Advanced Search (OLGA)

Gene: Hey2 (hes-related family bHLH transcription factor with YRPW motif 2) Rattus norvegicus

Analyze

Symbol:

Hey2

Name:

hes-related family bHLH transcription factor with YRPW motif 2

RGD ID:

621405

Description:

Enables RNA polymerase II-specific DNA-binding transcription factor binding activity. Involved in several processes, including Notch signaling pathway; negative regulation of cardiac vascular smooth muscle cell differentiation; and negative regulation of transcription by RNA polymerase II. Predicted to be located in cytoplasm. Predicted to be part of transcription repressor complex. Predicted to be active in nucleus. Orthologous to human HEY2 (hes related family bHLH transcription factor with YRPW motif 2); PARTICIPATES IN Notch signaling pathway; Notch signaling pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 3,3',5,5'-tetrabromobisphenol A; 6-propyl-2-thiouracil.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

hairy/enhancer-of-split related with YRPW motif 2; hairy/enhancer-of-split related with YRPW motif protein 2; Herp1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	28,641,100 - 28,651,187 (+)	NCBI		GRCr8
GRCr8 Ensembl	1	28,641,057 - 28,651,187 (+)	Ensembl		GRCr8 Ensembl
mRatBN7.2	1	26,822,131 - 26,832,218 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	26,822,131 - 26,832,218 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	26,573,165 - 26,583,262 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	32,572,976 - 32,583,073 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	26,773,752 - 26,783,849 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	29,191,170 - 29,201,257 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	29,191,192 - 29,201,531 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	30,633,675 - 30,643,762 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	27,505,117 - 27,515,204 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	1	25,500,527 - 25,510,614 (+)	NCBI		Celera
RGSC_v3.1	1	27,516,255 - 27,516,788 (+)	NCBI
Cytogenetic Map	1	p11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

aortic valve disease (ISS)

Breast Neoplasms (ISO)

Brugada syndrome (ISO)

Carotid Artery Injuries (IEP)

diabetic retinopathy (ISO)

hemangiopericytoma (ISO)

hypertrophic cardiomyopathy (ISO)

malignant astrocytoma (ISO)

pancreatic ductal carcinoma (ISO)

tetralogy of Fallot (ISO,ISS)

ureteral obstruction (ISO)

varicose veins (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2-(3,4-dimethoxyphenyl)-5-\{[2-(3,4-dimethoxyphenyl)ethyl](methyl)amino\}-2-(propan-2-yl)pentanenitrile (ISO)

3,3',5,5'-tetrabromobisphenol A (EXP)

3,4-methylenedioxymethamphetamine (ISO)

3-methyladenine (ISO)

4,4'-sulfonyldiphenol (ISO)

5-aza-2'-deoxycytidine (ISO)

6-propyl-2-thiouracil (EXP)

8-Br-cAMP (ISO)

acrylamide (EXP,ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

ammonium chloride (EXP)

antirheumatic drug (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenous acid (ISO)

baicalein (ISO)

baicalin (ISO)

belinostat (ISO)

benzo[a]pyrene (ISO)

bis(2-chloroethyl) sulfide (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

capsaicin (EXP)

carbon nanotube (ISO)

CGP 52608 (ISO)

choline (ISO)

cisplatin (ISO)

Cuprizon (EXP)

cypermethrin (ISO)

DAPT (EXP,ISO)

diallyl trisulfide (ISO)

diarsenic trioxide (ISO)

dibutyl phthalate (ISO)

dioxygen (ISO)

dorsomorphin (ISO)

doxorubicin (ISO)

endosulfan (EXP)

entinostat (ISO)

folic acid (ISO)

L-methionine (ISO)

lead diacetate (ISO)

lipopolysaccharide (ISO)

maneb (ISO)

methylisothiazolinone (ISO)

methylmercury chloride (ISO)

N-acetyl-L-cysteine (ISO)

nickel atom (ISO)

niclosamide (EXP,ISO)

okadaic acid (ISO)

oxaliplatin (EXP)

panobinostat (ISO)

paracetamol (EXP,ISO)

paraquat (ISO)

phenylephrine (ISO)

poly(I:C) (EXP)

raloxifene (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

SB 431542 (ISO)

sodium arsenite (ISO)

thiram (ISO)

titanium dioxide (ISO)

topotecan (EXP)

trichloroethene (EXP)

triclosan (ISO)

triptonide (ISO)

urethane (ISO)

valproic acid (ISO)

verapamil (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

anatomical structure formation involved in morphogenesis (IEA)

anterior/posterior axis specification (IEA,ISO)

anterior/posterior pattern specification (IBA)

aortic valve morphogenesis (IEA,ISO)

arterial endothelial cell differentiation (IEA,ISO)

artery development (IEA,ISO)

ascending aorta morphogenesis (IEA,ISO)

atrial septum morphogenesis (IEA,ISO)

atrioventricular valve development (IEA,ISO)

atrioventricular valve morphogenesis (IEA)

blood vessel development (IEA,ISO)

blood vessel endothelial cell differentiation (IEA,ISO)

cardiac epithelial to mesenchymal transition (IEA,ISO)

cardiac left ventricle morphogenesis (IEA,ISO)

cardiac muscle cell apoptotic process (IEA,ISO)

cardiac muscle cell proliferation (IEA,ISO)

cardiac muscle hypertrophy (IEA,ISO)

cardiac muscle hypertrophy in response to stress (IEA,ISO)

cardiac right ventricle morphogenesis (IEA,ISO)

cardiac septum morphogenesis (IEA,ISO)

cardiac vascular smooth muscle cell development (IEA,ISO)

cardiac ventricle morphogenesis (IEA,ISO)

cell fate commitment (IEA,ISO)

circulatory system development (IBA)

cochlea development (IEA,ISO)

coronary vasculature morphogenesis (IEA,ISO)

dorsal aorta morphogenesis (IEA,ISO)

endocardial cushion to mesenchymal transition involved in heart valve formation (IEA,ISO)

heart development (IEP)

heart trabecula formation (IEA,ISO)

labyrinthine layer blood vessel development (IEA,ISO)

mesenchymal cell development (IEA,ISO)

muscle organ development (IEA)

muscular septum morphogenesis (IEA,ISO)

negative regulation of biomineral tissue development (IEA,ISO)

negative regulation of cardiac muscle cell apoptotic process (IEA,ISO)

negative regulation of cardiac vascular smooth muscle cell differentiation (IDA)

negative regulation of DNA-templated transcription (IEA,ISO)

negative regulation of gene expression (IEA,ISO)

negative regulation of Notch signaling pathway (IEA,ISO)

negative regulation of smooth muscle cell differentiation (IEA,ISO)

negative regulation of transcription by RNA polymerase II (IDA,IEA,ISO)

negative regulation of transcription initiation by RNA polymerase II (IEA,ISO)

Notch signaling pathway (IBA,IDA,IEA,ISO)

outflow tract morphogenesis (IEA,ISO)

pattern specification process (IEA,ISO)

positive regulation of cardiac muscle cell proliferation (IEA,ISO)

positive regulation of heart rate (IEA,ISO)

positive regulation of transcription by RNA polymerase II (IEA,ISO)

protein-DNA complex assembly (IEA,ISO)

pulmonary artery morphogenesis (IEA,ISO)

pulmonary valve morphogenesis (IEA,ISO)

regulation of DNA-templated transcription (IEA)

regulation of gene expression (IEA,ISO)

regulation of inner ear auditory receptor cell differentiation (IEA,ISO)

regulation of neurogenesis (IBA)

regulation of neuron differentiation (IEA)

regulation of transcription by RNA polymerase II (IBA)

regulation of vasculogenesis (IEA,ISO)

striated muscle tissue development (IEA)

tissue morphogenesis (IEA)

tricuspid valve formation (IEA,ISO)

tricuspid valve morphogenesis (IEA,ISO)

umbilical cord morphogenesis (IEA,ISO)

vascular associated smooth muscle cell development (IEA,ISO)

vasculogenesis (IEA,ISO)

ventricular cardiac muscle cell development (IEA,ISO)

ventricular septum morphogenesis (IEA,ISO)

ventricular trabecula myocardium morphogenesis (IEA,ISO)

Cellular Component

cytoplasm (IEA,ISO)

nucleoplasm (TAS)

nucleus (IBA,IEA,ISO)

transcription repressor complex (IEA,ISO)

Molecular Function

cis-regulatory region sequence-specific DNA binding (IEA,ISO)

DNA binding (IEA,ISO)

DNA-binding transcription factor activity (IEA,ISO)

DNA-binding transcription factor activity, RNA polymerase II-specific (IBA,IEA,ISO)

DNA-binding transcription repressor activity, RNA polymerase II-specific (IEA,ISO)

histone deacetylase binding (IEA,ISO)

identical protein binding (IEA,ISO)

protein binding (ISO)

protein dimerization activity (IEA)

RNA polymerase II cis-regulatory region sequence-specific DNA binding (IBA)

RNA polymerase II-specific DNA-binding transcription factor binding (IDA,IEA,ISO)

sequence-specific DNA binding (IEA,ISO)

sequence-specific double-stranded DNA binding (IEA,ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

Notch signaling pathway (IDA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Cardiovascular basic helix loop helix factor 1, a novel transcriptional repressor expressed preferentially in the developing and adult cardiovascular system.	Chin MT, etal., J Biol Chem. 2000 Mar 3;275(9):6381-7.
2.	HERP1 inhibits myocardin-induced vascular smooth muscle cell differentiation by interfering with SRF binding to CArG box.	Doi H, etal., Arterioscler Thromb Vasc Biol. 2005 Nov;25(11):2328-34. Epub 2005 Sep 8.
3.	Delta-Notch--and then? Protein interactions and proposed modes of repression by Hes and Hey bHLH factors.	Fischer A and Gessler M, Nucleic Acids Res. 2007;35(14):4583-96. Epub 2007 Jun 22.
4.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
5.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
6.	HERP1 is a cell type-specific primary target of Notch.	Iso T, etal., J Biol Chem 2002 Feb 22;277(8):6598-607.
7.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
8.	NOTCH1 signaling induces pathological vascular permeability in diabetic retinopathy.	Miloudi K, etal., Proc Natl Acad Sci U S A. 2019 Mar 5;116(10):4538-4547. doi: 10.1073/pnas.1814711116. Epub 2019 Feb 20.
9.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
10.	Activation of multiple angiogenic signaling pathways in hemangiopericytoma.	Pierscianek D, etal., Brain Tumor Pathol. 2016 Jul;33(3):200-8. doi: 10.1007/s10014-016-0256-6. Epub 2016 Mar 7.
11.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
12.	Comprehensive gene review and curation	RGD comprehensive gene curation
13.	Arterialization and anomalous vein wall remodeling in varicose veins is associated with upregulated FoxC2-Dll4 pathway.	Surendran S, etal., Lab Invest. 2016 Apr;96(4):399-408. doi: 10.1038/labinvest.2015.167. Epub 2016 Jan 25.
14.	Coordinate Notch3-hairy-related transcription factor pathway regulation in response to arterial injury. Mediator role of platelet-derived growth factor and ERK.	Wang W, etal., J Biol Chem 2002 Jun 28;277(26):23165-71.

Additional References at PubMed

PMID:10964718	PMID:11076679	PMID:11095750	PMID:11486045	PMID:12372254	PMID:12535671	PMID:15107403	PMID:15297376	PMID:15485867	PMID:15680351	PMID:15821257	PMID:16025100
PMID:16043483	PMID:16199874	PMID:16293227	PMID:16603706	PMID:16953280	PMID:17259303	PMID:17303760	PMID:17332425	PMID:18239137	PMID:18302773	PMID:19154718	PMID:20382855
PMID:20619341	PMID:20628571	PMID:21290414	PMID:22110751	PMID:22615585

Genomics

Comparative Map Data

Hey2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	28,641,100 - 28,651,187 (+)	NCBI		GRCr8
GRCr8 Ensembl	1	28,641,057 - 28,651,187 (+)	Ensembl		GRCr8 Ensembl
mRatBN7.2	1	26,822,131 - 26,832,218 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	26,822,131 - 26,832,218 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	26,573,165 - 26,583,262 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	32,572,976 - 32,583,073 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	26,773,752 - 26,783,849 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	29,191,170 - 29,201,257 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	29,191,192 - 29,201,531 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	30,633,675 - 30,643,762 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	27,505,117 - 27,515,204 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	1	25,500,527 - 25,510,614 (+)	NCBI		Celera
RGSC_v3.1	1	27,516,255 - 27,516,788 (+)	NCBI
Cytogenetic Map	1	p11	NCBI

HEY2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	6	125,749,632 - 125,761,269 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	6	125,747,664 - 125,761,269 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	6	126,070,778 - 126,082,415 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	6	126,112,425 - 126,124,108 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	6	126,112,565 - 126,124,110	NCBI
Celera	6	126,813,087 - 126,824,769 (+)	NCBI		Celera
Cytogenetic Map	6	q22.31	NCBI
HuRef	6	123,645,968 - 123,657,653 (+)	NCBI		HuRef
CHM1_1	6	126,334,804 - 126,346,479 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	6	126,938,147 - 126,949,784 (+)	NCBI		T2T-CHM13v2.0

Hey2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	10	30,708,355 - 30,718,779 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	10	30,708,355 - 30,718,797 (-)	Ensembl		GRCm39 Ensembl
GRCm38	10	30,832,359 - 30,842,783 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	10	30,832,359 - 30,842,801 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	10	30,552,165 - 30,562,589 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	10	30,521,775 - 30,532,199 (-)	NCBI		MGSCv36	mm8
Celera	10	31,757,027 - 31,767,443 (-)	NCBI		Celera
Cytogenetic Map	10	A4	NCBI
cM Map	10	17.19	NCBI

Hey2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955436	7,060,930 - 7,070,030 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955436	7,060,930 - 7,070,610 (+)	NCBI	ChiLan1.0	ChiLan1.0

HEY2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	5	145,733,083 - 145,744,698 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	6	143,638,233 - 143,649,847 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	6	123,527,180 - 123,538,794 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	6	127,647,547 - 127,659,056 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	6	127,647,547 - 127,659,056 (+)	Ensembl	panpan1.1		panPan2

HEY2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	1	64,630,656 - 64,646,546 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	1	65,440,361 - 65,450,303 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	1	64,840,402 - 64,850,338 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	1	64,839,247 - 64,850,338 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	1	64,769,017 - 64,778,950 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	1	64,556,353 - 64,566,279 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	1	65,207,272 - 65,217,212 (+)	NCBI		UU_Cfam_GSD_1.0

Hey2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404946	114,704,470 - 114,715,205 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936639	3,703,447 - 3,716,820 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936639	3,705,225 - 3,714,696 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

HEY2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	37,219,883 - 37,231,385 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	1	37,219,887 - 37,231,321 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	40,989,466 - 41,000,901 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

HEY2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	13	47,965,808 - 47,977,435 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	13	47,964,847 - 47,977,346 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666040	20,275,597 - 20,288,250 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Hey2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624753	375,279 - 384,379 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624753	375,163 - 394,402 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Hey2
35 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	636
Count of miRNA genes:	273
Interacting mature miRNAs:	359
Transcripts:	ENSRNOT00000018718
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2313090	Bmd69	Bone mineral density QTL 69	4.4	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	1	5293229	34184556	Rat
631688	Hcas2	Hepatocarcinoma susceptibility QTL 2	3	0.0001	liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	7746118	52746118	Rat
4889451	Eae29	Experimental allergic encephalomyelitis QTL 29	5.51		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis severity score (CMO:0001419)	1	7746121	52746121	Rat
70179	Xhs2	X-ray hypersensitivity QTL 2	3.2		intestine integrity trait (VT:0010554)	post-insult time to onset of moribundity (CMO:0001896)	1	1	43965634	Rat
1558642	Prcr2	Prostate cancer resistance QTL 2	4.3		prostate integrity trait (VT:0010571)	area of ventral prostate occupied by tumorous lesions to total ventral prostate area ratio (CMO:0000899)	1	10379492	55379492	Rat
7421626	Bp360	Blood pressure QTL 360		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	6941022	51941022	Rat
2313070	Bss52	Bone structure and strength QTL 52	4.4	0.0001	body length (VT:0001256)	body length (CMO:0000013)	1	5293229	34184556	Rat
1357401	Bw43	Body weight QTL 43	3.75		body mass (VT:0001259)	body weight (CMO:0000012)	1	6909353	51909353	Rat
631494	Bp95	Blood pressure QTL 95	40	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	17315378	51816258	Rat
5684998	Bss101	Bone structure and strength QTL 101	3.6		tibia strength trait (VT:1000284)	tibia ultimate force (CMO:0001734)	1	6909353	51909353	Rat
5684999	Bss102	Bone structure and strength QTL 102	5.5	7e-07	tibia strength trait (VT:1000284)	tibia stiffness (CMO:0001735)	1	6909353	51909353	Rat
2302038	Pia31	Pristane induced arthritis QTL 31	5.5	0.001	blood autoantibody amount (VT:0003725)	serum immunoglobulin M-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002111)	1	12820494	57820494	Rat
2317755	Glom22	Glomerulus QTL 22	3.8		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	1	1	34184556	Rat
634353	Rends2	Renal damage susceptibility QTL 2		0.05	kidney blood vessel morphology trait (VT:0000530)	organ lesion measurement (CMO:0000677)	1	20656420	65656420	Rat
1578756	Iddm22	Insulin dependent diabetes mellitus QTL 22	2.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	20508326	65508326	Rat
631508	Sald1	Serum aldosterone level QTL 1	3.7		blood aldosterone amount (VT:0005346)	serum aldosterone level (CMO:0000487)	1	11684464	56684464	Rat
2313053	Bss51	Bone structure and strength QTL 51	3.8	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	1	5293229	34184556	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
9	11	49	113	91	90	59	25	59	6	218	97	11	93	45	60	31	16	16

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_130417	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AY059382	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474002	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000018718 ⟹ ENSRNOP00000018718

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	1	28,641,057 - 28,651,181 (+)	Ensembl
mRatBN7.2 Ensembl	1	26,822,131 - 26,832,218 (+)	Ensembl
Rnor_6.0 Ensembl	1	29,191,192 - 29,201,531 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000131406 ⟹ ENSRNOP00000104789

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	1	28,641,284 - 28,651,187 (+)	Ensembl

RefSeq Acc Id:

NM_130417 ⟹ NP_569101

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	28,641,100 - 28,651,187 (+)	NCBI
mRatBN7.2	1	26,822,131 - 26,832,218 (+)	NCBI
Rnor_6.0	1	29,191,170 - 29,201,257 (+)	NCBI
Rnor_5.0	1	30,633,675 - 30,643,762 (+)	NCBI
RGSC_v3.4	1	27,505,117 - 27,515,204 (+)	RGD
Celera	1	25,500,527 - 25,510,614 (+)	RGD

Sequence:

show sequence

GCGGGGAGGGAGGGAGGAGGCCCGCGAGGAGCTCAGGGTGTCCGTAGCTCTTCTTTTTCGCCGC
GATGAAGCGCCCTTGCGAGGAGACGACCTCTGAAAGCGACCTAGACGAGACCATCGACGTGGGG
AGCGAGAACAATTACTCCGGGCACAGTGCAAGCTCAGTGATGAGGTCCAATTCACCTACAACCA
CCTCTCAGATTATGGCAAGAAAGAAAAGGAGAGGGATCATAGAAAAAAGGCGTCGGGATCGAAT
AAATAACAGTTTATCTGAATTGAGAAGACTAGTGCCAACAGCTTTTGAAAAACAAGGATCTGCC
AAGTTGGAAAAGGCTGAAATTCTGCAAATGACAGTGGATCATTTGAAGATGCTCCAGGCAACAG
GGGGGAAAGGCTACTTTGACGCCCATGCCCTTGCCACGGACTTTATGAGCATTGGATTCCGAGA
ATGCTTGACAGAAGTGGCGAGGTACCTAAGCTCTGTGGAAGGCCTTGACCCTTCGGACCCACTA
CGCGTGCGCCTTGTCTCTCATCTCAGCACCTGTGCCTCCCAGCGGGAGGCAGCAGTGATGACAT
CCTCCATGTCCCACCACCATCACCCCCTGCACCCTCACCACTGGGCAGCGGCCTTCCACCATCT
CCCCACATCCCTGCTCCAACCCAATGGACTCCACACATCAGAGTCAACGCCATGTCGCCTATCC
ACGTCTTCAGAAGTGCCTCCTGCTCATGGCTCTGCCCTCCTCACAGCAACATTTGCCCATGCAG
ATTCTGCTCTTCGGATGCCATCAACGGGCACCGTCGCACCCTGCGTGCCACCTCTCTCCACCTC
TCTCCTGTCTCTTTCAGCTACTGTGCATGCCGCAGCAGCAGCGGCCACCGCAGCTGCACACAGC
TTCCCTCTGTCCTTCGCAGGGGCCTTTCCCATGCTCCCATCCAATGCAGCAGCAGCCGCCGCGG
TTGCCGCTGCAACAGCAATCAGCCCACCGTTATCAGTGTCTGCAGCCTCCAGTCCTCAGCAGAC
AAGCAGTGGAACAAACAGTAAACCTTACCGACCCTGGGGGACAGAAGTTGGAGCCTTTTAAGTT
ATTCTTGAATCTCTTTGCAATAGTAACTGGTGTCCTCCGTTTCGGAATCAGCTTCAAACCTCTG
CACCCGGACGGTAGTCATACAGATACGTCCAGATCTCCACAGCAGCAATAAAGCGATTTGAGAA
GAAACTTCCCACAAATGGAAATGTAGTATTATTTTTTCCTTTGTTTAAGGCAGCTTGGCAACTG
ACATCAACAACTTGAAAGCCGCACACCGGTTTCCATTTAAACTTTCTTGGAAAATACACCGATG
TTACCATCCAGTAGTGCATTTATACTCCTGATTTGGAAAAGAAAAAACCCCATAACTGAGTTCT
CCTGATGCAGGAAGGGAGAAGAAAAAAAAAATACCATGTTTCCTAAGTGCCTGAACTAAGAAAC
ATAATGTAGCACAAGGTCAGAAGGGTATAACCGTTAAGGTGAGAAAGGGAGAGTGCAGACAAGG
TGTCGGGCTGCAGATACAGTGTTCTTTGGGAACCAGAAAGATGAATGAAAGTTAAGTTGAAAGA
CCTAGTTTTGTCTTTGTTTTCTTTATACAGACTTGCCAGGCAGTGACATTTAGCAGTGCACTGA
AATAAAAATTCCCCCAGAGCCCCCATTAACAAGCATTTCTGGTCTGCCTTCAAGCTTCCGTACC
TCTGGTGAGCCCTAGCTTAAAACGCTATGCTTCTTTATGTAAACTTACAGGTATACATGCACTA
GAAGCAGTTACCTACTGTGTGCCCACCAGAGGTTCACTCACACGAACGGGAAAACTTCAGTTTG
CCAGACTTTGGATTAATTTATTGTTTCACTTGGACTATGTTTATATATTTAACTTCTTCAGTTT
TCTCCTGACAACATGTAATGTCTGTTCTTGTCTGTTTGGGGGTGGGGGGGGTGTTGCATTTTTG
GAAGTAACGAGAGAAGGAGAGATGATATGGAAGGGAAAAGCTACATGATGTAAATGTCTTGGTC
AAATCACAACGAATGTATGGAATGAGTTGTATATAAATTATTTTTGTCCATGCATAGACTAGTG
CTACATAATGGTGTTTTGGTTTTGATTTTTTTTTATCTTAACAATGAAATAATCTCTTAAGACA
TTGAAATTGAGCACATGAGATTTTATATTTGAAAGAATAAGGCACAGCATGTATTCTTATGCAC
TTCGTTTCTCTGCTGTGTGGAGAAAGCAGTAAACAAGAGAATATTAAACATTATGCAAAGTTAT
ACTCATAAATATGTTTTTAAAATTACTGTACCTAGTCTCTTCTGTATTACTTTGTAACTTTTTT
CTATGCAAAAGTCTACGTGTCACTAATTAAATGACGTCCTTTTTGACTATTTC

hide sequence

Protein Sequences


Protein RefSeqs	NP_569101	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAL30105	(Get FASTA)	NCBI Sequence Viewer
	EDL87708	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000018718
	ENSRNOP00000018718.3

RefSeq Acc Id:

NP_569101 ⟸ NM_130417

- UniProtKB:

G3V7S6 (UniProtKB/TrEMBL), A6JUS1 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MKRPCEETTSESDLDETIDVGSENNYSGHSASSVMRSNSPTTTSQIMARKKRRGIIEKRRRDRI
NNSLSELRRLVPTAFEKQGSAKLEKAEILQMTVDHLKMLQATGGKGYFDAHALATDFMSIGFRE
CLTEVARYLSSVEGLDPSDPLRVRLVSHLSTCASQREAAVMTSSMSHHHHPLHPHHWAAAFHHL
PTSLLQPNGLHTSESTPCRLSTSSEVPPAHGSALLTATFAHADSALRMPSTGTVAPCVPPLSTS
LLSLSATVHAAAAAATAAAHSFPLSFAGAFPMLPSNAAAAAAVAAATAISPPLSVSAASSPQQT
SSGTNSKPYRPWGTEVGAF

hide sequence

Ensembl Acc Id:

ENSRNOP00000018718 ⟸ ENSRNOT00000018718

Ensembl Acc Id:

ENSRNOP00000104789 ⟸ ENSRNOT00000131406

Protein Domains

bHLH Orange

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-G3V7S6-F1-model_v2	AlphaFold	G3V7S6	1-339	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13689543

Promoter ID:

EPDNEW_R67

Type:

multiple initiation site

Name:

Hey2_1

Description:

hes-related family bHLH transcription factor with YRPW motif2

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	1	29,191,116 - 29,191,176	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:621405	AgrOrtholog
BioCyc Gene	G2FUF-61981	BioCyc
Ensembl Genes	ENSRNOG00000013364	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000018718	ENTREZGENE
	ENSRNOT00000018718.7	UniProtKB/TrEMBL
Gene3D-CATH	4.10.280.10	UniProtKB/TrEMBL
	6.10.250.980	UniProtKB/TrEMBL
InterPro	HES_HEY	UniProtKB/TrEMBL
	HLH_DNA-bd_sf	UniProtKB/TrEMBL
	HLH_dom	UniProtKB/TrEMBL
	Orange	UniProtKB/TrEMBL
KEGG Report	rno:155430	UniProtKB/TrEMBL
NCBI Gene	155430	ENTREZGENE
PANTHER	BASIC HELIX-LOOP-HELIX TRANSCRIPTION FACTOR, HES-RELATED	UniProtKB/TrEMBL
Pfam	Hairy_orange	UniProtKB/TrEMBL
	HLH	UniProtKB/TrEMBL
PhenoGen	Hey2	PhenoGen
PROSITE	HLH	UniProtKB/TrEMBL
	ORANGE	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000013364	RatGTEx
SMART	HLH	UniProtKB/TrEMBL
	ORANGE	UniProtKB/TrEMBL
Superfamily-SCOP	HLH_basic	UniProtKB/TrEMBL
	Orange domain-like	UniProtKB/TrEMBL
UniProt	A6JUS1	ENTREZGENE, UniProtKB/TrEMBL
	G3V7S6	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2013-11-11	Hey2	hes-related family bHLH transcription factor with YRPW motif 2	Hey2	hairy/enhancer-of-split related with YRPW motif 2	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-01-20	Hey2	hairy/enhancer-of-split related with YRPW motif 2			Symbol and Name status set to approved	1299863	APPROVED
2002-08-07	Hey2	hairy/enhancer-of-split related with YRPW motif 2			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

RGD Manual Annotations

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

RGD Manual Annotations