Advanced Search (OLGA)

Gene: Egln2 (egl-9 family hypoxia-inducible factor 2) Rattus norvegicus

Analyze

Symbol:

Egln2

Name:

egl-9 family hypoxia-inducible factor 2

RGD ID:

631376

Description:

Enables peptidyl-proline 4-dioxygenase activity. Involved in peptidyl-proline hydroxylation to 4-hydroxy-L-proline. Predicted to be active in cytoplasm and nucleus. Human ortholog(s) of this gene implicated in renal cell carcinoma. Orthologous to human EGLN2 (egl-9 family hypoxia inducible factor 2); PARTICIPATES IN hypoxia inducible factor pathway; vascular endothelial growth factor signaling pathway; renal cell carcinoma pathway; INTERACTS WITH 1-[3-(dimethylamino)propyl]-1-(4-fluorophenyl)-1,3-dihydro-2-benzofuran-5-carbonitrile; 2,3,7,8-tetrachlorodibenzodioxine; 4,4'-sulfonyldiphenol.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

EGL nine homolog 2; EGL nine homolog 2 (C. elegans); HIF-1alpha prolyl-4-hydroxylase-1; HIF-PH1; HIF-prolyl hydroxylase 1; HPH-1; HPH-3; hypoxia-inducible factor prolyl hydroxylase 1; MGC93662; MGC93666; PHD-1; PHD1; prolyl hydroxylase domain-containing protein 1; prolyl hydroxylase EGLN2

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	EGLN2 (egl-9 family hypoxia inducible factor 2)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Egln2 (egl-9 family hypoxia-inducible factor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Egln2 (egl-9 family hypoxia inducible factor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	EGLN2 (egl-9 family hypoxia inducible factor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	EGLN2 (egl-9 family hypoxia inducible factor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Egln2 (egl-9 family hypoxia inducible factor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	EGLN2 (egl-9 family hypoxia inducible factor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	EGLN2 (egl-9 family hypoxia inducible factor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Egln2 (egl-9 family hypoxia inducible factor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Egln2 (egl-9 family hypoxia inducible factor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	METTL23 (methyltransferase 23, arginine)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	EGLN2 (egl-9 family hypoxia inducible factor 2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Egln2 (egl-9 family hypoxia-inducible factor 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	egln2 (egl-9 family hypoxia-inducible factor 2)	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Hph	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Hph	Alliance	DIOPT (Hieranoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	egl-9	Alliance	DIOPT (Hieranoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	egl-9	Alliance	DIOPT (Hieranoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	egln2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	91,579,205 - 91,586,985 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	1	91,579,206 - 91,587,385 (-)	Ensembl				GRCr8
mRatBN7.2	1	82,451,554 - 82,459,809 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	82,451,555 - 82,459,751 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	1	87,855,015 - 87,862,789 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	96,341,336 - 96,349,127 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	89,610,880 - 89,618,654 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	83,969,456 - 83,977,665 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	83,969,457 - 83,977,236 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	1	85,180,394 - 85,188,608 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	1	82,233,239 - 82,240,990 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	1	76,864,947 - 76,872,062 (-)	NCBI		Celera
RGSC_v3.1	1	82,311,350 - 82,318,466 (-)	NCBI
Cytogenetic Map	1	q21	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

renal cell carcinoma (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,10-phenanthroline (ISO)

1-[3-(dimethylamino)propyl]-1-(4-fluorophenyl)-1,3-dihydro-2-benzofuran-5-carbonitrile (EXP)

17alpha-ethynylestradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2-butoxyethanol (ISO)

4,4'-sulfonyldiphenol (EXP,ISO)

5-chloro-7-iodoquinolin-8-ol (ISO)

ammonium chloride (EXP)

benzene (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

bisphenol F (EXP)

Butylbenzyl phthalate (ISO)

C60 fullerene (EXP)

calcitriol (ISO)

CGP 52608 (ISO)

chlorpyrifos (ISO)

cisplatin (ISO)

citalopram (EXP)

cobalt dichloride (EXP,ISO)

cobalt(2+) sulfate (ISO)

DDT (EXP)

dextran sulfate (ISO)

Dibutyl phosphate (ISO)

dinophysistoxin 1 (ISO)

epoxiconazole (ISO)

folic acid (ISO)

lipopolysaccharide (ISO)

nickel atom (ISO)

paraquat (ISO)

pirinixic acid (ISO)

Soman (EXP)

testosterone (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

triphenyl phosphate (ISO)

urethane (ISO)

valproic acid (ISO)

vinclozolin (EXP)

vitamin E (ISO)

zoledronic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cell redox homeostasis (IEA,ISO)

cellular response to hypoxia (IBA)

peptidyl-proline hydroxylation to 4-hydroxy-L-proline (IDA,ISO)

positive regulation of protein catabolic process (IEA,ISO)

regulation of neuron apoptotic process (IBA,IEA,ISO,ISS)

response to hypoxia (IEA,ISO)

Cellular Component

cytoplasm (IBA)

nucleoplasm (IEA,ISO)

nucleus (IBA,IEA,ISO,ISS)

Molecular Function

2-oxoglutarate-dependent dioxygenase activity (IEA,ISO)

dioxygenase activity (IEA)

ferrous iron binding (IBA,IEA,ISO,ISS)

hypoxia-inducible factor-proline dioxygenase activity (IEA)

iron ion binding (IEA)

L-ascorbic acid binding (IEA)

metal ion binding (IEA)

oxidoreductase activity (IEA)

oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen (IEA)

oxygen sensor activity (IEA,ISO)

peptidyl-proline 4-dioxygenase activity (IBA,IDA,IEA,ISO)

protein binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

hypoxia inducible factor pathway (ISO)

renal cell carcinoma pathway (IEA)

vascular endothelial growth factor signaling pathway (ISS,TAS)

References

References - curated

#	Reference Title	Reference Citation
1.	Oxygen sensing in the hypoxic response pathway: regulation of the hypoxia-inducible transcription factor.	Bruick RK Genes Dev 2003 Nov 1;17(21):2614-23.
2.	Cloning and characterization of the rat HIF-1 alpha prolyl-4-hydroxylase-1 gene.	Cobb RR, etal., Protein Expr Purif. 2005 Aug;42(2):295-304. doi: 10.1016/j.pep.2005.03.036.
3.	Hypoxia up-regulates prolyl hydroxylase activity: a feedback mechanism that limits HIF-1 responses during reoxygenation.	D'Angelo G, etal., J Biol Chem 2003 Oct 3;278(40):38183-7.
4.	Beta-cell alpha-ketoglutarate hydroxylases may acutely participate in insulin secretion.	Fallon MJ and MacDonald MJ, Metabolism. 2008 Aug;57(8):1148-54.
5.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
6.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
7.	HIF-1 and HIF-2 transcription factors--similar but not identical.	Loboda A, etal., Mol Cells. 2010 May;29(5):435-42. Epub 2010 Apr 12.
8.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
9.	PID Annotation Import Pipeline	Pipeline to import Pathway Interaction Database annotations from NCI into RGD
10.	GOA pipeline	RGD automated data pipeline
11.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
12.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
13.	von Hippel-Lindau-dependent patterns of RNA polymerase II hydroxylation in human renal clear cell carcinomas.	Yi Y, etal., Clin Cancer Res. 2010 Nov 1;16(21):5142-52. doi: 10.1158/1078-0432.CCR-09-3416. Epub 2010 Oct 26.

Additional References at PubMed

PMID:11595184	PMID:11598268	PMID:11850811	PMID:12039559	PMID:12615973	PMID:12788921	PMID:18488199	PMID:18651560	PMID:19420289	PMID:19587290	PMID:21262877	PMID:22351621
PMID:22955912	PMID:28594552	PMID:29030976	PMID:34687132

Genomics

Comparative Map Data

Egln2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	91,579,205 - 91,586,985 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	1	91,579,206 - 91,587,385 (-)	Ensembl				GRCr8
mRatBN7.2	1	82,451,554 - 82,459,809 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	82,451,555 - 82,459,751 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	1	87,855,015 - 87,862,789 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	96,341,336 - 96,349,127 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	89,610,880 - 89,618,654 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	83,969,456 - 83,977,665 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	83,969,457 - 83,977,236 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	1	85,180,394 - 85,188,608 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	1	82,233,239 - 82,240,990 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	1	76,864,947 - 76,872,062 (-)	NCBI		Celera
RGSC_v3.1	1	82,311,350 - 82,318,466 (-)	NCBI
Cytogenetic Map	1	q21	NCBI

EGLN2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	19	40,799,191 - 40,808,434 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	19	40,798,996 - 40,808,444 (+)	Ensembl			hg38	GRCh38
GRCh37	19	41,305,096 - 41,314,339 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	19	45,996,888 - 46,006,177 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	19	45,996,984 - 46,006,176	NCBI
Celera	19	38,105,456 - 38,114,745 (+)	NCBI		Celera
Cytogenetic Map	19	q13.2	NCBI
HuRef	19	37,738,282 - 37,747,581 (+)	NCBI		HuRef
CHM1_1	19	41,304,720 - 41,314,010 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	19	43,619,870 - 43,629,113 (+)	NCBI		T2T-CHM13v2.0

Egln2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	7	26,858,083 - 26,866,227 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	7	26,858,083 - 26,866,227 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	7	27,158,658 - 27,166,802 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	7	27,158,658 - 27,166,802 (-)	Ensembl			mm10	GRCm38
MGSCv37	7	27,943,677 - 27,951,821 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	7	26,867,418 - 26,875,665 (-)	NCBI		MGSCv36	mm8
Celera	7	21,735,529 - 21,743,673 (-)	NCBI		Celera
Cytogenetic Map	7	A3	NCBI
cM Map	7	15.83	NCBI

Egln2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955578	548,578 - 557,609 (-)	Ensembl
ChiLan1.0	NW_004955578	541,723 - 557,609 (-)	NCBI	ChiLan1.0	ChiLan1.0

EGLN2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	20	47,057,187 - 47,066,205 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	19	48,928,138 - 48,937,146 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	19	37,842,460 - 37,851,465 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	19	46,348,912 - 46,357,875 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	19	46,349,131 - 46,357,875 (+)	Ensembl			panPan2	panpan1.1

EGLN2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	1	112,992,779 - 113,001,836 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	1	112,992,780 - 113,000,677 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	1	112,395,201 - 112,404,270 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	1	113,591,219 - 113,600,286 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	1	113,591,219 - 113,600,269 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	1	113,150,646 - 113,159,694 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	1	112,782,626 - 112,791,680 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	1	113,776,727 - 113,785,794 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Egln2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409349	14,633,248 - 14,642,158 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936661	3,061,308 - 3,070,192 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936661	3,061,391 - 3,070,219 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

EGLN2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1	6	49,002,266 - 49,010,042 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	44,685,765 - 44,694,868 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

EGLN2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	6	35,251,247 - 35,263,717 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	6	35,251,237 - 35,260,040 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666073	13,388,843 - 13,402,293 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Egln2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624925	707,583 - 716,456 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624925	708,920 - 716,084 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Egln2
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	2	168,776,521 - 168,784,731 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Egln2
28 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	162
Count of miRNA genes:	120
Interacting mature miRNAs:	139
Transcripts:	ENSRNOT00000028434
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1578649	Bmd8	Bone mineral density QTL 8	4.9		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	1	51940904	101229020	Rat
1582234	Gluco18	Glucose level QTL 18	3.4	0.0003	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	87889942	132889942	Rat
1358359	Sradr1	Stress Responsive Adrenal Weight QTL 1	4.74		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	39728272	132889942	Rat
634314	Niddm44	Non-insulin dependent diabetes mellitus QTL 44			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	51941022	208479811	Rat
1358192	Ept13	Estrogen-induced pituitary tumorigenesis QTL 13	3.4		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	1	86622262	131622262	Rat
6903308	Scl36	Serum cholesterol QTL 36	2	0.0125	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	1	58769992	103769992	Rat
1578654	Bss10	Bone structure and strength QTL 10	4		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	1	51940904	168768703	Rat
2300164	Bmd44	Bone mineral density QTL 44	5.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	1	66077886	111077886	Rat
1331800	Scl25	Serum cholesterol level QTL 25	3.013		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	1	87785026	142582336	Rat
7421628	Bp361	Blood pressure QTL 361		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	83019780	128019780	Rat
152025249	Scl82	Serum cholesterol level QTL 82	4.77		blood cholesterol amount (VT:0000180)		1	52891222	109116986	Rat
631495	Bp96	Blood pressure QTL 96	4.52		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	66404680	111404680	Rat
10054135	Gmadr2	Adrenal mass QTL 2	1.97	0.0129	adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	86993904	131993904	Rat
70225	Bp58	Blood pressure QTL 58	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	34184556	172281316	Rat
631512	Scl6	Serum cholesterol level QTL 6	9.6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	1	81269860	99645535	Rat
7411712	Strs4	Sensitivity to stroke QTL 4	8.7		cerebrum integrity trait (VT:0010549)	percentage of study population developing cerebrovascular lesions during a period of time (CMO:0000932)	1	87558587	132558587	Rat
2298545	Neuinf8	Neuroinflammation QTL 8	4.6		nervous system integrity trait (VT:0010566)	spinal cord beta-2 microglobulin mRNA level (CMO:0002125)	1	66009857	160501508	Rat
10059597	Bp377	Blood pressure QTL 377	3.42	0.025	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	34565911	208798288	Rat
1302788	Scl19	Serum cholesterol QTL 19	4.6	0.001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	1	66400974	132889942	Rat
1549903	Bp267	Blood pressure QTL 267			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	84107164	115183752	Rat
2313083	Bmd74	Bone mineral density QTL 74	4	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	1	91302413	136302413	Rat
2313402	Anxrr24	Anxiety related response QTL 24			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	1	51511344	153680016	Rat
61342	Bp27	Blood pressure QTL 27	3.4	0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	65405637	96805205	Rat

Markers in Region

BF418972

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	82,451,320 - 82,451,503 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	83,969,223 - 83,969,405	NCBI	Rnor6.0
Rnor_5.0	1	85,180,161 - 85,180,343	UniSTS	Rnor5.0
RGSC_v3.4	1	82,233,006 - 82,233,188	UniSTS	RGSC3.4
Celera	1	76,864,714 - 76,864,896	UniSTS
RH 3.4 Map	1	840.4	UniSTS
Cytogenetic Map	1	q21	UniSTS

RH125240

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	82,451,578 - 82,451,695 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	83,969,481 - 83,969,597	NCBI	Rnor6.0
Rnor_5.0	1	85,180,419 - 85,180,535	UniSTS	Rnor5.0
RGSC_v3.4	1	82,233,264 - 82,233,380	UniSTS	RGSC3.4
Celera	1	76,864,972 - 76,865,088	UniSTS
Cytogenetic Map	1	q21	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	163	91	90	59	92	59	6	356	192	11	142	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001004083	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006228574	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039111529	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039111536	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC123095	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY229997	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY952204	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC078907	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC081858	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473979	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000028434 ⟹ ENSRNOP00000028434

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	1	91,579,206 - 91,587,385 (-)	Ensembl
mRatBN7.2 Ensembl	1	82,451,555 - 82,459,751 (-)	Ensembl
Rnor_6.0 Ensembl	1	83,969,457 - 83,977,236 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000116136 ⟹ ENSRNOP00000081509

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	1	91,579,206 - 91,586,289 (-)	Ensembl
mRatBN7.2 Ensembl	1	82,451,557 - 82,459,697 (-)	Ensembl

RefSeq Acc Id:

NM_001004083 ⟹ NP_001004083

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	91,579,205 - 91,586,985 (-)	NCBI
mRatBN7.2	1	82,451,554 - 82,459,334 (-)	NCBI
Rnor_6.0	1	83,969,456 - 83,977,236 (-)	NCBI
Rnor_5.0	1	85,180,394 - 85,188,608 (-)	NCBI
RGSC_v3.4	1	82,233,239 - 82,240,990 (-)	RGD
Celera	1	76,864,947 - 76,872,062 (-)	RGD

Sequence:

show sequence

CGTCAGTCCGTCCGTCTGGCAGGACCTCCCTTCCGGCTGGCCACCCCCATCAATCCTTTCTCAA
GCTCCTAGGGACAACTGTGGACTTGGGGATCAGCGAGCACCCCCAGAGCACTAAAGGAGCCCCT
GCTGCCTGCCCTGCCTCACCCTGCCCCACACGAGGCCCAGCGGCCCCGGGCTGCATCAAGTGGA
GGAGGAGGAGGCGGAGGAGGGTGGCACCATGGGCCCGGGCCGTGCCCTCCATGCCCGGGGGATG
AAGACACTGCTGCCATGGACAGCCCGTGCCAGCCGCAGGCCCTGAATCAAGCTCTCCCTCAGTT
GCCAGGGTCTGTGTCAGAGTCCTTGGAGCCTAGCCGAGCCAGGATGGGGGTGGAGAGTTACCTG
CCCTGTCCTCTGCTCCCCTCCTACCACCGTTCAGGAGCATCTGGGGAGGCCTCGGCTGGCAACG
GGACCCCCAGAACCACAGCCACTGCTACTACTACCACTGCCAGTCCCCTGCGGGAGGGCTTTGG
TGGGCAGGATGGTGGTGAGCTGTGGCCACTGCAGAGTGAAGGTGCTGCTGCGTTGGTTACCAAG
GAGTGCCAGCGACTGGCGGCCCAGGGTGCCCGACCTGAGGCCCCCAAACGGAAGTGGGCCAAGG
ATGGTGGGGATGCCCCTTCACCCAGCAAGCGACCGTGGGCCAGGCAAGAGAACCAGGAGGCCAA
GGGGGAAAGTGGTGTGGGCTGTGACAGCGGTGGCGGCAGCAGCAACAGCACTACCCATAGCAGT
GGCGAGGCAAGTTCTAGGCTGAGGGAGGAAGCCCAGCCCTCTGCACCTGAGCGCCTGGCCTTGG
ACTATATTGTGCCTTGCATGCGGTACTATGGTATCTGCGTCAAGGACAACTTCTTGGGGGCAGT
ACTGGGTGGCCGTGTGCTGGCTGAGGTGGAAGCCCTGAAGTGGGGCGGGCGTCTACGTGATGGG
CAACTAGTGAGCCAGCGGGCGATCCCACCGCGCAGCATTCGTGGGGACCAGATTGCCTGGGTAG
AAGGCCACGAGCCAGGCTGCCGGAGCATTGGTGCCCTCATGGCTCATGTGGACGCAGTAATCCG
CCACTGTGCAGGGCGGCTGGGCAACTACGTCATCAATGGGCGCACCAAGGCCATGGTGGCGTGT
TACCCAGGCAATGGGCTCGGGTACGTGAGGCATGTTGACAATCCCCACGGCGATGGGCGCTGCA
TCACCTGTATCTATTACCTGAATCAGAACTGGGATGTTAAGGTGCATGGCGGCCTGCTGCAGAT
CTTCCCTGAGGGTCGGCCAGTGGTAGCCAACATCGAGCCACTCTTTGACCGGTTGCTCATTTTC
TGGTCTGACCGACGGAATCCACATGAGGTGAAGCCAGCCTATGCCACCAGGTACGCCATCACTG
TCTGGTATTTTGATGCCAAGGAGCGGGCAGCAGCCAGAGACAAGTATCAGCTAGCATCGGGACA
GAAAGGTGTTCAAGTACCCGTGTCACAGCCAGCTACACCTACCTAATGGCCAGCCCCAGAGCTG
CATGGGCCAGCAGCTCCTGCCTTGAGGGGAGCCTCAGTGCCCGCCCCTTCCCTGACACTGCTGC
TGCTTCTGGCTTGCCTCTGGATGTGTGGTGTGGAGGGCACTGAGTGTCACTGAGGAGCAACAAG
GAGAGGCCTCTGCTGCCCCGTGAGCAGTGGCCAGTATGGCTGGTGGCCTATGTCCTGCCATGTC
TGGTCCATTGCGTGTTGAGCTGAGGGGAGGCAGGATTTGGGGTTGAGGTGAGTCATGGCCTCTT
GCTGGCAAAGGTCTGTTGGGGGGGTCATCTCACCCCCTCCCCACTCCTCCAGCCTGGAATGTGA
AGTGGCTCCCCAACCCCCTTGCTGTGGCACTTTATGGACTGGGCTGCCACTGTTTGCAGAGTAC
AGTGCCATGAGGAACATGGGTATGGAGGTCCTGCCAGCCAAGAAATAAAAGTTTACCTCAGAGC
TGCAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039111529 ⟹ XP_038967457

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	91,579,205 - 91,586,159 (-)	NCBI
mRatBN7.2	1	82,451,554 - 82,459,809 (-)	NCBI

RefSeq Acc Id:

XM_039111536 ⟹ XP_038967464

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	91,579,205 - 91,581,920 (-)	NCBI
mRatBN7.2	1	82,451,554 - 82,454,269 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001004083	(Get FASTA)	NCBI Sequence Viewer
	XP_038967457	(Get FASTA)	NCBI Sequence Viewer
	XP_038967464	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH78907	(Get FASTA)	NCBI Sequence Viewer
	AAH81858	(Get FASTA)	NCBI Sequence Viewer
	AAO46039	(Get FASTA)	NCBI Sequence Viewer
	AAX51892	(Get FASTA)	NCBI Sequence Viewer
	EDM07971	(Get FASTA)	NCBI Sequence Viewer
	EDM07972	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000028434
	ENSRNOP00000028434.4
	ENSRNOP00000081509
GenBank Protein	Q6AYU4	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001004083 ⟸ NM_001004083

- UniProtKB:

Q6AYU4 (UniProtKB/Swiss-Prot)

- Sequence:

show sequence

MDSPCQPQALNQALPQLPGSVSESLEPSRARMGVESYLPCPLLPSYHRSGASGEASAGNGTPRT
TATATTTTASPLREGFGGQDGGELWPLQSEGAAALVTKECQRLAAQGARPEAPKRKWAKDGGDA
PSPSKRPWARQENQEAKGESGVGCDSGGGSSNSTTHSSGEASSRLREEAQPSAPERLALDYIVP
CMRYYGICVKDNFLGAVLGGRVLAEVEALKWGGRLRDGQLVSQRAIPPRSIRGDQIAWVEGHEP
GCRSIGALMAHVDAVIRHCAGRLGNYVINGRTKAMVACYPGNGLGYVRHVDNPHGDGRCITCIY
YLNQNWDVKVHGGLLQIFPEGRPVVANIEPLFDRLLIFWSDRRNPHEVKPAYATRYAITVWYFD
AKERAAARDKYQLASGQKGVQVPVSQPATPT

hide sequence

Ensembl Acc Id:

ENSRNOP00000028434 ⟸ ENSRNOT00000028434

RefSeq Acc Id:	XP_038967457 ⟸ XM_039111529
- Peptide Label:	isoform X1
- UniProtKB:	A0A8I5ZS56 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038967464 ⟸ XM_039111536
- Peptide Label:	isoform X2
- UniProtKB:	A6J9B3 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000081509 ⟸ ENSRNOT00000116136

Protein Domains

Fe2OG dioxygenase

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q6AYU4-F1-model_v2	AlphaFold	Q6AYU4	1-415	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13689843

Promoter ID:

EPDNEW_R368

Type:

single initiation site

Name:

Egln2_1

Description:

egl-9 family hypoxia-inducible factor 2

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	1	83,977,177 - 83,977,237	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:631376	AgrOrtholog
BioCyc Gene	G2FUF-60325	BioCyc
BioCyc Pathway	PWY-7894 [procollagen hydroxylation and glycosylation]	BioCyc
BioCyc Pathway Image	PWY-7894	BioCyc
Ensembl Genes	ENSRNOG00000020947	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000028434	ENTREZGENE
	ENSRNOT00000028434.7	UniProtKB/Swiss-Prot
	ENSRNOT00000116136	ENTREZGENE
Gene3D-CATH	q2cbj1_9rhob like domain	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7107517	IMAGE-MGC_LOAD
	IMAGE:7113703	IMAGE-MGC_LOAD
InterPro	HIF_prolyl_hydroxylases	UniProtKB/Swiss-Prot
	Oxoglu/Fe-dep_dioxygenase	UniProtKB/Swiss-Prot
	Pro_4_hyd_alph	UniProtKB/Swiss-Prot
	Pro_4_hyd_alph_FE2OG_OXY	UniProtKB/Swiss-Prot
KEGG Report	rno:308457	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:93662	IMAGE-MGC_LOAD
	MGC:93666	IMAGE-MGC_LOAD
NCBI Gene	308457	ENTREZGENE
PANTHER	EGL NINE HOMOLOG-RELATED	UniProtKB/Swiss-Prot
	PROLYL HYDROXYLASE EGLN2	UniProtKB/Swiss-Prot
Pfam	2OG-FeII_Oxy_3	UniProtKB/Swiss-Prot
PhenoGen	Egln2	PhenoGen
PROSITE	FE2OG_OXY	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000020947	RatGTEx
SMART	P4Hc	UniProtKB/Swiss-Prot
UniProt	A0A8I5ZS56	ENTREZGENE, UniProtKB/TrEMBL
	A6J9B3	ENTREZGENE, UniProtKB/TrEMBL
	EGLN2_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2013-09-16	Egln2	egl-9 family hypoxia-inducible factor 2	Egln2	EGL nine homolog 2 (C. elegans)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-02-11	Elgn2	EGL nine homolog 2 (C. elegans)			Symbol and Name status set to approved	625702	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_function	rapidly hydroxylates Pro-564 of Hif1 alpha	727754

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)

BioCyc Pathways

Send us a Message

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)

BioCyc Pathways