Advanced Search (OLGA)

Gene: Gabarap (gamma-aminobutyric acid receptor associated protein) Mus musculus

Analyze

Symbol:

Gabarap

Name:

gamma-aminobutyric acid receptor associated protein

RGD ID:

62204

MGI Page

MGI

Description:

Enables microtubule binding activity. Involved in regulation of neurotransmitter receptor localization to postsynaptic specialization membrane. Acts upstream of or within microtubule cytoskeleton organization. Located in several cellular components, including cytoskeleton; smooth endoplasmic reticulum; and sperm midpiece. Part of microtubule associated complex. Is active in GABA-ergic synapse. Is expressed in retina inner plexiform layer and spinal cord. Orthologous to human GABARAP (GABA type A receptor-associated protein).

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

GABA(A) receptor-associated protein; GABA-A receptor-associated protein; gamma-aminobutyric acid receptor-associated protein; gamma-aminobutyric acid reseptor associated protein

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	GABARAP (GABA type A receptor-associated protein)	HGNC	EggNOG, Ensembl, HGNC, HomoloGene, NCBI, OMA, OrthoDB, OrthoMCL, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):	Gabarap (GABA type A receptor-associated protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Gabarap (GABA type A receptor-associated protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	GABARAP (GABA type A receptor-associated protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	GABARAP (GABA type A receptor-associated protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Gabarap (GABA type A receptor-associated protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	GABARAP (GABA type A receptor-associated protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	GABARAP (GABA type A receptor-associated protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Gabarap (GABA type A receptor-associated protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Rattus norvegicus (Norway rat):	Gabarap (GABA type A receptor-associated protein)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	GABARAP (GABA type A receptor-associated protein)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	gabarapb (GABA(A) receptor-associated protein b)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid\|ZFIN)
Danio rerio (zebrafish):	gabarapa (GABA(A) receptor-associated protein a)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB\|ZFIN)
Drosophila melanogaster (fruit fly):	Atg8a	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	ATG8	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	lgg-1	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCm39 - Mouse Genome Assembly GRCm39

Position:

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	11	69,882,196 - 69,885,775 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	11	69,881,969 - 69,885,777 (+)	Ensembl		GRCm39 Ensembl
GRCm38	11	69,991,370 - 69,994,949 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	11	69,991,143 - 69,994,951 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	11	69,804,872 - 69,808,451 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	11	69,807,565 - 69,811,141 (+)	NCBI		MGSCv36	mm8
Celera	11	77,539,180 - 77,542,759 (+)	NCBI		Celera
Cytogenetic Map	11	B3	NCBI
cM Map	11	42.95	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

common variable immunodeficiency (ISO)

congenital myasthenic syndrome 2A (ISO)

dyskeratosis congenita (ISO)

Faundes-Banka Syndrome (ISO)

intellectual disability (ISO)

Li-Fraumeni syndrome (ISO)

very long chain acyl-CoA dehydrogenase deficiency (ISO)

Weissenbacher-Zweymuller syndrome (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-alpha-phellandrene (ISO)

1,2-dimethylhydrazine (EXP)

17beta-estradiol (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4,6-trinitrotoluene (ISO)

2-hydroxypropanoic acid (ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

3-methyladenine (EXP)

4,4'-sulfonyldiphenol (EXP,ISO)

4-nitrophenol (EXP)

acetylsalicylic acid (ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

alpha-phellandrene (ISO)

ammonium chloride (ISO)

arsenite(3-) (EXP,ISO)

atrazine (ISO)

benzo[a]pyrene (ISO)

bisphenol A (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

captan (EXP)

chlormequat chloride (ISO)

chlorpyrifos (EXP)

clofibrate (EXP)

copper(II) chloride (ISO)

dexamethasone (ISO)

Dibutyl phosphate (ISO)

dibutyl phthalate (ISO)

dicyclanil (EXP)

doxorubicin (ISO)

Erionite (EXP)

ethanol (EXP)

ethyl methanesulfonate (ISO)

fenthion (EXP)

fenvalerate (ISO)

folic acid (EXP)

folpet (EXP)

formaldehyde (ISO)

gentamycin (ISO)

hydralazine (ISO)

indometacin (ISO)

L-ascorbic acid (EXP)

methidathion (EXP)

methyl methanesulfonate (ISO)

rac-lactic acid (ISO)

raloxifene (ISO)

resveratrol (ISO)

sarin (ISO)

sirolimus (EXP)

sodium arsenite (EXP)

sodium dichromate (EXP)

Soman (ISO)

stigmasterol (EXP)

testosterone (ISO)

tetrachloromethane (EXP)

titanium dioxide (EXP)

toluene (ISO)

triadimefon (ISO)

triphenyl phosphate (ISO)

triptonide (EXP)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

autophagosome assembly (IBA)

autophagosome maturation (IBA)

autophagy (IEA)

cellular response to nitrogen starvation (IBA)

extrinsic apoptotic signaling pathway via death domain receptors (ISO,ISS)

microtubule cytoskeleton organization (IDA)

mitophagy (IBA)

positive regulation of proteasomal ubiquitin-dependent protein catabolic process (ISO,ISS)

positive regulation of protein K48-linked ubiquitination (ISO,ISS)

protein transport (IEA)

regulation of neurotransmitter receptor localization to postsynaptic specialization membrane (EXP,IDA,IMP)

regulation of Rac protein signal transduction (ISO,ISS)

Cellular Component

actin cytoskeleton (IDA)

autophagosome (ISO,ISS)

autophagosome membrane (IBA,IEA,ISO)

axoneme (IDA)

cell body (ISO)

cytoplasmic vesicle (IEA)

GABA-ergic synapse (EXP,IDA,IMP)

Golgi apparatus (IDA)

Golgi membrane (IEA)

intracellular membrane-bounded organelle (ISO)

lysosome (IDA)

microtubule (IEA)

microtubule associated complex (IDA)

perinuclear region of cytoplasm (ISO)

plasma membrane (IDA)

postsynaptic specialization, intracellular component (ISO)

smooth endoplasmic reticulum (IDA)

sperm midpiece (IDA)

Molecular Function

beta-tubulin binding (IEA,ISO)

GABA receptor binding (IBA,IEA,ISO)

microtubule binding (IDA)

phosphatidylethanolamine binding (IBA,IEA,ISO)

protein binding (IPI,ISO)

ubiquitin protein ligase binding (IBA,IEA,ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

autophagy pathway (IEA,ISO)

Phenotype Annotations Click to see Annotation Detail View

Mammalian Phenotype

no abnormal phenotype detected (IAGP)

References

References - curated

#	Reference Title	Reference Citation
1.	Network organization of the human autophagy system.	Behrends C, etal., Nature. 2010 Jul 1;466(7302):68-76. Epub 2010 Jun 20.
2.	Functional annotation of a full-length mouse cDNA collection.	Kawai J, etal., Nature. 2001 Feb 8;409(6821):685-90.
3.	Electronic Transfer of Homolog Data	MGD and Homologene mouse data transfer
4.	MGDs mouse GO annotations	MGD data from the GO Consortium
5.	MGD IEA	MGD IEA
6.	Analysis of the mouse transcriptome based on functional annotation of 60,770 full-length cDNAs.	Okazaki Y, etal., Nature. 2002 Dec 5;420(6915):563-73.
7.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
8.	Mouse MP Annotation Import Pipeline	RGD automated import pipeline
9.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
10.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
11.	LC3 conjugation system in mammalian autophagy.	Tanida I, etal., Int J Biochem Cell Biol. 2004 Dec;36(12):2503-18.

Additional References at PubMed

PMID:8889548	PMID:10349636	PMID:10899939	PMID:10900017	PMID:11042159	PMID:11076861	PMID:11146101	PMID:11890701	PMID:12477932	PMID:14610273	PMID:15365296	PMID:15489334
PMID:16141072	PMID:16141073	PMID:16307606	PMID:16602821	PMID:16874098	PMID:16954214	PMID:17916189	PMID:18451111	PMID:18497328	PMID:18799693	PMID:19225049	PMID:20010802
PMID:20354864	PMID:20577052	PMID:21267068	PMID:21383079	PMID:21388957	PMID:21677750	PMID:21873635	PMID:22033522	PMID:22049402	PMID:22948227	PMID:23427251	PMID:23671684
PMID:24089209	PMID:24240096	PMID:24747438	PMID:27124579	PMID:27899360	PMID:28320742	PMID:28497576	PMID:28604719	PMID:30504823	PMID:32325033	PMID:32876528	PMID:33042141
PMID:33436612	PMID:33591943	PMID:34338405	PMID:36113482	PMID:37434364

Genomics

Comparative Map Data

Gabarap
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	11	69,882,196 - 69,885,775 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	11	69,881,969 - 69,885,777 (+)	Ensembl		GRCm39 Ensembl
GRCm38	11	69,991,370 - 69,994,949 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	11	69,991,143 - 69,994,951 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	11	69,804,872 - 69,808,451 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	11	69,807,565 - 69,811,141 (+)	NCBI		MGSCv36	mm8
Celera	11	77,539,180 - 77,542,759 (+)	NCBI		Celera
Cytogenetic Map	11	B3	NCBI
cM Map	11	42.95	NCBI

GABARAP
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	17	7,240,008 - 7,242,449 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	17	7,240,008 - 7,242,449 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	17	7,143,327 - 7,145,768 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	17	7,084,462 - 7,086,477 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	17	7,084,462 - 7,086,477	NCBI
Celera	17	7,168,385 - 7,170,397 (-)	NCBI		Celera
Cytogenetic Map	17	p13.1	NCBI
HuRef	17	7,035,144 - 7,037,156 (-)	NCBI		HuRef
CHM1_1	17	7,152,530 - 7,154,546 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	17	7,140,933 - 7,143,371 (-)	NCBI		T2T-CHM13v2.0

Gabarap
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	55,213,465 - 55,216,787 (+)	NCBI		GRCr8
mRatBN7.2	10	54,714,777 - 54,718,099 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	54,714,198 - 54,717,765 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	59,376,972 - 59,380,294 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	58,865,552 - 58,868,874 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	54,372,830 - 54,376,146 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	56,601,288 - 56,604,223 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	56,601,288 - 56,604,221 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	56,346,407 - 56,349,342 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	56,837,772 - 56,840,707 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	10	56,851,394 - 56,854,330 (+)	NCBI
Celera	10	53,868,419 - 53,871,353 (+)	NCBI		Celera
Cytogenetic Map	10	q24	NCBI

Gabarap
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955467	9,667,941 - 9,670,067 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955467	9,667,938 - 9,670,067 (+)	NCBI	ChiLan1.0	ChiLan1.0

GABARAP
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	19	14,833,095 - 14,836,107 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	17	16,799,099 - 16,801,668 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	17	7,270,316 - 7,272,365 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	17	7,257,659 - 7,260,276 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	17	7,257,659 - 7,260,276 (-)	Ensembl	panpan1.1		panPan2

GABARAP
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	5	32,207,879 - 32,209,976 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	5	32,207,887 - 32,209,908 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	5	32,346,200 - 32,348,297 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	5	32,313,526 - 32,315,623 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	5	32,313,534 - 32,315,555 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	5	32,278,810 - 32,280,907 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	5	32,237,838 - 32,239,935 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	5	32,414,791 - 32,416,888 (-)	NCBI		UU_Cfam_GSD_1.0

Gabarap
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405602	47,059,854 - 47,061,872 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936595	533,977 - 536,271 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936595	534,042 - 536,289 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

GABARAP
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	12	52,596,543 - 52,598,194 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	12	52,596,130 - 52,598,166 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	12	54,842,339 - 54,844,400 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

GABARAP
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	16	6,614,478 - 6,616,516 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	16	6,614,688 - 6,616,443 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666059	14,793,285 - 14,796,280 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Gabarap
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624786	9,857,370 - 9,860,063 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624786	9,857,370 - 9,859,675 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Gabarap
78 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	540
Count of miRNA genes:	276
Interacting mature miRNAs:	312
Transcripts:	ENSMUST00000018711, ENSMUST00000108592, ENSMUST00000139007, ENSMUST00000144443
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCm39)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
27226783	Tibl5_m	tibia length 5, 5 week (mouse)					11	68190826	101890826	Mouse
1300628	Lgth6_m	body length 6 (mouse)			Not determined		11	66733420	100733652	Mouse
4141367	Inf1_m	acute ozone induced inflammation (mouse)			Not determined			44630038	113058009	Mouse
4141875	Etax9_m	ethanol induced ataxia 9 (mouse)			Not determined			55284985	72209927	Mouse
1300765	Bbaa4_m	B.burgdorferi-associated arthritis 4 (mouse)			Not determined		11	46185167	80185262	Mouse
1301788	Lbw8_m	lupus NZB x NZW 8 (mouse)			Not determined		11	36503287	70509492	Mouse
1302021	Nidd1n_m	non-insulin-dependent diabetes mellitus 1 in NSY (mouse)			Not determined		11	45165873	79978324	Mouse
4142121	Tmc1m2_m	Tmc1 modifier 2 (mouse)			Not determined		11	56864027	114157957	Mouse
1301896	Tria1_m	T-cell receptor induced activation 1 (mouse)			Not determined		11	36613565	70613855	Mouse
4141982	Skts-fp2_m	skin tumor susceptibility in FVB and PWK 2 (mouse)			Not determined			58719266	85066529	Mouse
4141853	Skmw17_m	skeletal muscle weight 17 (mouse)			Not determined		11	37080941	71081064	Mouse
1357878	Mastr_m	modifier of astrocytoma (mouse)			Not determined		11	45708581	89818733	Mouse
1300784	Prdt3_m	prion disease incubation time 3 (mouse)			Not determined		11	66733420	100733652	Mouse
11039501	Ltpr6a_m	Leishmania tropica response 6a (mouse)					11	64830336	98830473	Mouse
13208559	Wght10_m	weight 10 (mouse)					11	3950000	88890826	Mouse
13524840	Ppiq9a_m	prepulse inhibition QTL 9a (mouse)					11	52494385	86494385	Mouse
11039502	Ltpr6b_m	Leishmania tropica response 6b (mouse)					11	64830336	98830473	Mouse
36049792	Ars5_m	antibody response to SARS-CoV 5, day 7, IgM (mouse)					11	68990826	72490826	Mouse
13208558	Lgth12_m	body length 12 (mouse)					11	3950000	94890826	Mouse
1300664	Etohcta9_m	ethanol conditioned taste aversion 9 (mouse)			Not determined		11	57754660	91754758	Mouse
10053682	Eae45_m	experimental allergic encephalomyelitis susceptibility 45 (mouse)			Not determined		11	58490555	74754758	Mouse
1300924	Ity2_m	immunity to S. typhimurium 2 (mouse)			Not determined		1	58508030	87695238	Mouse
13208569	Bmiq10_m	body mass index QTL 10 (mouse)					11	35890827	84890826	Mouse
11039515	Ltpr6_m	Leishmania tropica response 6 (mouse)					11	64830336	98830473	Mouse
11532699	Sluc36b_m	susceptibility to lung cancer 36b (mouse)					11	42256617	76256730	Mouse
11532698	Sluc36a_m	susceptibility to lung cancer 36a (mouse)					11	42256617	76256730	Mouse
1300774	Pgia7_m	proteoglycan induced arthritis 7 (mouse)			Not determined		11	53390588	87390737	Mouse
4141830	Pregq1_m	pregnancy QTL 1 (mouse)			Not determined		11	54126752	83733652	Mouse
1301546	Pcir2_m	periosteal circumference 2 (mouse)			Not determined		11	66733420	100733652	Mouse
1300905	Scc6_m	colon tumor susceptibility 6 (mouse)			Not determined		11	6880277	89019734	Mouse
35673314	Ari2_m	antibody response to influenza 2, day 10, IgG3 (mouse)					11	68990826	72490826	Mouse
39128214	Lwq20_m	liver weight QTL 20 (mouse)					11	12268637	118022724	Mouse
1301328	Mol4_m	modifier of LPS-response 4 (mouse)			Not determined		11	36282577	83481356	Mouse
10412246	Dfs2_m	dental fluorosis suseptibility 2 (mouse)			Not determined		11	21807364	95881231	Mouse
1357766	Si5lq6_m	serum IGFBP-5 level QTL 6 (mouse)			Not determined		11	66733420	100733652	Mouse
4142316	Ity2b_m	immunity to S. typhimurium 2b (mouse)			Not determined		11	67078191	79813912	Mouse
1301319	Dautb4_m	dopamine uptake transporter binding 4 (mouse)			Not determined		11	62156005	96156153	Mouse
36049778	Ars6_m	antibody response to SARS-CoV 6, day 15, IgM (mouse)					11	68990826	72490826	Mouse
1301830	Ssta4_m	susceptibility to Salmonella typhimurium antigens 4 (mouse)			Not determined		11	50078191	84078411	Mouse
36049779	Ars7_m	antibody response to SARS-CoV 7, day 29, IgG1 (mouse)					11	68990826	72490826	Mouse
36049790	Ars3_m	antibody response to SARS-CoV 3, day 7, IgG2b (mouse)					11	68990826	72490826	Mouse
36049791	Ars4_m	antibody response to SARS-CoV 4, day 7, IgG3 (mouse)					11	68990826	72490826	Mouse
1301833	Tbbmd5_m	total body bone mineral density 5 (mouse)			Not determined		11	66733420	100733652	Mouse
36049788	Ars1_m	antibody response to SARS-CoV 1, day 7, IgG1 (mouse)					11	68990826	72490826	Mouse
36049789	Ars2_m	antibody response to SARS-CoV 2, day 7, IgG2a+IgG2c (mouse)					11	68990826	72490826	Mouse
36049786	Ars10_m	antibody response to SARS-CoV 10, 4 days post-rechallenge, IgG2a+IgG2c (mouse)					11	68990826	72490826	Mouse
10766457	Nwa3_m	New Zealand White autoimmunity 3 (mouse)					11	38016115	72016209	Mouse
36049787	Ars11_m	antibody response to SARS-CoV 11, 4 days post-rechallenge, IgM (mouse)					11	68990826	72490826	Mouse
36049784	Ars8_m	antibody response to SARS-CoV 8, day 29, IgG2a+IgG2c (mouse)					11	68990826	72490826	Mouse
36049785	Ars9_m	antibody response to SARS-CoV 9, day 29, IgM (mouse)					11	68990826	72490826	Mouse
4142300	Ctrq3_m	C. trachomatis resistance QTL 3 (mouse)			Not determined		11	44630038	76854757	Mouse
4141012	Femwf6_m	femur work to failure 6 (mouse)			Not determined			66733420	100733652	Mouse
1301987	Pid3_m	prior incubation determinant 3 (mouse)			Not determined		11	61686820	88699728	Mouse
27226730	Tibmd1_m	tibia midshaft diameter 1, 5 week (mouse)					11	62590826	109390826	Mouse
1301988	Bmd11_m	bone mineral density 11 (mouse)			Not determined		11	46319407	80319522	Mouse
4141894	Nidd6k_m	Nidd6 on KK-A (mouse)			Not determined			19124204	96897826	Mouse
1301999	Lmr15_m	leishmaniasis resistance 15 (mouse)			Not determined		11	63319407	81830473	Mouse
10044004	Stzid3_m	streptozotocin induced diabetes susceptibility 3 (mouse)			Not determined		11	63319407	94063918	Mouse
26884453	Sklq16_m	skull length QTL 16, 16 week (mouse)					11	3250000	72690826	Mouse

Markers in Region

RH128955

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	11	69,994,769 - 69,994,944	UniSTS	GRCm38
MGSCv37	11	69,808,271 - 69,808,446	UniSTS	GRCm37
Celera	11	77,542,579 - 77,542,754	UniSTS
Cytogenetic Map	11	B3	UniSTS
Cytogenetic Map	11	B4	UniSTS
cM Map	11	42.0	UniSTS

UniSTS:224312

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	11	69,994,831 - 69,994,943	UniSTS	GRCm38
MGSCv37	11	69,808,333 - 69,808,445	UniSTS	GRCm37
Celera	11	77,542,641 - 77,542,753	UniSTS
Cytogenetic Map	11	B4	UniSTS
Cytogenetic Map	11	B3	UniSTS
cM Map	11	42.0	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_019749	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF161587	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK002879	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK011731	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AL596185	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AV029091	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC002126	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC024621	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC029329	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC030350	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH466596	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CR933541	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	KY499680	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSMUST00000018711 ⟹ ENSMUSP00000018711

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	11	69,881,969 - 69,885,777 (+)	Ensembl
GRCm38.p6 Ensembl	11	69,991,143 - 69,994,951 (+)	Ensembl

Ensembl Acc Id:

ENSMUST00000108592 ⟹ ENSMUSP00000104233

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	11	69,882,465 - 69,885,766 (+)	Ensembl
GRCm38.p6 Ensembl	11	69,991,639 - 69,994,940 (+)	Ensembl

Ensembl Acc Id:

ENSMUST00000139007

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	11	69,882,633 - 69,883,427 (+)	Ensembl
GRCm38.p6 Ensembl	11	69,991,807 - 69,992,601 (+)	Ensembl

Ensembl Acc Id:

ENSMUST00000144443

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	11	69,882,510 - 69,885,761 (+)	Ensembl
GRCm38.p6 Ensembl	11	69,991,684 - 69,994,935 (+)	Ensembl

RefSeq Acc Id:

NM_019749 ⟹ NP_062723

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39	11	69,882,196 - 69,885,775 (+)	NCBI
GRCm38	11	69,991,370 - 69,994,949 (+)	NCBI
MGSCv37	11	69,804,872 - 69,808,451 (+)	RGD
Celera	11	77,539,180 - 77,542,759 (+)	RGD
cM Map	11		ENTREZGENE

Sequence:

show sequence

CAACTTTGTACTGTGGGAAAGGGTTTTTCAGTTCACTCGAAACAACAGCAACCTTATCTGCGAT
GTCATATGTGTAACCCACAAGTTGATTCCAAAGCAGTTACGCTGAAGGCGTAAGAGGACCAGGC
TACGGGTTGCGCTAGCAAGCTGAGCTAGTGGCGTATGTTAGCAGGCGGGGCCGGTCCGATGGTC
GGGGGCGGGGTTGATGAATAGGGAAGTGGCGCAAATTCGTGGATCGCTCCGCCAAGTCTGTTCG
TCGAAGCCGCCTCCGCCGCCGCCCCCTGTCCCGGCCCCCCCCCTGGGTTCCCTCAGCCCAGCTC
GGTCCAGCCCGGTTCTCGGGAGAATGAAGTTCGTGTACAAAGAGGAGCATCCGTTCGAGAAGCG
CCGCTCTGAGGGCGAGAAAATCCGAAAGAAATACCCAGACCGGGTCCCGGTGATAGTGGAAAAA
GCCCCCAAAGCTCGGATAGGAGACCTGGACAAAAAGAAATACCTGGTGCCTTCTGATCTTACAG
TTGGTCAATTCTACTTCTTGATCCGGAAGCGAATTCATCTCCGTGCTGAAGATGCCTTGTTTTT
CTTTGTCAACAATGTCATTCCACCCACCAGTGCCACGATGGGTCAGCTGTACCAGGAACACCAT
GAAGAAGACTTCTTTCTATACATTGCCTACAGTGATGAAAGCGTCTATGGTCTGTGAAGCTGCT
GTACCTGAGGTGGGGGGTTCCATTCTACGAAGAGAGGTGGCGCTCCTTCCTTGACATCCAGTTC
CTCCTTCAGGCTCAAACACCACCTCCTTTCTTCAGGACCTGCACTTAATGTTTGAGGCTGTCTC
TCCAGTCCCTCTCAGCAGGAGGGGTAATGGTAGATACAGCCTCCATACATCTCTTTCTCCCCTT
GTTTACCCTCCATTCCCACTCTGATTTAGACTTCTTGATTGTCGATCTCTGTCACATCCGATGA
TTGTTTTGGTTTCTATTCCCTTTCTAACTGCCCATCGGGCTCAGAACCCCAATAATCCCTTCCT
TTCACTATCTTCTTTTTGGGGGGTAGGTGGAAGGGATTGACATTGGATGGGGGAGGTAGGAGGC
ACATCAATAAAAAGGAAACCACCGAGCTGAATTG

hide sequence

Protein Sequences


Protein RefSeqs	NP_062723	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAD47642	(Get FASTA)	NCBI Sequence Viewer
	AAH02126	(Get FASTA)	NCBI Sequence Viewer
	AAH24621	(Get FASTA)	NCBI Sequence Viewer
	AAH30350	(Get FASTA)	NCBI Sequence Viewer
	AQS27601	(Get FASTA)	NCBI Sequence Viewer
	BAB22426	(Get FASTA)	NCBI Sequence Viewer
	BAB27806	(Get FASTA)	NCBI Sequence Viewer
	EDL12511	(Get FASTA)	NCBI Sequence Viewer
	EDL12512	(Get FASTA)	NCBI Sequence Viewer
	EDL12513	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSMUSP00000018711
	ENSMUSP00000018711.9
	ENSMUSP00000104233.2
GenBank Protein	Q9DCD6	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_062723 ⟸ NM_019749
- UniProtKB:	B1AR49 (UniProtKB/Swiss-Prot), Q9DCD6 (UniProtKB/Swiss-Prot), Q9QUI7 (UniProtKB/Swiss-Prot)
- Sequence:	show sequence MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLI RKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL hide sequence

Ensembl Acc Id:

ENSMUSP00000104233 ⟸ ENSMUST00000108592

Ensembl Acc Id:

ENSMUSP00000018711 ⟸ ENSMUST00000018711

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q9DCD6-F1-model_v2	AlphaFold	Q9DCD6	1-117	view protein structure

Promoters

RGD ID:

6820911

Promoter ID:

MM_KWN:8165

Type:

CpG-Island

SO ACC ID:

SO:0000170

Source:

MPROMDB

Tissues & Cell Lines:

3T3L1_Day0, 3T3L1_Day1, 3T3L1_Day2, 3T3L1_Day3, 3T3L1_Day4, 3T3L1_Day6, BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, Brain, ES_Cell, Kidney, Liver, Lung, MEF_B4, MEF_B6, Spleen

Transcripts:

ENSMUST00000108592, OTTMUST00000013495, OTTMUST00000013496, OTTMUST00000013497

Position:

Mouse Assembly	Chr	Position (strand)	Source
MGSCv36	11	69,804,501 - 69,805,617 (+)	MPROMDB

RGD ID:

8675274

Promoter ID:

EPDNEW_M15667

Type:

initiation region

Name:

Gabarap_1

Description:

Mus musculus gamma-aminobutyric acid receptor associated protein, mRNA.

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm38	11	69,991,592 - 69,991,652	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	MGI:1861742	AgrOrtholog
Ensembl Genes	ENSMUSG00000018567	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Ensembl Transcript	ENSMUST00000018711	ENTREZGENE
	ENSMUST00000018711.15	UniProtKB/Swiss-Prot
	ENSMUST00000108592.2	UniProtKB/TrEMBL
Gene3D-CATH	Phosphatidylinositol 3-kinase Catalytic Subunit, Chain A, domain 1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	Atg8-like	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Ubiquitin-like_domsf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	mmu:56486	UniProtKB/Swiss-Prot
MGD	MGI:1861742	ENTREZGENE
NCBI Gene	56486	ENTREZGENE
PANTHER	PTHR10969	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Atg8	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Gabarap	PhenoGen
Superfamily-SCOP	SSF54236	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A1S6GWH0_MOUSE	UniProtKB/TrEMBL
	B1AR49	ENTREZGENE
	B1AR50_MOUSE	UniProtKB/TrEMBL
	GBRAP_MOUSE	UniProtKB/Swiss-Prot, ENTREZGENE
	Q9QUI7	ENTREZGENE
UniProt Secondary	B1AR49	UniProtKB/Swiss-Prot
	Q9QUI7	UniProtKB/Swiss-Prot

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Mammalian Phenotype

Send us a Message

Imported Disease Annotations - ClinVar

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Mammalian Phenotype