Advanced Search (OLGA)

Gene: Cacng3 (calcium voltage-gated channel auxiliary subunit gamma 3) Rattus norvegicus

Analyze

Symbol:

Cacng3

Name:

calcium voltage-gated channel auxiliary subunit gamma 3

RGD ID:

628803

Description:

Enables PDZ domain binding activity and ionotropic glutamate receptor binding activity. Involved in positive regulation of AMPA receptor activity. Located in dendrite and excitatory synapse. Part of AMPA glutamate receptor complex. Is active in glutamatergic synapse and postsynaptic density membrane. Human ortholog(s) of this gene implicated in childhood absence epilepsy and macular degeneration. Orthologous to human CACNG3 (calcium voltage-gated channel auxiliary subunit gamma 3); PARTICIPATES IN arrhythmogenic right ventricular cardiomyopathy pathway; dilated cardiomyopathy pathway; hypertrophic cardiomyopathy pathway; INTERACTS WITH 1,2-dimethylhydrazine; 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

calcium channel, voltage-dependent, gamma subunit 3; neuronal voltage-gated calcium channel gamma-3 subunit; TARP gamma-3; transmembrane AMPAR regulatory protein gamma-3; voltage-dependent calcium channel gamma-3 subunit

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	186,632,334 - 186,728,220 (+)	NCBI		GRCr8
GRCr8 Ensembl	1	186,632,323 - 186,728,214 (+)	Ensembl		GRCr8 Ensembl
mRatBN7.2	1	177,201,361 - 177,297,019 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	177,201,288 - 177,297,024 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	185,530,079 - 185,624,581 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	192,716,035 - 192,810,537 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	185,400,681 - 185,495,253 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	192,613,766 - 192,708,371 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	192,613,372 - 192,709,078 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	199,676,988 - 199,771,889 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	181,498,716 - 181,594,090 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	1	174,909,742 - 175,002,485 (+)	NCBI		Celera
RGSC_v3.1	1	181,638,630 - 181,734,005 (+)	NCBI
Cytogenetic Map	1	q36	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

childhood absence epilepsy (ISO)

macular degeneration (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

3,4-methylenedioxymethamphetamine (ISO)

4,4'-sulfonyldiphenol (ISO)

aflatoxin B1 (ISO)

ammonium chloride (EXP)

arsenous acid (ISO)

barium(0) (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

capsaicin (EXP)

cefaloridine (EXP)

CGP 52608 (ISO)

chlorpyrifos (ISO)

diarsenic trioxide (ISO)

dibutyl phthalate (EXP)

diethylstilbestrol (EXP)

flavonoids (EXP)

ketoconazole (EXP)

Nor-9-carboxy-delta9-THC (ISO)

sulindac sulfide (ISO)

valproic acid (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

calcium ion transmembrane transport (IEA)

calcium ion transport (IEA)

intracellular protein localization (IEA,ISO,ISS)

monoatomic ion transmembrane transport (IEA)

monoatomic ion transport (IEA)

neurotransmitter receptor localization to postsynaptic specialization membrane (IEA,ISO)

positive regulation of AMPA receptor activity (IDA)

positive regulation of synaptic transmission, glutamatergic (IBA)

postsynaptic neurotransmitter receptor diffusion trapping (IBA)

protein targeting (IEA,ISO,ISS)

regulation of AMPA receptor activity (IDA)

transmission of nerve impulse (IBA)

Cellular Component

AMPA glutamate receptor complex (IBA,IDA,IEA,ISO)

dendrite (IDA)

excitatory synapse (IDA)

glutamatergic synapse (IDA,IEA,IEP,ISO)

membrane (IEA)

monoatomic ion channel complex (IEA)

postsynaptic density membrane (IBA,IDA,IEA,IEP,ISO)

Schaffer collateral - CA1 synapse (IEA,ISO)

somatodendritic compartment (IEA,ISO,ISS)

Molecular Function

calcium channel activity (IEA)

channel regulator activity (IBA)

ionotropic glutamate receptor binding (IDA,IEA)

PDZ domain binding (IDA)

protein binding (ISO)

voltage-gated calcium channel activity (IBA)

Molecular Pathway Annotations Click to see Annotation Detail View

arrhythmogenic right ventricular cardiomyopathy pathway (IEA)

dilated cardiomyopathy pathway (IEA)

hypertrophic cardiomyopathy pathway (IEA)

mitogen activated protein kinase signaling pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Identification of three novel Ca(2+) channel gamma subunit genes reveals molecular diversification by tandem and chromosome duplication.	Burgess DL, etal., Genome Res 1999 Dec;9(12):1204-13.
2.	Calcium channel gamma subunits provide insights into the evolution of this gene family.	Chu PJ, etal., Gene 2001 Dec 12;280(1-2):37-48.
3.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
5.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
6.	TARP subtypes differentially and dose-dependently control synaptic AMPA receptor gating.	Milstein AD, etal., Neuron. 2007 Sep 20;55(6):905-18.
7.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
8.	GOA pipeline	RGD automated data pipeline
9.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
10.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
11.	Linkage analysis between childhood absence epilepsy and genes encoding GABAA and GABAB receptors, voltage-dependent calcium channels, and the ECA1 region on chromosome 8q.	Robinson R, etal., Epilepsy Res 2002 Feb;48(3):169-79.
12.	Functional proteomics identify cornichon proteins as auxiliary subunits of AMPA receptors.	Schwenk J, etal., Science. 2009 Mar 6;323(5919):1313-9. doi: 10.1126/science.1167852.
13.	Selective regulation of long-form calcium-permeable AMPA receptors by an atypical TARP, gamma-5.	Soto D, etal., Nat Neurosci. 2009 Mar;12(3):277-85. doi: 10.1038/nn.2266. Epub 2009 Feb 22.
14.	Dissection of chromosome 16p12 linkage peak suggests a possible role for CACNG3 variants in age-related macular degeneration susceptibility.	Spencer KL, etal., Invest Ophthalmol Vis Sci. 2011 Mar 28;52(3):1748-54. doi: 10.1167/iovs.09-5112. Print 2011 Mar.
15.	Functional studies and distribution define a family of transmembrane AMPA receptor regulatory proteins.	Tomita S, etal., J Cell Biol. 2003 May 26;161(4):805-16. doi: 10.1083/jcb.200212116.
16.	Dynamic interaction of stargazin-like TARPs with cycling AMPA receptors at synapses.	Tomita S, etal., Science 2004 Mar 5;303(5663):1508-11.

Additional References at PubMed

PMID:18341993	PMID:18753375	PMID:22632720	PMID:27076426

Genomics

Comparative Map Data

Cacng3
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	186,632,334 - 186,728,220 (+)	NCBI		GRCr8
GRCr8 Ensembl	1	186,632,323 - 186,728,214 (+)	Ensembl		GRCr8 Ensembl
mRatBN7.2	1	177,201,361 - 177,297,019 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	177,201,288 - 177,297,024 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	185,530,079 - 185,624,581 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	192,716,035 - 192,810,537 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	185,400,681 - 185,495,253 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	192,613,766 - 192,708,371 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	192,613,372 - 192,709,078 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	199,676,988 - 199,771,889 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	181,498,716 - 181,594,090 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	1	174,909,742 - 175,002,485 (+)	NCBI		Celera
RGSC_v3.1	1	181,638,630 - 181,734,005 (+)	NCBI
Cytogenetic Map	1	q36	NCBI

CACNG3
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	16	24,256,335 - 24,362,412 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	16	24,256,335 - 24,362,412 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	16	24,267,656 - 24,373,733 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	16	24,174,377 - 24,281,238 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	16	24,174,376 - 24,281,238	NCBI
Celera	16	23,044,814 - 23,151,626 (+)	NCBI		Celera
Cytogenetic Map	16	p12.1	NCBI
HuRef	16	22,357,514 - 22,464,192 (+)	NCBI		HuRef
CHM1_1	16	25,279,898 - 25,387,338 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	16	24,532,831 - 24,639,260 (+)	NCBI		T2T-CHM13v2.0

Cacng3
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	7	122,270,967 - 122,368,616 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	7	122,269,715 - 122,368,616 (+)	Ensembl		GRCm39 Ensembl
GRCm38	7	122,671,744 - 122,769,393 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	7	122,670,492 - 122,769,393 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	7	129,815,258 - 129,912,907 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	7	122,462,922 - 122,559,994 (+)	NCBI		MGSCv36	mm8
Celera	7	122,557,841 - 122,658,275 (+)	NCBI		Celera
Cytogenetic Map	7	F2	NCBI
cM Map	7	66.81	NCBI

Cacng3
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955493	2,742,096 - 2,841,403 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955493	2,742,096 - 2,841,353 (+)	NCBI	ChiLan1.0	ChiLan1.0

CACNG3
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	18	25,668,414 - 25,775,243 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	16	30,188,707 - 30,295,523 (+)	NCBI		NHGRI_mPanPan1
PanPan1.1	16	24,501,881 - 24,608,921 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	16	24,501,881 - 24,608,921 (+)	Ensembl	panpan1.1		panPan2

CACNG3
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	6	21,626,977 - 21,712,331 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	6	21,627,547 - 21,711,635 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	6	23,188,831 - 23,274,205 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	6	21,764,445 - 21,849,816 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	6	21,764,445 - 21,849,806 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	6	21,569,695 - 21,655,198 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	6	21,472,243 - 21,557,090 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	6	21,866,262 - 21,951,817 (-)	NCBI		UU_Cfam_GSD_1.0

Cacng3
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409344	120,664,522 - 120,743,045 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936501	8,762,376 - 8,840,915 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936501	8,762,386 - 8,840,123 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CACNG3
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	3	21,855,855 - 21,961,187 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	3	21,855,847 - 21,961,191 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	3	22,759,942 - 22,865,619 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

CACNG3
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	5	21,975,706 - 22,081,428 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	5	21,976,428 - 22,081,547 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666068	7,691,896 - 7,799,654 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Cacng3
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624782	9,319,277 - 9,408,821 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624782	9,319,318 - 9,408,620 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Cacng3
814 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	74
Count of miRNA genes:	60
Interacting mature miRNAs:	63
Transcripts:	ENSRNOT00000016632
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1578778	Pur4	Proteinuria QTL 4	3.3	0.003	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	1	160111531	262090437	Rat
1354646	Kidm18	Kidney mass QTL 18	5.7		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	160573753	266453731	Rat
1354652	Kidm20	Kidney mass QTL 20	4.3		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	186658830	266453731	Rat
2302378	Insul11	Insulin level QTL 11	3.25		blood insulin amount (VT:0001560)	serum insulin level (CMO:0000358)	1	153679879	198679879	Rat
1354653	Despr9	Despair related QTL 9		0.00019	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	1	177339686	222339686	Rat
1578770	Stresp23	Stress response QTL 23			kidney sympathetic nerve activity (VT:0004050)	stimulated renal sympathetic nerve activity to basal renal sympathetic nerve activity ratio (CMO:0001786)	1	132760429	191848948	Rat
2293673	Bss27	Bone structure and strength QTL 27	18.63	0.0001	femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	1	181059071	226059071	Rat
61326	Eae6	Experimental allergic encephalomyelitis QTL 6	5.3		body mass (VT:0001259)	change in body weight (CMO:0002045)	1	182383862	191260518	Rat
2293677	Bss41	Bone structure and strength QTL 41	9.38	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra cross-sectional area (CMO:0001689)	1	181059071	226059071	Rat
70160	Bw18	Body weight QTL 18	5.7		body mass (VT:0001259)	body weight (CMO:0000012)	1	153679879	205813246	Rat
1549830	Bss1	Bone structure and strength QTL 1	4.8		femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	1	182039247	227039247	Rat
8694166	Bw147	Body weight QTL 147	6.83	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	1	153788989	198788989	Rat
70163	Bw20	Body weight QTL 20	5.1		body mass (VT:0001259)	body weight (CMO:0000012)	1	183564652	228564652	Rat
1354624	Cm35	Cardiac mass QTL35	5.7		heart left ventricle mass (VT:0007031)	calculated heart weight (CMO:0000073)	1	186658830	266453731	Rat
1600397	Edcs4	Endometrial carcinoma susceptibility QTL 4	2.2		uterus morphology trait (VT:0001120)	percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759)	1	176288899	270518180	Rat
1354636	Lmblg1	Limb length QTL 1	6.4		tibia length (VT:0004357)	tibia length (CMO:0000450)	1	160573753	210707719	Rat
1549837	Hcar15	Hepatocarcinoma resistance QTL 15		0.05	liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	162548015	270518180	Rat
2293689	Bss47	Bone structure and strength QTL 47	7.25	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra trabecular cross-sectional area (CMO:0001692)	1	181059071	226059071	Rat
152025235	Bw194	Body weight QTL 194	4.86		body mass (VT:0001259)		1	132966869	252856240	Rat
61341	Bp26	Blood pressure QTL 26			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	139442053	223964440	Rat
1598853	Memor3	Memory QTL 3	4.5		exploratory behavior trait (VT:0010471)	total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443)	1	152919152	268496042	Rat
1354634	Kidm12	Kidney mass QTL 12	3.9		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	1	160573753	210707719	Rat
4889428	Stresp24	Stress response QTL 24		0.05	heart pumping trait (VT:2000009)	absolute change in electrocardiographic low frequency R-R spectral component to high frequency R-R spectral component ratio (CMO:0002162)	1	165278545	210278545	Rat
152025232	Bw192	Body weight QTL 192	3.93		body mass (VT:0001259)		1	127329268	206393015	Rat
1578759	Uae30	Urinary albumin excretion QTL 30	3.3	0.003	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	160111531	262090437	Rat
61343	Bp28	Blood pressure QTL 28			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	161077990	206077990	Rat
2293693	Bss22	Bone structure and strength QTL 22	33.52	0.0001	femur morphology trait (VT:0000559)	femur cross-sectional area (CMO:0001661)	1	181059071	226059071	Rat
1358902	Bw47	Body weight QTL 47	1.67		body mass (VT:0001259)	body weight (CMO:0000012)	1	99645382	221502378	Rat
2300161	Bmd43	Bone mineral density QTL 43	8.4	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	1	181059071	226059071	Rat
61347	Bp197	Blood pressure QTL 197	4.2		arterial blood pressure trait (VT:2000000)	blood pressure measurement (CMO:0000003)	1	168063662	213063662	Rat
61348	Bp30	Blood pressure QTL 30	2.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	159894717	207261263	Rat
8655649	Arrd1	Age-related retinal degeneration QTL 1	4.89		retinal layer morphology trait (VT:0003727)	percentage of study population developing retinopathy during a period of time (CMO:0002453)	1	109493780	193400781	Rat
2303622	Vencon6	Ventilatory control QTL 6		0.001	respiration trait (VT:0001943)	respiration rate (CMO:0000289)	1	163992710	208992710	Rat
631214	Bw61	Body weight QTL61	3.4	0.0001	intramuscular adipose amount (VT:0010044)	intramuscular fat area (CMO:0001162)	1	182535316	227535316	Rat
7771612	Cm80	Cardiac mass QTL 80	8.4		heart left ventricle mass (VT:0007031)	heart left ventricle weight (CMO:0000776)	1	146080545	243492863	Rat
731168	Bp154	Blood pressure QTL 154	3.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	103779152	223964440	Rat
631205	Bp196	Blood pressure QTL 196	4	0.0001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	98879955	208479939	Rat
1300158	Bp173	Blood pressure QTL 173	3.48		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	1	155359438	194575574	Rat
2300174	Bmd42	Bone mineral density QTL 42	8.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	bone mineral density (CMO:0001226)	1	181059071	226059071	Rat
737828	Hcas3	Hepatocarcinoma susceptibility QTL 3	4.9		liver integrity trait (VT:0010547)	liver tumorous lesion volume to total liver volume ratio (CMO:0001082)	1	153679879	232414077	Rat
1354661	Bw33	Body weight QTL 33	5.2		body mass (VT:0001259)	body weight (CMO:0000012)	1	160573753	266453731	Rat
1358886	Bp260	Blood pressure QTL 260	3.67		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	160574007	235238518	Rat
1331751	Bp199	Blood pressure QTL 199	3.60022		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	116099376	191260518	Rat
2293654	Bss30	Bone structure and strength QTL 30	32.65	0.0001	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	1	181059071	226059071	Rat
724531	Uae5	Urinary albumin excretion QTL 5	4		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	1	160111426	262090599	Rat
2300187	Bmd41	Bone mineral density QTL 41	8.9	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	1	181059071	226059071	Rat
1641895	Bp298	Blood pressure QTL 298			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	132760429	191848948	Rat
1354580	Scort1	Serum corticosterone level QTL 1	3.4		blood corticosterone amount (VT:0005345)	blood corticosterone level (CMO:0001172)	1	154961463	266453731	Rat
70209	Niddm23	Non-insulin dependent diabetes mellitus QTL 23	2.82		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	162753891	207753891	Rat
1358294	Bw37	Body weight QTL 37	5	0.000011	body mass (VT:0001259)	body weight (CMO:0000012)	1	180739993	225739993	Rat
634314	Niddm44	Non-insulin dependent diabetes mellitus QTL 44			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	51941022	208479811	Rat
2312420	Pur17	Proteinuria QTL 17	7.1	0.0001	urine protein amount (VT:0005160)	urine total protein excretion rate (CMO:0000756)	1	172718770	228180370	Rat
10059600	Bp378	Blood pressure QTL 378	3.08	0.05	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	186298393	231298393	Rat
6893347	Bw98	Body weight QTL 98	0.2	0.53	body mass (VT:0001259)	body weight (CMO:0000012)	1	143092939	188092939	Rat
1354591	Cm36	Cardiac mass QTL 36	4.1		heart left ventricle mass (VT:0007031)	calculated heart weight (CMO:0000073)	1	111949780	210707719	Rat
2312558	Glom17	Glomerulus QTL 17	3.9	0.001	kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	1	175967553	200707874	Rat
10059597	Bp377	Blood pressure QTL 377	3.42	0.025	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	34565911	208798288	Rat
631519	Pia11	Pristane induced arthritis QTL 11	5.3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	1	93903998	191260518	Rat
619614	Bp78	Blood pressure QTL 78		0.001	arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	178547286	206690557	Rat
6893361	Bw104	Body weight QTL 104	0.59	0.27	body mass (VT:0001259)	body weight (CMO:0000012)	1	143092939	188092939	Rat
724562	Rends1	Renal damage susceptibility QTL 1		0.05	kidney glomerulus integrity trait (VT:0010546)	index of glomerular damage (CMO:0001135)	1	139442053	223964440	Rat
2292222	Bp307	Blood pressure QTL 307	3.06	0.0014	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	186298393	231298393	Rat
2292220	Bp306	Blood pressure QTL 306	3.47	0.00087	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	186298393	231298393	Rat
1558645	Bw55	Body weight QTL 55	3.2	0.004	body mass (VT:0001259)	body weight (CMO:0000012)	1	143092939	188092939	Rat
1354615	Cm32	Cardiac mass QTL 32	5.2		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	1	111949780	210707719	Rat
1600380	Niddm70	Non-insulin dependent diabetes mellitus QTL 70	3.1	0.0008	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	1	185979875	230979875	Rat
1354610	Bw34	Body weight QTL 34	4.1		body mass (VT:0001259)	body weight (CMO:0000012)	1	160573753	266453731	Rat
1354620	Kidm19	Kidney mass QTL 19	4		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	160573753	210707719	Rat
1576310	Schws2	Schwannoma susceptibility QTL 2		0.029	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	1	153788989	198788989	Rat
1354618	Kidm15	Kidney mass QTL 15	5		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	1	165707719	210707719	Rat
6903303	Scl34	Serum cholesterol QTL 34	2.5	0.0033	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	1	173363824	227535316	Rat
631544	Bp84	Blood pressure QTL 84	5.6		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	132760429	191190115	Rat
152025212	Bw190	Body weight QTL 190	5.7		body mass (VT:0001259)		1	132966869	206393015	Rat
1358189	Cstrr1	Cold stress response QTL 1		0.0001	catecholamine amount (VT:0010543)	urine norepinephrine level (CMO:0001629)	1	132760429	191848948	Rat
1354606	Bp246	Blood pressure QTL 246	3.6		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	1	111949780	228180370	Rat
738032	Hcas5	Hepatocarcinoma susceptibility QTL 5	3.12		liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	185857683	270518180	Rat
7411599	Foco11	Food consumption QTL 11	18.5	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	1	153788989	198788989	Rat
1354602	Bw35	Body weight QTL 35	12.2		body mass (VT:0001259)	body weight (CMO:0000012)	1	160573753	210707719	Rat
631670	Iddm10	Insulin dependent diabetes mellitus QTL 10	1.9		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	1	183564652	205813246	Rat

Markers in Region

D1Rat155

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	1	186,658,830 - 186,658,977 (+)	Marker Load Pipeline
mRatBN7.2	1	177,227,632 - 177,227,779 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	192,639,698 - 192,639,842	NCBI	Rnor6.0
Rnor_5.0	1	199,702,920 - 199,703,064	UniSTS	Rnor5.0
RGSC_v3.4	1	181,524,850 - 181,524,994	UniSTS	RGSC3.4
RGSC_v3.4	1	181,524,849 - 181,524,994	RGD	RGSC3.4
Celera	1	174,935,384 - 174,935,528	UniSTS
RGSC_v3.1	1	181,664,764 - 181,664,909	RGD
SHRSP x BN Map	1	89.1199	RGD
SHRSP x BN Map	1	89.1199	UniSTS
FHH x ACI Map	1	86.55	RGD
Cytogenetic Map	1	q36	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
7	4	22	113	49	48	17	25	17	6	108	64	2	93	16	45	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_080691	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063270769	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF361340	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473956	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000016632 ⟹ ENSRNOP00000016632

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	1	186,632,323 - 186,728,214 (+)	Ensembl
mRatBN7.2 Ensembl	1	177,201,288 - 177,297,024 (+)	Ensembl
Rnor_6.0 Ensembl	1	192,613,372 - 192,709,078 (+)	Ensembl

RefSeq Acc Id:

NM_080691 ⟹ NP_542422

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	186,632,562 - 186,728,212 (+)	NCBI
mRatBN7.2	1	177,201,361 - 177,297,019 (+)	NCBI
Rnor_6.0	1	192,613,766 - 192,708,371 (+)	NCBI
Rnor_5.0	1	199,676,988 - 199,771,889 (+)	NCBI
RGSC_v3.4	1	181,498,716 - 181,594,090 (+)	RGD
Celera	1	174,909,742 - 175,002,485 (+)	RGD

Sequence:

show sequence

ATGAGGATGTGTGACAGAGGTATCCAGATGTTGATCACCACTGTAGGAGCCTTCGCAGCTTTCA
GTTTAATGACCATTGCGGTGGGCACGGACTACTGGCTATATTCCAGAGGTGTGTGCAGGACTAA
ATCTACAAGTGACAATGAAACCAGCAGGAAAAATGAAGAAGTAATGACCCACTCCGGGTTGTGG
AGGACCTGCTGCTTAGAAGGAGCTTTCCGAGGCGTGTGCAAGAAAATCGATCACTTCCCAGAAG
ATGCAGACTATGAACAGGATACAGCAGAATATCTTCTCCGGGCTGTGAGGGCCTCCAGTGTCTT
CCCCATCCTCAGCGTCACTCTGCTGTTTTTCGGGGGACTCTGTGTAGCTGCCAGCGAGTTCCAC
CGCAGTAGGCACAGTGTTATCCTCAGCGCCGGCATCTTCTTCGTCTCTGCAGGGCTAAGCAACA
TCATCGGCATCATAGTTTATATCTCAGCCAATGCTGGAGACCCTGGGCAGAGGGACTCTAAAAA
GAGCTACTCCTACGGCTGGTCCTTTTATTTTGGAGCCTTCTCTTTCATCATCGCGGAAATTGTG
GGTGTGGTCGCCGTGCACATCTATATTGAGAAGCATCAGCAGCTGCGCGCCAGATCCCATTCAG
AGCTCCTGAAGAAGTCTACATTTGCGCGCCTACCGCCCTACAGGTATAGATTCCGAAGACGGTC
AAGTTCTCGCTCCACTGAACCTAGATCCCGAGACCTGTCTCCCATCAGCAAAGGCTTCCACACC
ATCCCTTCCACTGACATCTCCATGTTCACCCTGTCCCGGGACCCCTCTAAGCTTACCATGGGGA
CCCTTCTCAACTCTGACCGGGACCATGCTTTTCTACAGTTCCACAACTCCACACCCAAAGAGTT
CAAAGAGTCGTTGCATAACAATCCGGCCAACAGACGCACCACGCCCGTCTGA

hide sequence

RefSeq Acc Id:

XM_063270769 ⟹ XP_063126839

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	186,632,334 - 186,728,220 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_542422	(Get FASTA)	NCBI Sequence Viewer
	XP_063126839	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAL50035	(Get FASTA)	NCBI Sequence Viewer
	EDM17553	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000016632
	ENSRNOP00000016632.1
GenBank Protein	Q8VHX0	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_542422 ⟸ NM_080691

- UniProtKB:

Q8VHX0 (UniProtKB/Swiss-Prot), A6I8X7 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MRMCDRGIQMLITTVGAFAAFSLMTIAVGTDYWLYSRGVCRTKSTSDNETSRKNEEVMTHSGLW
RTCCLEGAFRGVCKKIDHFPEDADYEQDTAEYLLRAVRASSVFPILSVTLLFFGGLCVAASEFH
RSRHSVILSAGIFFVSAGLSNIIGIIVYISANAGDPGQRDSKKSYSYGWSFYFGAFSFIIAEIV
GVVAVHIYIEKHQQLRARSHSELLKKSTFARLPPYRYRFRRRSSSRSTEPRSRDLSPISKGFHT
IPSTDISMFTLSRDPSKLTMGTLLNSDRDHAFLQFHNSTPKEFKESLHNNPANRRTTPV

hide sequence

Ensembl Acc Id:

ENSRNOP00000016632 ⟸ ENSRNOT00000016632

RefSeq Acc Id:	XP_063126839 ⟸ XM_063270769
- Peptide Label:	isoform X1

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q8VHX0-F1-model_v2	AlphaFold	Q8VHX0	1-315	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:628803	AgrOrtholog
BioCyc Gene	G2FUF-57540	BioCyc
Ensembl Genes	ENSRNOG00000012362	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000016632	ENTREZGENE
	ENSRNOT00000016632.4	UniProtKB/Swiss-Prot
Gene3D-CATH	1.20.140.150	UniProtKB/Swiss-Prot
InterPro	CACNG_subunit	UniProtKB/Swiss-Prot
	PMP22/EMP/MP20/Claudin	UniProtKB/Swiss-Prot
	VDCC_gsu	UniProtKB/Swiss-Prot
KEGG Report	rno:140724	UniProtKB/Swiss-Prot
NCBI Gene	140724	ENTREZGENE
PANTHER	VOLTAGE-DEPENDENT CALCIUM CHANNEL GAMMA SUBUNIT	UniProtKB/Swiss-Prot
	VOLTAGE-DEPENDENT CALCIUM CHANNEL GAMMA-3 SUBUNIT	UniProtKB/Swiss-Prot
Pfam	PMP22_Claudin	UniProtKB/Swiss-Prot
PhenoGen	Cacng3	PhenoGen
PRINTS	VDCCGAMMA	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000012362	RatGTEx
UniProt	A6I8X7	ENTREZGENE, UniProtKB/TrEMBL
	CCG3_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-02-11	Cacng3	calcium voltage-gated channel auxiliary subunit gamma 3	Cacng3	calcium channel, voltage-dependent, gamma subunit 3	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-09-10	Cacng3	calcium channel, voltage-dependent, gamma subunit 3		voltage-dependent calcium channel gamma-3 subunit	Name updated	1299863	APPROVED
2003-02-27	Cacng3	voltage-dependent calcium channel gamma-3 subunit			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_disease	human homolog may be associated with a subsed of childhood absence epilepsy (CAE), a type of idiopathic generalised epilepsy (IGE)	728397

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Annotations - KEGG (archival)