI
mRatBN7.2	1	187,782,070 - 187,918,115 (-)	NCBI

RefSeq Acc Id:

XM_039092153 ⟹ XP_038948081

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	197,212,959 - 197,347,789 (-)	NCBI
mRatBN7.2	1	187,782,070 - 187,917,743 (-)	NCBI

RefSeq Acc Id:

XM_039092156 ⟹ XP_038948084

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	197,212,959 - 197,347,135 (-)	NCBI
mRatBN7.2	1	187,782,070 - 187,916,925 (-)	NCBI

RefSeq Acc Id:

XM_039092159 ⟹ XP_038948087

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	197,212,959 - 197,347,186 (-)	NCBI
mRatBN7.2	1	187,782,070 - 187,917,133 (-)	NCBI

RefSeq Acc Id:

XM_039092165 ⟹ XP_038948093

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	197,212,959 - 197,346,967 (-)	NCBI
mRatBN7.2	1	187,782,070 - 187,916,922 (-)	NCBI

RefSeq Acc Id:

XM_039092169 ⟹ XP_038948097

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	197,212,959 - 197,306,641 (-)	NCBI
mRatBN7.2	1	187,782,070 - 187,842,776 (-)	NCBI

RefSeq Acc Id:

XM_039092172 ⟹ XP_038948100

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	197,212,959 - 197,227,283 (-)	NCBI
mRatBN7.2	1	187,782,070 - 187,797,095 (-)	NCBI

RefSeq Acc Id:

XM_039092175 ⟹ XP_038948103

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	197,212,959 - 197,347,789 (-)	NCBI
mRatBN7.2	1	187,782,070 - 187,917,743 (-)	NCBI

RefSeq Acc Id:

XM_063275150 ⟹ XP_063131220

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	197,212,959 - 197,348,675 (-)	NCBI

RefSeq Acc Id:

XM_063275154 ⟹ XP_063131224

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	197,212,959 - 197,311,643 (-)	NCBI

RefSeq Acc Id:

XM_063275156 ⟹ XP_063131226

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	197,212,959 - 197,306,640 (-)	NCBI

RefSeq Acc Id:

XM_063275168 ⟹ XP_063131238

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	197,212,959 - 197,348,802 (-)	NCBI

RefSeq Acc Id:

XM_063275191 ⟹ XP_063131261

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	197,212,959 - 197,346,963 (-)	NCBI

RefSeq Acc Id:

XM_063275196 ⟹ XP_063131266

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	197,212,959 - 197,347,068 (-)	NCBI

RefSeq Acc Id:

XM_063275206 ⟹ XP_063131276

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	197,208,536 - 197,241,552 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_445787	(Get FASTA)	NCBI Sequence Viewer
	XP_038948067	(Get FASTA)	NCBI Sequence Viewer
	XP_038948076	(Get FASTA)	NCBI Sequence Viewer
	XP_038948081	(Get FASTA)	NCBI Sequence Viewer
	XP_038948084	(Get FASTA)	NCBI Sequence Viewer
	XP_038948087	(Get FASTA)	NCBI Sequence Viewer
	XP_038948093	(Get FASTA)	NCBI Sequence Viewer
	XP_038948097	(Get FASTA)	NCBI Sequence Viewer
	XP_038948100	(Get FASTA)	NCBI Sequence Viewer
	XP_038948103	(Get FASTA)	NCBI Sequence Viewer
	XP_063131220	(Get FASTA)	NCBI Sequence Viewer
	XP_063131224	(Get FASTA)	NCBI Sequence Viewer
	XP_063131226	(Get FASTA)	NCBI Sequence Viewer
	XP_063131238	(Get FASTA)	NCBI Sequence Viewer
	XP_063131261	(Get FASTA)	NCBI Sequence Viewer
	XP_063131266	(Get FASTA)	NCBI Sequence Viewer
	XP_063131276	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAG45952	(Get FASTA)	NCBI Sequence Viewer
	EDM11743	(Get FASTA)	NCBI Sequence Viewer
	EDM11744	(Get FASTA)	NCBI Sequence Viewer
	EDM11745	(Get FASTA)	NCBI Sequence Viewer
	EDM11746	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000023404.3
	ENSRNOP00000023574.3
	ENSRNOP00000090411.1
	ENSRNOP00000090975.1
	ENSRNOP00000093562.1
	ENSRNOP00055036398
	ENSRNOP00060032942
	ENSRNOP00065026680
GenBank Protein	Q9EQH5	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_445787 ⟸ NM_053335

- UniProtKB:

A6HX13 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MPVPSRHINIGRSQSWDAAGWYEGPWENAGPPGRRSSLTYGPGEGVWCELVNHRAQDTESCLSR
EAFYNSLASRKGSVPDFTFYDSRQAVMSGRGSVLPQDYYGDPSRGTRVPKEPPFYRDPGTSRPV
PSYGVLGSRIPWEQVQGQLPALQDAGHLYRESGSKTVLHGQRTHCRAPSPGRYGREQPDSRLGI
EVPTYSPNSSQVYNDICERPVDSTHARQVAPTCLVVDPSSTAPTENSTGVAPGSLNRGYGPTRE
SIHSKLAYENYEADLSTFQGPGGKRTVYPEFLALLRAEGVAEATLAALLQQGFDSPAVLATLED
ADIKSVAPNLGQARVLSRLVSSCRTEMQFRRQDRTGPPPRHRSSSFSHRSELLPNDTASLGTTA
LQFHPAGPLQTPSPRGGDLGRRPSSAPSQHLLETAATYSAPVVGSQTPHLPSNSGYSSPTPCAL
TARLASSYPSQAGVALTANPGPSVPLHSSPRTAYSTSYTVPMELLKRERSVTASPLPSPHASPQ
LLRKPGAAPVEPAALPPVRQSLHTPHPPYQKVARRTGAPIIVSTMLTPEPSIRPQIMNGPLHPR
PLVALLDGRDCTVEMPILKDLATVAFCDAQSTQEIHEKVLNEAVGAMMYHTITLTREDLEKFKA
LRVIVRIGSGYDNVDIKAAGELGIAVCNIPSAAVEETADSTVCHILNLYRRNTWLYQALREGTR
VQSVEQIREVASGAARIRGETLGLIGFGRTGQAVAVRAKAFGFSVIFYDPYLQDGIERSLGVQR
VYTLQDLLYQSDCVSLHCNLNEHNHHLINDFTIKQMRQGAFLVNAARGGLVDEKALAQALKEGR
IRGAALDVHESEPFSFAQGPLKDAPNLICTPHTAWYSEQASLEMREAAATEIRRAITGRIPESL
RNCVNKEFFVTSTPWSVIDQQAIHPELNGATYRYPPGIVGVAPGGLPPAMEGIIPGGIPVTHNL
PTVAHPSQAPSPNQPTKHGDNREHPNEQ

hide sequence

Ensembl Acc Id:

ENSRNOP00000023574 ⟸ ENSRNOT00000023574

Ensembl Acc Id:

ENSRNOP00000023404 ⟸ ENSRNOT00000023404

RefSeq Acc Id:	XP_038948076 ⟸ XM_039092148
- Peptide Label:	isoform X2
- UniProtKB:	Q9EQH5 (UniProtKB/Swiss-Prot), A6HX12 (UniProtKB/TrEMBL), A0A8I6AEI5 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038948103 ⟸ XM_039092175
- Peptide Label:	isoform X4
- UniProtKB:	A0A8I6AEI5 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038948081 ⟸ XM_039092153
- Peptide Label:	isoform X2
- UniProtKB:	Q9EQH5 (UniProtKB/Swiss-Prot), A6HX12 (UniProtKB/TrEMBL), A0A8I6AEI5 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038948087 ⟸ XM_039092159
- Peptide Label:	isoform X2
- UniProtKB:	Q9EQH5 (UniProtKB/Swiss-Prot), A6HX12 (UniProtKB/TrEMBL), A0A8I6AEI5 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038948084 ⟸ XM_039092156
- Peptide Label:	isoform X2
- UniProtKB:	Q9EQH5 (UniProtKB/Swiss-Prot), A6HX12 (UniProtKB/TrEMBL), A0A8I6AEI5 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038948093 ⟸ XM_039092165
- Peptide Label:	isoform X2
- UniProtKB:	Q9EQH5 (UniProtKB/Swiss-Prot), A6HX12 (UniProtKB/TrEMBL), A0A8I6AEI5 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038948097 ⟸ XM_039092169
- Peptide Label:	isoform X2
- UniProtKB:	Q9EQH5 (UniProtKB/Swiss-Prot), A6HX12 (UniProtKB/TrEMBL), A0A8I6AEI5 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038948067 ⟸ XM_039092139
- Peptide Label:	isoform X1
- UniProtKB:	A0A8L2QC65 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038948100 ⟸ XM_039092172
- Peptide Label:	isoform X3
- UniProtKB:	A0A8I6ALN3 (UniProtKB/TrEMBL), A0A8I6AEI5 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000090411 ⟸ ENSRNOT00000114061

Ensembl Acc Id:

ENSRNOP00000090975 ⟸ ENSRNOT00000100484

Ensembl Acc Id:

ENSRNOP00000093562 ⟸ ENSRNOT00000099382

RefSeq Acc Id:	XP_063131276 ⟸ XM_063275206
- Peptide Label:	isoform X5

RefSeq Acc Id:	XP_063131238 ⟸ XM_063275168
- Peptide Label:	isoform X2
- UniProtKB:	Q9EQH5 (UniProtKB/Swiss-Prot), A0A8I6AEI5 (UniProtKB/TrEMBL), A6HX12 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063131220 ⟸ XM_063275150
- Peptide Label:	isoform X2
- UniProtKB:	Q9EQH5 (UniProtKB/Swiss-Prot), A0A8I6AEI5 (UniProtKB/TrEMBL), A6HX12 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063131266 ⟸ XM_063275196
- Peptide Label:	isoform X4
- UniProtKB:	A0A8I6AEI5 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063131261 ⟸ XM_063275191
- Peptide Label:	isoform X4
- UniProtKB:	A0A8I6AEI5 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063131224 ⟸ XM_063275154
- Peptide Label:	isoform X2
- UniProtKB:	Q9EQH5 (UniProtKB/Swiss-Prot), A0A8I6AEI5 (UniProtKB/TrEMBL), A6HX12 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063131226 ⟸ XM_063275156
- Peptide Label:	isoform X2
- UniProtKB:	Q9EQH5 (UniProtKB/Swiss-Prot), A0A8I6AEI5 (UniProtKB/TrEMBL), A6HX12 (UniProtKB/TrEMBL)

Protein Domains

D-isomer specific 2-hydroxyacid dehydrogenase D-isomer specific 2-hydroxyacid dehydrogenase NAD-

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q9EQH5-F1-model_v2	AlphaFold	Q9EQH5	1-445	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:68372	AgrOrtholog
BioCyc Gene	G2FUF-57198	BioCyc
Ensembl Genes	ENSRNOG00000017326	Ensembl, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ENSRNOG00055025762	UniProtKB/Swiss-Prot
	ENSRNOG00060022836	UniProtKB/Swiss-Prot
	ENSRNOG00065019740	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000023404.7	UniProtKB/Swiss-Prot
	ENSRNOT00000023574.7	UniProtKB/TrEMBL
	ENSRNOT00000099382.1	UniProtKB/TrEMBL
	ENSRNOT00000100484.1	UniProtKB/TrEMBL
	ENSRNOT00000114061.1	UniProtKB/Swiss-Prot
	ENSRNOT00055044491	UniProtKB/Swiss-Prot
	ENSRNOT00060039867	UniProtKB/Swiss-Prot
	ENSRNOT00065033348	UniProtKB/Swiss-Prot
Gene3D-CATH	NAD(P)-binding Rossmann-like Domain	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	CtBP	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	CTBP_dehydrogenase	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	D-isomer_2_OHA_DH_cat_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	D-isomer_DH_CS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	D-isomer_DH_NAD-bd	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	NAD(P)-bd_dom_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:81717	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
NCBI Gene	81717	ENTREZGENE
PANTHER	C-TERMINAL-BINDING PROTEIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	C-TERMINAL-BINDING PROTEIN 2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	2-Hacid_dh	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	2-Hacid_dh_C	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Ctbp2	PhenoGen
PROSITE	D_2_HYDROXYACID_DH_3	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000017326	RatGTEx
	ENSRNOG00055025762	RatGTEx
	ENSRNOG00060022836	RatGTEx
	ENSRNOG00065019740	RatGTEx
Superfamily-SCOP	Formate/glycerate dehydrogenase catalytic domain-like	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SSF51735	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
TIGR	TC204483
UniProt	A0A8I6AEI5	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6ALN3	ENTREZGENE, UniProtKB/TrEMBL
	A0A8L2QC65	ENTREZGENE, UniProtKB/TrEMBL
	A6HX12	ENTREZGENE, UniProtKB/TrEMBL
	A6HX13	ENTREZGENE, UniProtKB/TrEMBL
	A6HX14_RAT	UniProtKB/TrEMBL
	A6HX15_RAT	UniProtKB/TrEMBL
	CTBP2_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2002-06-10	Ctbp2	C-terminal binding protein 2			Name updated	70584	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_domains	contains an A domain specific for ribbons, and a B domain identical with CtBP2, a transcriptional repressor that in turn is related to 2-hydroxyacid dehydrogenases	68229

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Annotations - KEGG (archival)