Advanced Search (OLGA)

Gene: Disc1 (DISC1 scaffold protein) Rattus norvegicus

Analyze

Symbol:

Disc1

Name:

DISC1 scaffold protein

RGD ID:

631359

Description:

Enables kinesin binding activity. Involved in several processes, including positive regulation of cell projection organization; protein localization to centrosome; and pyramidal neuron migration to cerebral cortex. Acts upstream of or within regulation of glutamatergic synaptic transmission. Located in several cellular components, including central region of growth cone; microtubule cytoskeleton; and perinuclear region of cytoplasm. Part of dynein complex and kinesin complex. Human ortholog(s) of this gene implicated in autism spectrum disorder (multiple); bipolar disorder; chronic fatigue syndrome; major depressive disorder; and psychotic disorder (multiple). Orthologous to human DISC1 (DISC1 scaffold protein); INTERACTS WITH 17alpha-ethynylestradiol; acetamide; ammonium chloride.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

disrupted in schizophrenia 1; disrupted in schizophrenia 1 homolog

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	DISC1 (DISC1 scaffold protein)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Disc1 (disrupted in schizophrenia 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Disc1 (DISC1 scaffold protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	DISC1 (DISC1 scaffold protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	DISC1 (DISC1 scaffold protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Disc1 (DISC1 scaffold protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	DISC1 (DISC1 scaffold protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	DISC1 (DISC1 scaffold protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Disc1 (DISC1 scaffold protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	DISC1 (DISC1 scaffold protein)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Disc1 (disrupted in schizophrenia 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	disc1 (DISC1 scaffold protein)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)

Allele / Splice:

Disc1^em1Rst

Genetic Models:

SD-Disc1^em1Rst

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	19	69,911,548 - 70,120,970 (+)	NCBI		GRCr8
mRatBN7.2	19	53,014,201 - 53,223,617 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	19	53,014,616 - 53,219,778 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	19	59,798,589 - 60,006,037 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	19	60,649,615 - 60,856,157 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	19	62,725,049 - 62,932,128 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	19	57,818,838 - 58,069,992 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	19	57,820,260 - 58,066,152 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	19	68,529,791 - 68,641,620 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
Rnor_5.0	19	68,711,386 - 68,769,050 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	19	55,265,116 - 55,449,375 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	19	55,270,004 - 55,427,798 (+)	NCBI
Celera	19	52,376,528 - 52,580,211 (+)	NCBI		Celera
Cytogenetic Map	19	q12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Actin-Accumulation Myopathy (ISO)

anxiety disorder (ISO)

Asperger syndrome (ISO)

autistic disorder (ISO)

bipolar disorder (ISO)

chronic fatigue syndrome (ISO)

depressive disorder (ISO)

developmental coordination disorder (ISO)

gastrointestinal stromal tumor (ISO)

Hyperkinesis (ISO)

intellectual disability (ISO)

major depressive disorder (ISO)

melancholic depression (ISS)

Pain (ISO)

parathyroid carcinoma (ISO)

psychotic disorder (ISO)

schizophrenia (ISO,ISS)

schizophrenia 9 (ISO)

substance-related disorder (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(S)-amphetamine (ISO)

1,2-dichloroethane (ISO)

17alpha-ethynylestradiol (EXP)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2-hydroxypropanoic acid (ISO)

3',5'-cyclic AMP (ISO)

4,4'-sulfonyldiphenol (ISO)

5-aza-2'-deoxycytidine (ISO)

acetamide (EXP)

aflatoxin B1 (ISO)

Aflatoxin B2 alpha (ISO)

aldehydo-D-glucose (ISO)

all-trans-retinoic acid (ISO)

ammonium chloride (EXP)

aristolochic acid A (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

bisphenol A (EXP,ISO)

cadmium dichloride (ISO)

chlorpyrifos (ISO)

clozapine (ISO)

copper(II) sulfate (ISO)

D-glucose (ISO)

dopamine (ISO)

doxorubicin (ISO)

ethylbenzene (ISO)

FR900359 (ISO)

fructose (ISO)

fulvestrant (ISO)

furan (EXP)

genistein (ISO)

glucose (ISO)

herbicide (ISO)

lead diacetate (EXP)

leflunomide (ISO)

lipopolysaccharide (ISO)

malathion (ISO)

maneb (ISO)

N,N-diethyl-m-toluamide (EXP)

N-nitrosodiethylamine (EXP)

O-methyleugenol (ISO)

paraquat (ISO)

PCB138 (ISO)

permethrin (EXP,ISO)

phenethyl caffeate (EXP)

phenylmercury acetate (ISO)

potassium dichromate (ISO)

propanal (ISO)

rac-lactic acid (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

sodium arsenite (ISO)

T-2 toxin (EXP)

titanium dioxide (ISO)

toluene (ISO)

trichloroethene (EXP)

trichostatin A (ISO)

valproic acid (ISO)

vinclozolin (EXP)

vorinostat (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

canonical Wnt signaling pathway (ISO)

cell proliferation in forebrain (ISO)

cerebral cortex radially oriented cell migration (ISO)

cilium assembly (IBA,IMP)

detection of temperature stimulus involved in sensory perception of pain (ISO)

microtubule cytoskeleton organization (ISO)

mitochondrial calcium ion homeostasis (ISO)

nervous system development (IMP)

neuron cellular homeostasis (ISO)

neuron migration (IBA,ISO)

non-motile cilium assembly (ISO)

positive regulation of axon extension (IMP)

positive regulation of cell-matrix adhesion (IMP)

positive regulation of neuroblast proliferation (ISO)

positive regulation of neuron projection development (IMP)

positive regulation of ubiquitin-dependent protein catabolic process (ISO)

positive regulation of Wnt signaling pathway (ISO)

protein localization (ISO)

protein localization to centrosome (IGI,IMP)

pyramidal neuron migration to cerebral cortex (IMP)

regulation of dendritic spine development (IMP)

regulation of neuron projection development (IMP,ISO)

regulation of postsynapse organization (ISO)

regulation of synapse maturation (ISO)

regulation of synaptic transmission, glutamatergic (IMP)

response to electrical stimulus (IEP)

TOR signaling (ISO)

ubiquitin-dependent protein catabolic process (ISO)

Cellular Component

axon (IDA)

cell body (IDA)

central region of growth cone (IDA)

centrosome (IDA,ISO)

ciliary basal body (ISO)

ciliary base (ISO)

cytosol (IEA,ISO)

dynein complex (IDA)

GABA-ergic synapse (ISO)

glutamatergic synapse (ISO)

intermediate filament cytoskeleton (IBA,ISO)

kinesin complex (IDA)

microtubule (IBA,IDA)

microtubule organizing center (IBA)

mitochondrion (ISO)

perinuclear region of cytoplasm (IDA)

postsynaptic density (ISO)

presynapse (ISO)

synaptic vesicle (ISO)

Molecular Function

cytoskeletal protein binding (TAS)

identical protein binding (ISO)

kinesin binding (IDA)

molecular adaptor activity (ISO)

protein binding (IPI,ISO)

protein-containing complex binding (IDA,IPI)

References

References - curated

#	Reference Title	Reference Citation
1.	The effect of amygdala kindling on hippocampal neurogenesis coincides with decreased reelin and DISC1 expression in the adult dentate gyrus.	Fournier NM, etal., Hippocampus. 2009 Jun 4.
2.	A functional polymorphism in the disrupted-in schizophrenia 1 gene is associated with chronic fatigue syndrome.	Fukuda S, etal., Life Sci. 2010 May 8;86(19-20):722-5. Epub 2010 Mar 20.
3.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
5.	Impact of the DISC1 Ser704Cys polymorphism on risk for major depression, brain morphology and ERK signaling.	Hashimoto R, etal., Hum Mol Genet. 2006 Oct 15;15(20):3024-33. Epub 2006 Sep 7.
6.	A novel DISC1-interacting partner DISC1-Binding Zinc-finger protein: implication in the modulation of DISC1-dependent neurite outgrowth.	Hattori T, etal., Mol Psychiatry. 2007 Apr;12(4):398-407. Epub 2007 Jan 23.
7.	DISC1 regulates cell-cell adhesion, cell-matrix adhesion and neurite outgrowth.	Hattori T, etal., Mol Psychiatry. 2010 Aug;15(8):778, 798-809. Epub 2010 May 18.
8.	Disrupted-in-Schizophrenia 1 (DISC1) regulates spines of the glutamate synapse via Rac1.	Hayashi-Takagi A, etal., Nat Neurosci. 2010 Mar;13(3):327-32. Epub 2010 Feb 7.
9.	PAKs inhibitors ameliorate schizophrenia-associated dendritic spine deterioration in vitro and in vivo during late adolescence.	Hayashi-Takagi A, etal., Proc Natl Acad Sci U S A. 2014 Apr 29;111(17):6461-6. doi: 10.1073/pnas.1321109111. Epub 2014 Apr 3.
10.	DISC1 association, heterogeneity and interplay in schizophrenia and bipolar disorder.	Hennah W, etal., Mol Psychiatry. 2009 Sep;14(9):865-73. Epub 2008 Mar 4.
11.	Disrupted in schizophrenia 1 (DISC1): association with schizophrenia, schizoaffective disorder, and bipolar disorder.	Hodgkinson CA, etal., Am J Hum Genet. 2004 Nov;75(5):862-72. Epub 2004 Sep 22.
12.	Recruitment of PCM1 to the centrosome by the cooperative action of DISC1 and BBS4: a candidate for psychiatric illnesses.	Kamiya A, etal., Arch Gen Psychiatry. 2008 Sep;65(9):996-1006. doi: 10.1001/archpsyc.65.9.996.
13.	DISC1-NDEL1/NUDEL protein interaction, an essential component for neurite outgrowth, is modulated by genetic variations of DISC1.	Kamiya A, etal., Hum Mol Genet. 2006 Nov 15;15(22):3313-23. Epub 2006 Oct 11.
14.	A schizophrenia-associated mutation of DISC1 perturbs cerebral cortex development.	Kamiya A, etal., Nat Cell Biol. 2005 Dec;7(12):1167-78. Epub 2005 Nov 20.
15.	Association of DISC1 gene with schizophrenia in families from two distinct French and Algerian populations.	Lepagnol-Bestel AM, etal., Psychiatr Genet. 2010 Dec;20(6):298-303.
16.	DISC1 regulates primary cilia that display specific dopamine receptors.	Marley A and von Zastrow M, PLoS One. 2010 May 28;5(5):e10902.
17.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
18.	Disruption of two novel genes by a translocation co-segregating with schizophrenia.	Millar JK, etal., Hum Mol Genet. 2000 May 22;9(9):1415-23.
19.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
20.	Disrupted-in-Schizophrenia-1 (DISC-1): mutant truncation prevents binding to NudE-like (NUDEL) and inhibits neurite outgrowth.	Ozeki Y, etal., Proc Natl Acad Sci U S A 2003 Jan 7;100(1):289-94.
21.	PC12 cell model of inducible expression of mutant DISC1: new evidence for a dominant-negative mechanism of abnormal neuronal differentiation.	Pletnikov MV, etal., Neurosci Res. 2007 Jul;58(3):234-44. Epub 2007 Mar 16.
22.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
23.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
24.	A form of DISC1 enriched in nucleus: altered subcellular distribution in orbitofrontal cortex in psychosis and substance/alcohol abuse.	Sawamura N, etal., Proc Natl Acad Sci U S A. 2005 Jan 25;102(4):1187-92. Epub 2005 Jan 18.
25.	DISC1 regulates neurotrophin-induced axon elongation via interaction with Grb2.	Shinoda T, etal., J Neurosci. 2007 Jan 3;27(1):4-14.
26.	DISC1 regulates the transport of the NUDEL/LIS1/14-3-3epsilon complex through kinesin-1.	Taya S, etal., J Neurosci. 2007 Jan 3;27(1):15-26.
27.	Limited association between Disrupted in Schizophrenia 1 (DISC1) gene and bipolar disorder in the Chinese population.	Xiao Y, etal., Psychiatr Genet. 2011 Feb;21(1):42-6.
28.	Evidence for association between Disrupted-in-Schizophrenia 1 (DISC1) gene polymorphisms and autism in Chinese Han population: a family-based association study.	Zheng F, etal., Behav Brain Funct. 2011 May 15;7:14.

Additional References at PubMed

PMID:12874605	PMID:15057822	PMID:17825401	PMID:18955030	PMID:18983980	PMID:19303846	PMID:19368862	PMID:19502360	PMID:19778506	PMID:20624590	PMID:20685985	PMID:20838393
PMID:20880836	PMID:20956536	PMID:21323643	PMID:21471969	PMID:22031837	PMID:22479520	PMID:24301646	PMID:24516667	PMID:24560582	PMID:25224257	PMID:25399920	PMID:25738396
PMID:26078884	PMID:26385055	PMID:26424793	PMID:30409224	PMID:30723982	PMID:30745562	PMID:31103832	PMID:33960643	PMID:35461978	PMID:35715502

Genomics

Comparative Map Data

Disc1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	19	69,911,548 - 70,120,970 (+)	NCBI		GRCr8
mRatBN7.2	19	53,014,201 - 53,223,617 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	19	53,014,616 - 53,219,778 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	19	59,798,589 - 60,006,037 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	19	60,649,615 - 60,856,157 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	19	62,725,049 - 62,932,128 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	19	57,818,838 - 58,069,992 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	19	57,820,260 - 58,066,152 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	19	68,529,791 - 68,641,620 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
Rnor_5.0	19	68,711,386 - 68,769,050 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	19	55,265,116 - 55,449,375 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	19	55,270,004 - 55,427,798 (+)	NCBI
Celera	19	52,376,528 - 52,580,211 (+)	NCBI		Celera
Cytogenetic Map	19	q12	NCBI

DISC1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	231,626,790 - 232,041,272 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	231,626,790 - 232,041,272 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	1	231,762,536 - 232,177,018 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	229,829,184 - 230,243,641 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	1	228,069,295 - 228,483,607	NCBI
Celera	1	205,027,310 - 205,445,842 (+)	NCBI		Celera
Cytogenetic Map	1	q42.2	NCBI
HuRef	1	202,246,109 - 202,664,353 (+)	NCBI		HuRef
CHM1_1	1	233,036,406 - 233,450,761 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	1	231,009,996 - 231,426,811 (+)	NCBI		T2T-CHM13v2.0

Disc1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	8	125,773,928 - 125,991,882 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	8	125,780,934 - 125,988,597 (+)	Ensembl		GRCm39 Ensembl
GRCm38	8	125,048,767 - 125,265,143 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	8	125,054,195 - 125,261,858 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	8	127,578,095 - 127,785,051 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	8	127,940,285 - 128,148,274 (+)	NCBI		MGSCv36	mm8
Celera	8	129,364,004 - 129,569,546 (+)	NCBI		Celera
Cytogenetic Map	8	E2	NCBI
cM Map	8	73.26	NCBI

Disc1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955492	6,953,389 - 7,239,328 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955492	6,946,528 - 7,239,328 (-)	NCBI	ChiLan1.0	ChiLan1.0

DISC1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	17,161,052 - 17,575,242 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	17,356,795 - 17,771,144 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	207,180,513 - 207,594,684 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	212,320,582 - 212,616,406 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	212,265,520 - 212,612,079 (+)	Ensembl	panpan1.1		panPan2

DISC1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	4	7,524,336 - 7,825,143 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	4	7,524,397 - 7,822,558 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	4	7,518,316 - 7,865,131 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	4	7,547,601 - 7,896,939 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	4	7,547,642 - 7,897,205 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	4	7,555,426 - 7,902,062 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	4	7,676,276 - 8,023,319 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	4	7,902,898 - 8,249,898 (-)	NCBI		UU_Cfam_GSD_1.0

Disc1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409344	42,878,559 - 43,045,852 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936484	19,047,215 - 19,237,306 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936484	19,151,752 - 19,237,435 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

DISC1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	14	58,606,464 - 58,963,563 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	14	58,606,441 - 58,963,954 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	14	63,056,095 - 63,124,157 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

DISC1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	25	68,886,451 - 69,274,774 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	25	68,946,430 - 69,263,198 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666055	70,799,188 - 71,196,506 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Disc1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624775	17,831,272 - 18,165,668 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624775	17,820,590 - 18,165,640 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Disc1
2233 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	60
Count of miRNA genes:	54
Interacting mature miRNAs:	59
Transcripts:	ENSRNOT00000057945
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2313395	Anxrr26	Anxiety related response QTL 26			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	19	49976481	53225766	Rat
1578764	Stresp19	Stress response QTL 19	3.6	0.001	blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	19	15630201	57337602	Rat
61350	Bp32	Blood pressure QTL 32		0.012	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	19	20483575	57337602	Rat
5135224	Leukc1	Leukocyte quantity QTL 1			eosinophil quantity (VT:0002602)	blood eosinophil count (CMO:0000033)	19	44340214	55283277	Rat
724546	Kidm3	Kidney mass QTL 3	3.1		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	19	29322490	57337602	Rat
7411549	Bw130	Body weight QTL 130	5	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	19	15455860	57337602	Rat
1358200	Insglur2	Insulin/glucose ratio QTL 2	4.1		blood glucose amount (VT:0000188)	serum glucose level (CMO:0000543)	19	33838214	55283146	Rat
724566	Uae12	Urinary albumin excretion QTL 12	5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	19	2187927	56457239	Rat
1331737	Uae29	Urinary albumin excretion QTL 29	5.5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	19	4096155	55283277	Rat
2298478	Eau8	Experimental allergic uveoretinitis QTL 8		0.0163	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	19	17154433	57337602	Rat

Markers in Region

D19Rat60

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	19	53,217,458 - 53,217,652 (+)	MAPPER	mRatBN7.2
Rnor_6.0	19	58,063,836 - 58,064,029	NCBI	Rnor6.0
Rnor_5.0	19	68,766,731 - 68,766,924	UniSTS	Rnor5.0
RGSC_v3.4	19	55,447,056 - 55,447,249	UniSTS	RGSC3.4
RGSC_v3.4	19	55,447,055 - 55,447,249	RGD	RGSC3.4
RGSC_v3.1	19	55,451,937 - 55,452,130	RGD
Celera	19	52,577,892 - 52,578,085	UniSTS
RH 3.4 Map	19	719.2	RGD
RH 3.4 Map	19	719.2	UniSTS
SHRSP x BN Map	19	43.6299	RGD
SHRSP x BN Map	19	43.6299	UniSTS
Cytogenetic Map	19	q12	UniSTS

BI296374

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	19	53,185,564 - 53,185,784 (+)	MAPPER	mRatBN7.2
Rnor_6.0	19	58,033,016 - 58,033,235	NCBI	Rnor6.0
Rnor_5.0	19	68,736,026 - 68,736,245	UniSTS	Rnor5.0
RGSC_v3.4	19	55,415,475 - 55,415,694	UniSTS	RGSC3.4
Celera	19	52,546,340 - 52,546,559	UniSTS
RH 3.4 Map	19	721.2	UniSTS
Cytogenetic Map	19	q12	UniSTS

BF415610

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	19	53,131,507 - 53,131,642 (+)	MAPPER	mRatBN7.2
Rnor_6.0	19	57,944,392 - 57,944,526	NCBI	Rnor6.0
Rnor_5.0	19	68,652,854 - 68,652,988	UniSTS	Rnor5.0
RGSC_v3.4	19	55,347,455 - 55,347,589	UniSTS	RGSC3.4
Celera	19	52,491,163 - 52,491,297	UniSTS
RH 3.4 Map	19	718.4	UniSTS
Cytogenetic Map	19	q12	UniSTS

fi45a03.x1

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	19	53,074,621 - 53,076,085 (+)	MAPPER	mRatBN7.2
Rnor_6.0	19	57,887,854 - 57,889,317	NCBI	Rnor6.0
Rnor_5.0	19	68,597,827 - 68,599,290	UniSTS	Rnor5.0
RGSC_v3.4	19	55,290,605 - 55,292,068	UniSTS	RGSC3.4
Celera	19	52,434,546 - 52,436,005	UniSTS
Cytogenetic Map	19	q12	UniSTS

Genetic Models

This gene Disc1 is modified in the following models/strains:

SD-Disc1^em1Rst

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_175596	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039097792	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039097793	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039097794	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063278075	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063278076	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063278077	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063278078	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_010060004	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_010060005	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_010060006	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_010060007	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_010060008	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AY177674	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474054	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000019	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000057945 ⟹ ENSRNOP00000054753

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	19	53,034,869 - 53,219,778 (+)	Ensembl
Rnor_6.0 Ensembl	19	57,820,260 - 58,066,152 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000119995 ⟹ ENSRNOP00000095161

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	19	53,014,616 - 53,219,778 (+)	Ensembl

RefSeq Acc Id:

NM_175596 ⟹ NP_783186

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	19	69,911,976 - 70,120,970 (+)	NCBI
mRatBN7.2	19	53,014,620 - 53,223,615 (+)	NCBI
Rnor_6.0	19	57,820,260 - 58,066,155 (+)	NCBI
Rnor_5.0	19	68,529,791 - 68,641,620 (+)	NCBI
Rnor_5.0	19	68,711,386 - 68,769,050 (+)	NCBI
RGSC_v3.4	19	55,265,116 - 55,449,375 (+)	RGD
Celera	19	52,376,528 - 52,580,211 (+)	RGD

Sequence:

show sequence

ATGCAGGGCGCGGGTTCCCGGGGCGCTTGGATCCACAGTCCGAGCCACTGCCCAGGCAATGGGC
ATGGCTCGCCGCCTGCAGTAGCCCCTCAGAGGCGGCGGCTGACACGGAGACCAGGCTACATGAG
AAGCACAGCCAGTCCTGGGATCGGGTTCCTGTCTCCAGCAGTGGGCATGCCACGTCCGATCTCA
GCGGGGCTGACAGGCCAGGAGTTCTACCCCTCACAGTCCAAGGCTAGACAGTGCAGCCTTGACC
TCAGAAGCCACTGCCAAGACTCATTGGTGGGCAACCCTTTTCTCAAGGGCTCCCTTGGCCCTGC
TGTGACCTCTGTGGGCCACCTGCACCCAGCCCAGGGCTCTATGAGAGAAAGGATGGTGCACTCT
GGGGTTCATTCCGGGAATGACAGAAGACAATCCGAGAGGCTGACTGGGGACAGTGGTTGTCGGC
AAGAATTTTTATCTTCAGACAGCTCTAAGTCTCTGGCTTCTAGCCTTGATGTAGCTTGGAGCAA
GGGATCGAGGGGCCTGAAGACTGTGAGGCCTCTGGTATCACCGGCGTCGAATGGCCCCGTTGAC
ATCCCATCCCTTCCTGGGTTCCAAGACACCTTTACTTCCAACTTCAGCTTCATCCGACTCTCCC
TCGGTGCTGCTGGAGAACGCGGAGAAGCAGAAGGTTGCCTGCCATCCAGAGAGGCCGAACCCCT
GCATCAGAGCCCCCAAGAGATGGCAGCTGAAGGATCCGGCTCAGACAGGCCCCACGGGGAGCCT
CGGCATCTCTGGACCTTCAGTCTTCACGCTGCTCCGGGCTTGGTGGACTTGGCTCAGGGGACGA
GGAGCAACAGGCAACCAGAATGTGGCATGGTCTCCTCCTCCGATGCTGGCTTCTCTTCCCAGGA
TGCATCCCCCGCTGGAGGGCGGAGCGACCAGGACGGAGGCTGGGCGGATGCCCATGGATGGCAC
GCTCTGCTCAGGGAATGGGAGCCTATGCTGCAGGACTACCTACTGAGCAACCGCAGGCAGCTGG
AGGTCACTTCCTTGATTTTAAAGCTTCAGAAACTTCAAGAAAAAGCGGTCGAGGATGGCGATTA
CGACATGGCAGAGACACTGAGACAGAGATTGGAAGACCTGGAACAGGAGAAAGGCCGCCTGCCC
TGGGCTCTGCCCTCACAGCAACCAGCCCTTCGCAGCTTCTTGGGGTACCTGGCAACACAGACAC
ACGCGGCCTTGCATGGAGCCCCCCAAAGGGCTGGCAGCGATGACCCAGAAGCCCCACTTGAGGG
ACAGCGGAGGACCACCGCCCAGGATAGCCTGCCGGGACTAGCCGTCACCAGGCGGGACTGGCTG
ATGCGAGAGAAAGAGCAATTGCAGAAGGAAATCGAAGCTCTCCGGGCAAGGGTGTCTGTGCTGG
AGGCGAAGGAACAACGGCTGAGCCAAGAGTTGGAGGATCAGGAGATGCTGCTCCGGTGGCAGGG
CTGTGACCAGATGGCACTGGTGGCACAGCTGTCCCCAGGCCAGCTGCAGGAGGTCAGCAAGGCC
TTGGGAGAGACTCTGACCTCTGCCAGATGGGCTCCCTTCCGCGTGGAGCCACCCGAAACCCTCA
GGAGCCTCCGGGAAAGGACAAAGTCACTCGACCTGGCTGTTAGAGAACTCACTGAGCAGGTATG
CTCAGGTGAGAAGCTATGCAGCTCTCTGAGGAAGAGACTCGCTGACCTTGACACCAGGCTGCCT
GCCTTGCTGGAAGCCAAGATGCTGGCCCTATCAGGAAGCTGCTTCTCTACAGCCAAGGAGCTCG
CAGAGGAGATTTGGGCCGTGTCATCGGAGCGGGAAGGGCTAGAGATGTTCCTGGGCAGGCTGCT
GGCCCTCAGCTCCAGGAACACGAGAAGACTGGGCAGCGTCAAAGAGGACTACCTCAGGTGCAGG
CAGGACCTGGCCCTCCAGGAAGCCGCCCACAAAACACGCGTGAAGGCAAACACTGTGAAGTGCA
CGGAAGTGTTGGAGGGTCAGCTGAGCTGCTGCAGGTGCCCGCTGCTTGAGAGAGTGTGGAAAGC
GGACTTGGAGGCGTGTCAGTTGCTGATGCAGAGCCTAGAGATCCAGGAAGCAGGCAGCAGCTCA
CATGTGGAGGATGAGAAGCAGGTGCACAGCACAGGAGAGGCGGCTCAGACAGCTGCCCTGGCTG
TCCCTAGAACACCCCACCCCGAAGAGGAAAAGTCCCCCTTGCAGGAATCTCATGTCGTTTTTGC
TGAAGTTGGAGACAAATGCGAAGCCATAGGCATGAGGCTCCTGCACCTGGAAGACCAGCTTCTC
GGCGCCATGCACGGTCACGATGAAGCTCTCTTTCAGTCTCTCCAGGGGGAGCTCCAGATGGTTA
AGGAAACACTACAGACCATGTTCCTGCAGCTCCAGCCAGCAAAGGAGGCAGGAGGAGAGGCCTC
AGCTTCCTATTCGACAGCTGGTGCTCAGGAAGCCGAGGACTGA

hide sequence

RefSeq Acc Id:

XM_039097792 ⟹ XP_038953720

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	19	69,911,552 - 70,108,171 (+)	NCBI
mRatBN7.2	19	53,014,202 - 53,210,810 (+)	NCBI

RefSeq Acc Id:

XM_039097793 ⟹ XP_038953721

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	19	69,911,551 - 70,090,316 (+)	NCBI
mRatBN7.2	19	53,014,202 - 53,192,968 (+)	NCBI

RefSeq Acc Id:

XM_039097794 ⟹ XP_038953722

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	19	69,911,552 - 70,023,107 (+)	NCBI
mRatBN7.2	19	53,014,202 - 53,125,894 (+)	NCBI

RefSeq Acc Id:

XM_063278075 ⟹ XP_063134145

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	19	69,911,551 - 70,120,970 (+)	NCBI

RefSeq Acc Id:

XM_063278076 ⟹ XP_063134146

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	19	69,911,550 - 70,120,970 (+)	NCBI

RefSeq Acc Id:

XM_063278077 ⟹ XP_063134147

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	19	69,911,552 - 70,108,236 (+)	NCBI

RefSeq Acc Id:

XM_063278078 ⟹ XP_063134148

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	19	69,911,552 - 70,108,236 (+)	NCBI

RefSeq Acc Id:

XR_010060004

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	19	69,911,549 - 70,120,970 (+)	NCBI

RefSeq Acc Id:

XR_010060005

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	19	69,911,549 - 70,120,970 (+)	NCBI

RefSeq Acc Id:

XR_010060006

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	19	69,911,548 - 70,120,970 (+)	NCBI

RefSeq Acc Id:

XR_010060007

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	19	69,911,548 - 70,120,970 (+)	NCBI

RefSeq Acc Id:

XR_010060008

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	19	69,911,552 - 70,117,132 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_783186	(Get FASTA)	NCBI Sequence Viewer
	XP_038953720	(Get FASTA)	NCBI Sequence Viewer
	XP_038953721	(Get FASTA)	NCBI Sequence Viewer
	XP_038953722	(Get FASTA)	NCBI Sequence Viewer
	XP_063134145	(Get FASTA)	NCBI Sequence Viewer
	XP_063134146	(Get FASTA)	NCBI Sequence Viewer
	XP_063134147	(Get FASTA)	NCBI Sequence Viewer
	XP_063134148	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAO19642	(Get FASTA)	NCBI Sequence Viewer
	EDL96753	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000054753.5
	ENSRNOP00000095161.1
GenBank Protein	Q810H6	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_783186 ⟸ NM_175596

- UniProtKB:

A6KJ31 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MQGAGSRGAWIHSPSHCPGNGHGSPPAVAPQRRRLTRRPGYMRSTASPGIGFLSPAVGMPRPIS
AGLTGQEFYPSQSKARQCSLDLRSHCQDSLVGNPFLKGSLGPAVTSVGHLHPAQGSMRERMVHS
GVHSGNDRRQSERLTGDSGCRQEFLSSDSSKSLASSLDVAWSKGSRGLKTVRPLVSPASNGPVD
IPSLPGFQDTFTSNFSFIRLSLGAAGERGEAEGCLPSREAEPLHQSPQEMAAEGSGSDRPHGEP
RHLWTFSLHAAPGLVDLAQGTRSNRQPECGMVSSSDAGFSSQDASPAGGRSDQDGGWADAHGWH
ALLREWEPMLQDYLLSNRRQLEVTSLILKLQKLQEKAVEDGDYDMAETLRQRLEDLEQEKGRLP
WALPSQQPALRSFLGYLATQTHAALHGAPQRAGSDDPEAPLEGQRRTTAQDSLPGLAVTRRDWL
MREKEQLQKEIEALRARVSVLEAKEQRLSQELEDQEMLLRWQGCDQMALVAQLSPGQLQEVSKA
LGETLTSARWAPFRVEPPETLRSLRERTKSLDLAVRELTEQVCSGEKLCSSLRKRLADLDTRLP
ALLEAKMLALSGSCFSTAKELAEEIWAVSSEREGLEMFLGRLLALSSRNTRRLGSVKEDYLRCR
QDLALQEAAHKTRVKANTVKCTEVLEGQLSCCRCPLLERVWKADLEACQLLMQSLEIQEAGSSS
HVEDEKQVHSTGEAAQTAALAVPRTPHPEEEKSPLQESHVVFAEVGDKCEAIGMRLLHLEDQLL
GAMHGHDEALFQSLQGELQMVKETLQTMFLQLQPAKEAGGEASASYSTAGAQEAED

hide sequence

Ensembl Acc Id:

ENSRNOP00000054753 ⟸ ENSRNOT00000057945

RefSeq Acc Id:	XP_038953720 ⟸ XM_039097792
- Peptide Label:	isoform X3
- UniProtKB:	A6KJ31 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038953721 ⟸ XM_039097793
- Peptide Label:	isoform X4

RefSeq Acc Id:	XP_038953722 ⟸ XM_039097794
- Peptide Label:	isoform X5

Ensembl Acc Id:

ENSRNOP00000095161 ⟸ ENSRNOT00000119995

RefSeq Acc Id:	XP_063134146 ⟸ XM_063278076
- Peptide Label:	isoform X2

RefSeq Acc Id:	XP_063134145 ⟸ XM_063278075
- Peptide Label:	isoform X1

RefSeq Acc Id:	XP_063134147 ⟸ XM_063278077
- Peptide Label:	isoform X6

RefSeq Acc Id:	XP_063134148 ⟸ XM_063278078
- Peptide Label:	isoform X7

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q810H6-F1-model_v2	AlphaFold	Q810H6	1-846	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:631359	AgrOrtholog
BioCyc Gene	G2FUF-5217	BioCyc
Ensembl Genes	ENSRNOG00000019779	Ensembl, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000057945.5	UniProtKB/TrEMBL
	ENSRNOT00000119995.1	UniProtKB/Swiss-Prot
InterPro	DISC1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:307940	UniProtKB/Swiss-Prot
NCBI Gene	307940	ENTREZGENE
PANTHER	DISRUPTED IN SCHIZOPHRENIA 1 PROTEIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR14332	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Disc1	PhenoGen
RatGTEx	ENSRNOG00000019779	RatGTEx
UniProt	A0A8L2QR08_RAT	UniProtKB/TrEMBL
	A6KJ31	ENTREZGENE, UniProtKB/TrEMBL
	DISC1_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2018-03-16	Disc1	DISC1 scaffold protein	Disc1	disrupted in schizophrenia 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-02-11	Disc1	disrupted in schizophrenia 1			Symbol and Name status set to approved	625702	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_mutations_overexpression	expression of mutant form reduces neurite extension in PC12 cells	629536
gene_physical_interaction	interacts with NudE-like (NUDEL)	629536

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM