Zp4 (zona pellucida glycoprotein 4)

Advanced Search (OLGA)

Gene: Zp4 (zona pellucida glycoprotein 4) Rattus norvegicus

Analyze

Symbol:

Zp4

Name:

zona pellucida glycoprotein 4

RGD ID:

628708

Description:

Predicted to enable acrosin binding activity and identical protein binding activity. Predicted to be a structural constituent of egg coat. Predicted to be involved in several processes, including acrosomal vesicle exocytosis; binding activity of sperm to zona pellucida; and negative regulation of binding activity of sperm to zona pellucida. Predicted to be located in extracellular region and plasma membrane. Predicted to be active in collagen-containing extracellular matrix and egg coat. Orthologous to human ZP4 (zona pellucida glycoprotein 4); INTERACTS WITH acrylamide; ammonium chloride; bisphenol A.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

zona pellucida 4; zona pellucida B glycoprotein; zona pellucida protein B; zona pellucida sperm-binding protein 4; Zp-4

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	ZP4 (zona pellucida glycoprotein 4)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Chinchilla lanigera (long-tailed chinchilla):	Zp4 (zona pellucida glycoprotein 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	ZP4 (zona pellucida glycoprotein 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	ZP4 (zona pellucida glycoprotein 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Zp4 (zona pellucida glycoprotein 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	ZP4 (zona pellucida glycoprotein 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	ZP4 (zona pellucida glycoprotein 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Zp4 (zona pellucida glycoprotein 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	ZP4 (zona pellucida glycoprotein 4)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	zp2l1 (zona pellucida glycoprotein 2, like 1)	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	si:zfos-1505d6.3	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	zp2.6 (zona pellucida glycoprotein 2, tandem duplicate 6)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	zp2l2 (zona pellucida glycoprotein 2, like 2)	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Danio rerio (zebrafish):	zp2.3 (zona pellucida glycoprotein 2, tandem duplicate 3)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	zp2.1 (zona pellucida glycoprotein 2, tandem duplicate 1)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	zp2.5 (zona pellucida glycoprotein 2, tandem duplicate 5)	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Danio rerio (zebrafish):	zp2.2 (zona pellucida glycoprotein 2, tandem duplicate 2)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	zp4	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	zp4.2	Alliance	DIOPT (OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Is Marker For:

QTLs: Bp369

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	17	63,697,147 - 63,703,700 (-)	NCBI		GRCr8
mRatBN7.2	17	59,005,649 - 59,012,202 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	17	59,005,649 - 59,012,202 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	17	62,200,994 - 62,207,550 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	17	66,204,050 - 66,210,606 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	17	60,358,390 - 60,364,946 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	17	65,497,359 - 65,503,912 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	17	65,497,359 - 65,503,912 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	17	67,248,685 - 67,255,238 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	17	69,576,957 - 69,583,510 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	17	69,587,789 - 69,594,343 (-)	NCBI
Celera	17	61,538,443 - 61,544,996 (+)	NCBI		Celera
Cytogenetic Map	17	q12.1	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

gastrointestinal stromal tumor (ISO)

Hereditary Leiomyomatosis and Renal Cell Cancer (ISO)

parathyroid carcinoma (ISO)

prostate cancer (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

acrylamide (EXP)

aflatoxin B1 (ISO)

ammonium chloride (EXP)

benzo[a]pyrene (ISO)

bisphenol A (EXP)

CGP 52608 (ISO)

paracetamol (ISO)

resveratrol (ISO)

sodium arsenite (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

acrosomal vesicle exocytosis (IEA,ISO)

binding of sperm to zona pellucida (IBA)

biological_process (ND)

negative regulation of binding of sperm to zona pellucida (IEA,ISO)

positive regulation of acrosome reaction (IEA,ISO)

positive regulation of humoral immune response (IEA,ISO)

positive regulation of T cell proliferation (IEA,ISO)

prevention of polyspermy (IBA)

Cellular Component

collagen-containing extracellular matrix (IBA)

egg coat (IBA,IEA,ISO,ISS)

extracellular region (IEA)

plasma membrane (IEA)

Molecular Function

acrosin binding (IBA,IEA,ISO)

identical protein binding (IEA,ISO)

protein binding (ISO)

structural constituent of egg coat (IBA,ISS)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	GOA pipeline	RGD automated data pipeline
3.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
5.	Comprehensive gene review and curation	RGD comprehensive gene curation
6.	Information Derived from GenBank Report	RGD, Sept. 2003

Additional References at PubMed

PMID:15950651	PMID:18667750	PMID:19004505	PMID:20394732	PMID:26879157	PMID:29895852	PMID:33624742	PMID:33709118

Genomics

Comparative Map Data

Zp4
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	17	63,697,147 - 63,703,700 (-)	NCBI		GRCr8
mRatBN7.2	17	59,005,649 - 59,012,202 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	17	59,005,649 - 59,012,202 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	17	62,200,994 - 62,207,550 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	17	66,204,050 - 66,210,606 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	17	60,358,390 - 60,364,946 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	17	65,497,359 - 65,503,912 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	17	65,497,359 - 65,503,912 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	17	67,248,685 - 67,255,238 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	17	69,576,957 - 69,583,510 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	17	69,587,789 - 69,594,343 (-)	NCBI
Celera	17	61,538,443 - 61,544,996 (+)	NCBI		Celera
Cytogenetic Map	17	q12.1	NCBI

ZP4
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	237,882,404 - 237,890,922 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	237,877,864 - 237,890,922 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	1	238,045,704 - 238,054,222 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	236,112,333 - 236,120,558 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	1	234,371,750 - 234,379,976	NCBI
Celera	1	211,290,655 - 211,303,716 (-)	NCBI		Celera
Cytogenetic Map	1	q43	NCBI
HuRef	1	208,497,545 - 208,510,618 (-)	NCBI		HuRef
CHM1_1	1	239,313,463 - 239,326,514 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	1	237,293,715 - 237,302,152 (-)	NCBI		T2T-CHM13v2.0

Zp4
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955492	2,599,579 - 2,606,837 (+)	NCBI	ChiLan1.0	ChiLan1.0

ZP4
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	11,270,421 - 11,278,931 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	11,487,205 - 11,495,738 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	213,435,888 - 213,444,439 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	218,433,473 - 218,442,383 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	218,428,967 - 218,442,383 (-)	Ensembl	panpan1.1		panPan2

ZP4
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	4	2,324,657 - 2,332,357 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	4	2,324,226 - 2,331,470 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	4	2,372,257 - 2,380,393 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	4	2,343,415 - 2,351,490 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	4	2,343,307 - 2,350,533 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	4	2,339,106 - 2,347,238 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	4	2,475,022 - 2,483,157 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	4	2,696,097 - 2,704,236 (+)	NCBI		UU_Cfam_GSD_1.0

Zp4
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409344	39,205,217 - 39,211,353 (+)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936484	15,370,443 - 15,376,564 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

ZP4
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	14	53,577,135 - 53,584,546 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	14	53,577,138 - 53,584,544 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	14	57,496,103 - 57,503,521 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

ZP4
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	25	75,002,053 - 75,010,764 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	25	75,002,344 - 75,010,323 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666055	77,101,795 - 77,109,779 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Zp4
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624775	12,902,697 - 12,910,149 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624775	12,903,145 - 12,910,048 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Zp4
21 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	101
Count of miRNA genes:	90
Interacting mature miRNAs:	92
Transcripts:	ENSRNOT00000038938
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1354640	Scl32	Serum cholesterol level QTL 32	5.4		blood HDL cholesterol amount (VT:0000184)	blood high density lipoprotein cholesterol level (CMO:0000052)	17	15781592	60781592	Rat
7411575	Bw140	Body weight QTL 140	30.2	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	17	48560935	86533673	Rat
1354654	Spl7	Serum phospholipid level QTL 7	5.5		blood phospholipid amount (VT:0006084)	blood phospholipid level (CMO:0001169)	17	50890908	60781592	Rat
1598871	Memor5	Memory QTL 5	5.3		exploratory behavior trait (VT:0010471)	total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443)	17	40540041	80387013	Rat
1354651	Lmblg2	Limb length QTL 2	6		tibia length (VT:0004357)	tibia length (CMO:0000450)	17	4299130	69599340	Rat
1354628	Stl13	Serum triglyceride level QTL 13	3.8		blood triglyceride amount (VT:0002644)	blood triglyceride level (CMO:0000118)	17	21293039	60781592	Rat
1354629	Scl31	Serum cholesterol level QTL 31	4.1		blood cholesterol amount (VT:0000180)	blood total cholesterol level (CMO:0000051)	17	50890908	60781592	Rat
1354630	Cm34	Cardiac mass QTL 34	8.7		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	17	4299130	69599340	Rat
1600398	Edcs5	Endometrial carcinoma susceptibility QTL 5	2.2		uterus morphology trait (VT:0001120)	percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759)	17	57246723	70852846	Rat
1559055	Bp278	Blood pressure QTL 278		0.04	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	23653184	68653184	Rat
61466	Niddm12	Non-insulin dependent diabetes mellitus QTL 12	3.2	0.001	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	17	54029929	60463637	Rat
1354638	Insul1	Insulin level QTL 1	4.8		blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	17	4299130	69599340	Rat
1354635	Bp245	Blood pressure QTL 245	6		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	42073160	69599340	Rat
8694181	Bw151	Body weight QTL 151	4.36	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	17	48560935	86533673	Rat
1300148	Bp192	Blood pressure QTL 192	3.47		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	17	34550843	73951021	Rat
2317060	Aia26	Adjuvant induced arthritis QTL 26	3.22		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	17	38281509	83281509	Rat
4889955	Bss93	Bone structure and strength QTL 93	4.4		tibia size trait (VT:0100001)	tibia cortical bone volume to tibia total bone volume ratio (CMO:0001727)	17	27027949	60463643	Rat
2324621	Coatc5	Coat color QTL 5			coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	17	31368391	73951021	Rat
7488963	Bp369	Blood pressure QTL 369		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	59005649	77910000	Rat
1354662	Rf49	Renal function QTL 49	2.9		blood creatinine amount (VT:0005328)	plasma creatinine level (CMO:0000537)	17	1	69599340	Rat
1354663	Bvd5	Brain ventricular dilatation QTL 5	3.51	0.001	brain ventricle morphology trait (VT:0000822)	hydrocephalus severity score (CMO:0001881)	17	31990784	81292925	Rat
1354658	Spl8	Serum phospholipid level QTL 8	3.8		blood VLDL phospholipid amount (VT:0010507)	blood very low density lipoprotein phospholipid level (CMO:0001571)	17	1	60781592	Rat
1354659	Scl68	Serum cholesterol level QTL 68	3.9		blood VLDL cholesterol amount (VT:0005144)	blood very low density lipoprotein cholesterol level (CMO:0000648)	17	15781592	60781592	Rat
724528	Uae4	Urinary albumin excretion QTL 4	4.9	0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	17	35837085	69599340	Rat
2302365	Gluco40	Glucose level QTL 40	4.79		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	17	57246843	82046127	Rat
631497	Bp98	Blood pressure QTL 98	3.66		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	17	41354651	60463643	Rat
1354581	Bp247	Blood pressure QTL 247	4.5		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	17	1	69599340	Rat
70210	Cm15	Cardiac mass QTL 15	6.5		heart right ventricle mass (VT:0007033)	heart right ventricle wet weight (CMO:0000072)	17	57246723	70156904	Rat
1358295	Aocep1	Aortic cell protein QTL 1	6.1	7e-07	thoracic aorta cellular protein amount (VT:0010598)	aortic cell percentage	17	40990005	85990005	Rat
2301412	Kidm40	Kidney mass QTL 40		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	17	37479847	82479847	Rat
1354588	Bvd4	Brain ventricular dilatation QTL 4	5.31	0.001	brain ventricle morphology trait (VT:0000822)	hydrocephalus severity score (CMO:0001881)	17	53498828	82479847	Rat
9590107	Sffal7	Serum free fatty acids level QTL 7	4.81	0.001	blood free fatty acid amount (VT:0001553)	plasma free fatty acids level (CMO:0000546)	17	28409147	73409147	Rat
2317038	Ginf3	Gastrointestinal inflammation QTL 3	2.89	0.005	liver integrity trait (VT:0010547)	liver granuloma severity score (CMO:0002157)	17	49920154	86533673	Rat
724549	Niddm56	Non-insulin dependent diabetes mellitus QTL 56		0.03	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	17	31990784	76990784	Rat
61394	Bp8	Blood pressure QTL 8	2.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	17	23080567	59555013	Rat
10450503	Bp386	Blood pressure QTL 386		0.28	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	31368391	62109574	Rat
2317054	Aia12	Adjuvant induced arthritis QTL 12	4.24		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	17	38281509	83281509	Rat
2317053	Aia25	Adjuvant induced arthritis QTL 25	2.69		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	17	50909196	60781426	Rat
8552928	Pigfal9	Plasma insulin-like growth factor 1 level QTL 9	9		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	17	28409147	73409147	Rat
7394837	Memor18	Memory QTL 18			exploratory behavior trait (VT:0010471)	measurement of voluntary locomotion into, out of or within a discrete space in an experimental apparatus (CMO:0000957)	17	18640182	63640182	Rat
12903980	Cm120	Cardiac mass QTL 120		0.002	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	17	23653184	68653184	Rat
12903981	Am17	Aortic mass QTL 17		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	17	23653184	68653184	Rat
12903982	Kidm70	Kidney mass QTL 70		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	17	23653184	70974005	Rat
4889894	Eae33	Experimental allergic encephalomyelitis QTL 33	5.2	0.0001	nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis severity score (CMO:0001419)	17	50909099	86022412	Rat
12903978	Cm118	Cardiac mass QTL 118		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	17	23653184	68653184	Rat
1354619	Bp242	Blood pressure QTL 242	6.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	17	24599340	69599340	Rat
12903979	Cm119	Cardiac mass QTL 119		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	17	23653184	68653184	Rat
1354596	Bw32	Body weight QTL 32	4.5		body mass (VT:0001259)	body weight (CMO:0000012)	17	4299130	60781592	Rat
2303580	Gluco49	Glucose level QTL 49	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	17	50040271	86533673	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
11	14	9	6	3	1	3	56	13	13	40	44	3

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_172330	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF456325	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474071	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000017	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000038938 ⟹ ENSRNOP00000031597

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	17	59,005,649 - 59,012,202 (-)	Ensembl
Rnor_6.0 Ensembl	17	65,497,359 - 65,503,912 (+)	Ensembl

RefSeq Acc Id:

NM_172330 ⟹ NP_758833

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	17	63,697,147 - 63,703,700 (-)	NCBI
mRatBN7.2	17	59,005,649 - 59,012,202 (-)	NCBI
Rnor_6.0	17	65,497,359 - 65,503,912 (+)	NCBI
Rnor_5.0	17	67,248,685 - 67,255,238 (+)	NCBI
RGSC_v3.4	17	69,576,957 - 69,583,510 (-)	RGD
Celera	17	61,538,443 - 61,544,996 (+)	RGD

Sequence:

show sequence

GATGTGGGTTAGTGAAGGAGAAAGGATGGCTAGGCAGGCTCTAAGGAGCACTCTGTGGCTTCTA
CCAAGCATCTTACTGTGTTTCCCATTCTGTCTTCCTTTGAGTGGCCAGCATGTTACCGAGTTGC
CAGGTGTGCTCCACTGTGGGTTACAGAGCTTCCAGTTTGCTGTGAACCTCAGCCTGGAGGCAGA
GAGTCCTGTGCTAACAACTTGGGATAGCCAAGGGCTGCCACACAGGCTTAAGAATGACTCTGAC
TGTGGTACATGGGTGATGGACAGTCCTGATGGCTTTCTGGTCTTGGAAGCCAGCTACAGTGGCT
GCTATGTCACTCTGGAGGGATCCCACTACATCATGACCGTTGGTGTGCAAGAGGCAGATGTAGC
TGGACATGTAGCAGGAACAAGACAAAGACTGCTTACGTGCCCTTTGGCTCTTCAGGGTAAAGCC
CCAGATACACCAAGTGCTAAAGTGTGCAGTCCTGTGCCAGTAAAGGAAAGGCTGCCCTGTGCTT
CCTCGACCATCTCCAGAGGAGACTGTGAAGAGTTGGGGTGCTGCTACAGCTCTGAAGAGGAAGG
GGCAGACTCCTGTTACTATGGAAACACAGTGACCTCCCATTGCACCAAGGAGGGCCACTTTTCC
ATTGCTGTGTCCAGGGACGTGACCTCGCCCCCTCTGCGCTTGGATTCACTTCGCTTAGGCTTCA
GGAACATCACCACAGGGTGTGATCCTGTGATGAAAACATCCACCTTTGTCCTGTTCCAATTTCC
ACTTACTTCCTGTGGGACTACACAGCGGATCACTGGAGACCAGGCCATGTATGAAAATGAGCTA
GTGGCCATTCGGGATGTACAAGCATGGGGCAGAAGCTCTATTACTAGAGACAGCAACTTCAGGC
TCCGAGTCAGCTGCACGTACTCCATTCACAGCATCATGTCCCCAGTTAACATGCAAGTGTGGAC
TCTCCCACCACCCCTTCCTAAGACCCAGCCCGGACCCCTCTCTCTGGAACTTCAGATTGCCCAG
GATAAAAACTACAGCTCTTACTACGGTACTGATGCCTACCCACTGGTAAAATTCCTCCAGGATC
CCATTTACGTGGAGGTCTCCATCCTTCATAGAACAGACCCCTCGTTGAGCCTGCTGCTAGAGCA
ATGTTGGGCTACACCTGGCTCTAATCCTTTTCATCAACCACAATGGCCAATCCTAGTGAAGGGA
TGCCCATATGCTGGAGACAATTATCAGACCAAAAGGATCCCGGTTCAGAAAGCATCAGATGTCT
TTCCATCTCATCATCAGCGCTTCAGTATCTCTACCTTCAGCTTCATGAGTGCTGGAAGGGAGAA
GCAGGTTTTGGGTGGACAGGTATACCTGCACTGCAGTGCATCGGTCTGCCAGCCTGCTGGGATG
CCATCCTGCACGGTTATCTGTCCTGCTTCCAGGAGAAGAAGAAAATCTGAGCTTTATTTTGATA
ACTCCACCAGCATATCTAGCAAAGGTCCCGTGATCCTCCTCCAAGCCACTAAGGACCCTGCAGT
CATGCTTCATAAACACTCAGGCACCCATGCAGATTCTCCCACTCTGTGGGTAATGGGACTTTCT
GCAAGCATGGTCATCACTGGAGTCTTGGTAGTATCCTACTTGGCCACCAGGAAACAGAGATGAA
TAGCCCAAGCCAAGAGTCTCAATAAAACTGACTATACTACCAGC

hide sequence

Protein Sequences


Protein RefSeqs	NP_758833	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAN76981	(Get FASTA)	NCBI Sequence Viewer
	EDM06978	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000031597.3
GenBank Protein	Q8CH34	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_758833 ⟸ NM_172330
- Peptide Label:	precursor
- UniProtKB:	Q8CH34 (UniProtKB/Swiss-Prot), F1LP51 (UniProtKB/TrEMBL)
- Sequence:	show sequence MARQALRSTLWLLPSILLCFPFCLPLSGQHVTELPGVLHCGLQSFQFAVNLSLEAESPVLTTWD SQGLPHRLKNDSDCGTWVMDSPDGFLVLEASYSGCYVTLEGSHYIMTVGVQEADVAGHVAGTRQ RLLTCPLALQGKAPDTPSAKVCSPVPVKERLPCASSTISRGDCEELGCCYSSEEEGADSCYYGN TVTSHCTKEGHFSIAVSRDVTSPPLRLDSLRLGFRNITTGCDPVMKTSTFVLFQFPLTSCGTTQ RITGDQAMYENELVAIRDVQAWGRSSITRDSNFRLRVSCTYSIHSIMSPVNMQVWTLPPPLPKT QPGPLSLELQIAQDKNYSSYYGTDAYPLVKFLQDPIYVEVSILHRTDPSLSLLLEQCWATPGSN PFHQPQWPILVKGCPYAGDNYQTKRIPVQKASDVFPSHHQRFSISTFSFMSAGREKQVLGGQVY LHCSASVCQPAGMPSCTVICPASRRRRKSELYFDNSTSISSKGPVILLQATKDPAVMLHKHSGT HADSPTLWVMGLSASMVITGVLVVSYLATRKQR hide sequence

Ensembl Acc Id:

ENSRNOP00000031597 ⟸ ENSRNOT00000038938

Protein Domains

P-type ZP

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q8CH34-F1-model_v2	AlphaFold	Q8CH34	1-545	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:628708	AgrOrtholog
BioCyc Gene	G2FUF-8927	BioCyc
Ensembl Genes	ENSRNOG00000027506	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000038938.4	UniProtKB/TrEMBL
Gene3D-CATH	2.60.40.4100	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	4.10.110.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Zona pellucida, ZP-N domain	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	P_trefoil_CS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	P_trefoil_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	P_trefoil_dom_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Zona_Pellucida_Domain_gp	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ZP-C	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ZP_chr	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ZP_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ZP_dom_CS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:282833	UniProtKB/TrEMBL
NCBI Gene	282833	ENTREZGENE
PANTHER	ZONA PELLUCIDA SPERM-BINDING PROTEIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ZONA PELLUCIDA SPERM-BINDING PROTEIN 4	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Trefoil	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Zona_pellucida	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Zp4	PhenoGen
PRINTS	ZPELLUCIDA	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	P_TREFOIL_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	P_TREFOIL_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ZP_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ZP_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000027506	RatGTEx
SMART	SM00018	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SM00241	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF57492	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A6KN27_RAT	UniProtKB/TrEMBL
	F1LP51	ENTREZGENE, UniProtKB/TrEMBL
	Q8CH34	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2004-09-10	Zp4	zona pellucida glycoprotein 4		zona pellucida 4	Name updated	1299863	APPROVED
2003-02-27	Zp4	zona pellucida 4			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar