Advanced Search (OLGA)

Gene: Atp5pf (ATP synthase peripheral stalk subunit F6) Rattus norvegicus

Analyze

Symbol:

Atp5pf

Name:

ATP synthase peripheral stalk subunit F6

RGD ID:

621376

Description:

Contributes to ATP hydrolysis activity. Involved in several processes, including negative regulation of icosanoid secretion; positive regulation of heart rate; and response to muscle activity. Located in cell surface and extracellular space. Part of proton-transporting ATP synthase complex. Used to study pulmonary hypertension. Biomarker of pulmonary hypertension. Orthologous to human ATP5PF (ATP synthase peripheral stalk subunit F6); PARTICIPATES IN forkhead class A signaling pathway; Alzheimer's disease pathway; Huntington's disease pathway; INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

ATP synthase, H+ transporting, mitochondrial F0 complex, subunit F6; ATP synthase, H+ transporting, mitochondrial Fo complex, subunit F6; ATP synthase-coupling factor 6, mitochondrial; Atp5j; ATPase subunit F6; coupling factor 6; LOC102551946; uncharacterized LOC102551946

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	ATP5PF (ATP synthase peripheral stalk subunit F6)	HGNC	Ensembl, HomoloGene, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Atp5pf (ATP synthase peripheral stalk subunit F6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Atp5pf (ATP synthase peripheral stalk subunit F6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	ATP5PF (ATP synthase peripheral stalk subunit F6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	ATP5PF (ATP synthase peripheral stalk subunit F6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Atp5pf (ATP synthase peripheral stalk subunit F6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	ATP5PF (ATP synthase peripheral stalk subunit F6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	ATP5PF (ATP synthase peripheral stalk subunit F6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Atp5pf (ATP synthase peripheral stalk subunit F6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Atp5pf (ATP synthase peripheral stalk subunit F6)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	ATP5PF (ATP synthase peripheral stalk subunit F6)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	si:ch211-140m22.7	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER)
Danio rerio (zebrafish):	si:dkey-22n8.3	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Danio rerio (zebrafish):	atp5pf	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	ATPsynCF6	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	ATPsynCF6L	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	atp-4	Alliance	DIOPT (Hieranoid\|OrthoFinder\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	atp5pf	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	11	37,368,045 - 37,375,721 (-)	NCBI		GRCr8
mRatBN7.2	11	23,881,594 - 23,889,581 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	11	23,881,592 - 23,889,119 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	11	32,587,838 - 32,594,892 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	11	25,288,245 - 25,295,299 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	11	24,476,951 - 24,484,006 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	11	24,286,806 - 24,294,419 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	11	24,286,787 - 24,294,179 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	11	27,914,805 - 27,918,237 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	11	24,316,748 - 24,323,800 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	11	24,316,747 - 24,323,800 (-)	NCBI
Celera	11	23,720,789 - 23,727,843 (-)	NCBI		Celera
Cytogenetic Map	11	q11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Alzheimer's disease (ISO)

Alzheimer's Disease, Early-Onset, with Cerebral Amyloid Angiopathy (ISO)

essential hypertension (ISO)

Experimental Diabetes Mellitus (IEP)

heart disease (ISO)

Left Ventricular Hypertrophy (IEP)

Liver Injury (IEP)

Neurodevelopmental Disorders (ISO)

pulmonary hypertension (IEP,IMP)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-dexrazoxane (ISO)

1,2-dimethylhydrazine (ISO)

17beta-estradiol (EXP,ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

4,4'-diaminodiphenylmethane (ISO)

4,4'-sulfonyldiphenol (ISO)

5-fluorouracil (ISO)

6-propyl-2-thiouracil (EXP)

aconitine (EXP)

amitrole (EXP)

ammonium chloride (EXP)

ampicillin (EXP)

arsane (ISO)

arsenic atom (ISO)

atrazine (ISO)

beauvericin (ISO)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

calcium dichloride (ISO)

CGP 52608 (ISO)

chlorpyrifos (EXP)

copper(II) sulfate (ISO)

corosolic acid (ISO)

crocidolite asbestos (ISO)

cyclosporin A (ISO)

dibutyl phthalate (ISO)

diclofenac (EXP)

doxorubicin (ISO)

elemental selenium (ISO)

enniatin (ISO)

ethanol (ISO)

fenthion (ISO)

folic acid (ISO)

fulvestrant (ISO)

gentamycin (EXP)

hydralazine (ISO)

isobutanol (ISO)

isoniazide (ISO)

ivermectin (ISO)

lamivudine (ISO)

lipopolysaccharide (ISO)

methimazole (EXP)

metronidazole (EXP)

neomycin (EXP)

ochratoxin A (ISO)

paracetamol (EXP,ISO)

perfluorooctane-1-sulfonic acid (ISO)

pregnenolone 16alpha-carbonitrile (EXP)

reactive oxygen species (ISO)

rotenone (ISO)

selenium atom (ISO)

sodium arsenite (ISO)

sulfadimethoxine (EXP)

sunitinib (ISO)

thiram (ISO)

tolcapone (EXP)

toluene (EXP)

trichloroethene (EXP)

triphenyl phosphate (ISO)

triptonide (ISO)

troglitazone (ISO)

tungsten (ISO)

urethane (ISO)

valproic acid (ISO)

vancomycin (EXP)

zidovudine (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

monoatomic ion transport (IEA)

negative regulation of arachidonate secretion (IDA)

negative regulation of prostaglandin secretion (IDA,IMP)

positive regulation of blood pressure (IDA,IMP)

positive regulation of heart rate (IDA)

proton motive force-driven ATP synthesis (IEA)

proton motive force-driven mitochondrial ATP synthesis (ISO)

proton transmembrane transport (IEA)

response to muscle activity (IEP)

substantia nigra development (ISO)

Cellular Component

cell surface (IDA)

extracellular space (IDA)

membrane (IEA)

mitochondrial inner membrane (IEA)

mitochondrion (IEA,ISO)

proton-transporting ATP synthase complex (IBA,IDA,IEA,ISO)

Molecular Function

ATP hydrolysis activity (IDA)

protein binding (ISO)

protein-containing complex binding (IDA)

proton transmembrane transporter activity (IEA)

proton-transporting ATP synthase activity, rotational mechanism (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

Alzheimer's disease pathway (IEA)

forkhead class A signaling pathway (ISO)

Huntington's disease pathway (IEA)

oxidative phosphorylation pathway (IEA)

Parkinson's disease pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Comparison of gene and protein expressions in rats residing in standard cages with those having access to an exercise wheel.	Alessio HM, etal., Biomed Res Int. 2014;2014:950516. doi: 10.1155/2014/950516. Epub 2014 Feb 25.
2.	Total synthesis of human and rat coupling factor-6 amide and pressor effects in the rat.	Chang JK, etal., Regul Pept. 2003 May 15;113(1-3):63-9.
3.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
5.	Mitochondrial coupling factor 6 upregulation in hypertension-induced cardiac hypertrophy.	He T, etal., Herz. 2015 Aug;40(5):783-7. doi: 10.1007/s00059-015-4301-8. Epub 2015 Apr 22.
6.	cDNA cloning and sequencing for the import precursor of coupling factor 6 in H(+)-ATP synthase from rat liver mitochondria.	Higuti T, etal., Biochem Biophys Res Commun 1990 Sep 28;171(3):1079-86.
7.	A simple, rapid method for purification of epsilon-subunit, coupling factor 6, subunit d, and subunit e from rat liver H(+)-ATP synthase and determination of the complete amino acid sequence of epsilon-subunit.	Higuti T, etal., J Biol Chem. 1992 Nov 5;267(31):22658-61.
8.	KEGG: Kyoto Encyclopedia of Genes and Genomes	KEGG
9.	Mitochondrial F(0)F(1) ATP synthase. Subunit regions on the F1 motor shielded by F(0), Functional significance, and evidence for an involvement of the unique F(0) subunit F(6).	Ko YH, etal., J Biol Chem. 2000 Oct 20;275(42):32931-9.
10.	Coupling Factor 6 Is Upregulated in Monocrotaline-induced Pulmonary Arterial Hypertension in Rats.	Li N, etal., Am J Med Sci. 2016 Dec;352(6):631-636. doi: 10.1016/j.amjms.2016.08.002. Epub 2016 Aug 15.
11.	Identification of two proteins associated with mammalian ATP synthase.	Meyer B, etal., Mol Cell Proteomics. 2007 Oct;6(10):1690-9. Epub 2007 Jun 17.
12.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
13.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
14.	A novel inhibitory effect on prostacyclin synthesis of coupling factor 6 extracted from the heart of spontaneously hypertensive rats.	Osanai T, etal., J Biol Chem. 1998 Nov 27;273(48):31778-83.
15.	Mitochondrial coupling factor 6 as a potent endogenous vasoconstrictor.	Osanai T, etal., J Clin Invest. 2001 Oct;108(7):1023-30. doi: 10.1172/JCI11076.
16.	Circulating coupling factor 6 in human hypertension: role of reactive oxygen species.	Osanai T, etal., J Hypertens. 2003 Dec;21(12):2323-8. doi: 10.1097/01.hjh.0000098161.70956.08.
17.	Coupling factor 6-induced prostacyclin inhibition is enhanced in vascular smooth muscle cells from spontaneously hypertensive rats.	Osanai T, etal., J Hypertens. 2009 Sep;27(9):1823-8. doi: 10.1097/HJH.0b013e32832d4b05.
18.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
19.	PID Annotation Import Pipeline	Pipeline to import Pathway Interaction Database annotations from NCI into RGD
20.	Application of a discovery to targeted LC-MS proteomics approach to identify deregulated proteins associated with idiosyncratic liver toxicity in a rat model of LPS/diclofenac co-administration.	Ramm S, etal., Toxicology. 2015 May 4;331:100-11. doi: 10.1016/j.tox.2015.03.004. Epub 2015 Mar 13.
21.	GOA pipeline	RGD automated data pipeline
22.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
23.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
24.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
25.	Rat mitochondrial coupling factor 6: molecular cloning of a cDNA encoding the imported precursor.	Tracer HL, etal., Gene 1992 Jul 15;116(2):291-2.
26.	Lung-specific RNA interference of coupling factor 6, a novel peptide, attenuates pulmonary arterial hypertension in rats.	Yin J, etal., Respir Res. 2016 Aug 4;17(1):99. doi: 10.1186/s12931-016-0409-5.
27.	H(+)-ATP synthase from rat liver mitochondria. A simple, rapid purification method of the functional complex and its characterization.	Yoshihara Y, etal., Biochemistry. 1991 Jul 16;30(28):6854-60.
28.	Marine collagen peptides reduce endothelial cell injury in diabetic rats by inhibiting apoptosis and the expression of coupling factor 6 and microparticles.	Zhu C, etal., Mol Med Rep. 2017 Oct;16(4):3947-3957. doi: 10.3892/mmr.2017.7061. Epub 2017 Jul 21.

Additional References at PubMed

PMID:12110673	PMID:12865426	PMID:14651853	PMID:15489334	PMID:18614015	PMID:20833797	PMID:22926577	PMID:25002582	PMID:29476059	PMID:35352799

Genomics

Comparative Map Data

Atp5pf
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	11	37,368,045 - 37,375,721 (-)	NCBI		GRCr8
mRatBN7.2	11	23,881,594 - 23,889,581 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	11	23,881,592 - 23,889,119 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	11	32,587,838 - 32,594,892 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	11	25,288,245 - 25,295,299 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	11	24,476,951 - 24,484,006 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	11	24,286,806 - 24,294,419 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	11	24,286,787 - 24,294,179 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	11	27,914,805 - 27,918,237 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	11	24,316,748 - 24,323,800 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	11	24,316,747 - 24,323,800 (-)	NCBI
Celera	11	23,720,789 - 23,727,843 (-)	NCBI		Celera
Cytogenetic Map	11	q11	NCBI

ATP5PF
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	21	25,724,500 - 25,735,653 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	21	25,716,503 - 25,735,673 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	21	27,096,811 - 27,107,964 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	21	26,018,662 - 26,029,836 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	21	26,018,662 - 26,029,836	NCBI
Celera	21	12,280,206 - 12,291,380 (-)	NCBI		Celera
Cytogenetic Map	21	q21.3	NCBI
HuRef	21	12,499,927 - 12,511,003 (-)	NCBI		HuRef
CHM1_1	21	26,657,444 - 26,668,586 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	21	24,082,042 - 24,093,216 (-)	NCBI		T2T-CHM13v2.0

Atp5pf
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	16	84,624,754 - 84,632,495 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	16	84,624,754 - 84,632,513 (-)	Ensembl		GRCm39 Ensembl
GRCm38	16	84,827,871 - 84,835,857 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	16	84,827,866 - 84,835,625 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	16	84,828,116 - 84,835,819 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	16	84,710,463 - 84,718,166 (-)	NCBI		MGSCv36	mm8
Celera	16	85,033,263 - 85,040,971 (-)	NCBI		Celera
Cytogenetic Map	16	C3.3	NCBI
cM Map	16	46.92	NCBI

Atp5pf
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955407	25,601,083 - 25,609,888 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955407	25,601,253 - 25,609,933 (-)	NCBI	ChiLan1.0	ChiLan1.0

ATP5PF
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	22	21,919,475 - 21,930,738 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	21	16,776,655 - 16,787,928 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	21	12,169,567 - 12,180,717 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	21	25,526,252 - 25,537,363 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	21	25,519,441 - 25,537,363 (-)	Ensembl	panpan1.1		panPan2

ATP5PF
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	31	21,207,080 - 21,212,220 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	31	21,200,337 - 21,215,975 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
ROS_Cfam_1.0	31	21,261,085 - 21,269,970 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	31	21,254,346 - 21,269,778 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	31	21,278,973 - 21,288,056 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	31	21,280,200 - 21,289,273 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	31	21,755,620 - 21,764,710 (-)	NCBI		UU_Cfam_GSD_1.0

Atp5pf
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404971	21,756,733 - 21,764,531 (-)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936640	1,916,711 - 1,924,823 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

ATP5PF
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	13	189,278,945 - 189,290,229 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	13	189,281,429 - 189,290,234 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	13	199,153,513 - 199,157,380 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

ATP5PF
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	2	66,539,014 - 66,550,186 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	2	66,538,864 - 66,550,046 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666050	87,004,210 - 87,016,075 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Atp5pf
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624745	13,779,610 - 13,787,610 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624745	13,779,610 - 13,787,525 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Atp5pf
4 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	12
Count of miRNA genes:	11
Interacting mature miRNAs:	12
Transcripts:	ENSRNOT00000002116
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1300147	Bp187	Blood pressure QTL 187	3.67		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	11	1	69446234	Rat
724554	Iddm17	Insulin dependent diabetes mellitus QTL 17		0.001	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	11	18976208	86241447	Rat
1598842	Glom10	Glomerulus QTL 10	3.4		kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	11	1	35331169	Rat
8694376	Bw156	Body weight QTL 156	2.25	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	11	23280456	68280456	Rat
10755497	Bp388	Blood pressure QTL 388	2.76		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	11	19456205	76331918	Rat
724517	Uae18	Urinary albumin excretion QTL 18	3.7		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	11	16472047	44285911	Rat
2290451	Scl58	Serum cholesterol level QTL 58	3.48		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	11	12831046	25121472	Rat
10058952	Gmadr6	Adrenal mass QTL 6	2.29	0.0072	adrenal gland mass (VT:0010420)	both adrenal glands wet weight to body weight ratio (CMO:0002411)	11	22959403	67959403	Rat
1600394	Edcs1	Endometrial carcinoma susceptibility QTL1	2.9	0.04	uterus morphology trait (VT:0001120)	percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759)	11	18976208	24697116	Rat
1558659	Tescar1	Testicular tumor resistance QTL 1	3.9		testis integrity trait (VT:0010572)	percentage of study population developing testis tumors during a period of time (CMO:0001261)	11	1041931	66113562	Rat
9589032	Epfw10	Epididymal fat weight QTL 10	9.29	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	11	23280456	68280456	Rat
9590313	Scort20	Serum corticosterone level QTL 20	6.51	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	11	23280456	68280456	Rat
8694424	Bw162	Body weight QTL 162	3.8	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	11	23280456	68280456	Rat
1641927	Alcrsp10	Alcohol response QTL 10			alcohol metabolism trait (VT:0015089)	blood ethanol level (CMO:0000535)	11	8436674	53436674	Rat

Markers in Region

PMC200946P1

Rat Assembly	Chr	Position (strand)	Source	JBrowse
Cytogenetic Map	5	q36	UniSTS
Cytogenetic Map	11	q11	UniSTS

RH130478

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	11	23,881,659 - 23,882,218 (+)	MAPPER	mRatBN7.2
Rnor_6.0	11	24,286,872 - 24,287,430	NCBI	Rnor6.0
Rnor_5.0	11	27,914,868 - 27,915,426	UniSTS	Rnor5.0
RGSC_v3.4	11	24,316,811 - 24,317,369	UniSTS	RGSC3.4
Celera	11	23,720,852 - 23,721,410	UniSTS
RH 3.4 Map	11	102.1	UniSTS
Cytogenetic Map	11	q11	UniSTS

RH143804

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	11	23,885,690 - 23,885,938 (+)	MAPPER	mRatBN7.2
Rnor_6.0	11	24,290,903 - 24,291,150	NCBI	Rnor6.0
Rnor_5.0	11	27,918,899 - 27,919,145	UniSTS	Rnor5.0
RGSC_v3.4	11	24,320,842 - 24,321,087	UniSTS	RGSC3.4
Celera	11	23,724,883 - 23,725,130	UniSTS
RH 3.4 Map	11	142.28	UniSTS
Cytogenetic Map	11	q11	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001428996	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001428997	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_053602	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008768603	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017598085	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017598086	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC110471	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC059121	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473989	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ212150	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ214305	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ216982	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ217271	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ217448	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ224472	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ228382	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000011	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M73030	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X54510	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000002116 ⟹ ENSRNOP00000002116

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	11	23,881,592 - 23,889,119 (-)	Ensembl
Rnor_6.0 Ensembl	11	24,286,787 - 24,294,179 (-)	Ensembl

RefSeq Acc Id:

NM_053602 ⟹ NP_446054

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	11	37,368,047 - 37,375,101 (-)	NCBI
mRatBN7.2	11	23,881,597 - 23,888,652 (-)	NCBI
Rnor_6.0	11	24,286,809 - 24,293,863 (-)	NCBI
Rnor_5.0	11	27,914,805 - 27,918,237 (-)	NCBI
RGSC_v3.4	11	24,316,748 - 24,323,800 (-)	RGD
Celera	11	23,720,789 - 23,727,843 (-)	RGD

Sequence:

show sequence

GCTTCCTGTCCGGTGAGCGTCGAACGACTGAAGCGGTGGCCCATAGTGCATTGCGATGGCGGGT
AGGCGTGTGTAGGCGGAGCCAGGGCCGGAAGTAGAACGGTGGCGGCGGCGGTGACTCTGGCAGC
TCGGGACTCAGTGCAAGTACCACAGACTCAACCATGACTGTTCAGAGGATCTTCAGGCTCTCCT
CTGTCCTTCGGTCAGCAGTCTCTGTGCATTTGAGGAGGAACATTGGTGTTACAGCTGTGGCGTT
TAATAAGGAACTTGATCCTGTACAGAAACTCTTCTTGGACAAGATAAGAGAGTACAAAGCAAAG
CGACTGGCGTCTGGAGGACCTGTTGATACTGGCCCAGAATATCAGCAAGAGGTGGACAGAGAGC
TTTTTAAGCTTAAACAAATGTATGGTAAAGGAGAGATGGATAAGTTTCCTACCTTCAATTTTGA
GGATCCCAAATTTGAAGTCCTCGACAAACCCCAGTCCTGAGGAACATACAAACCATGTGGTAAT
TTGTCATGACTTAGTTGTACAATTAATCTAAAAAATTCAAATAAACATTCACTTCACAG

hide sequence

RefSeq Acc Id:

XM_008768603 ⟹ XP_008766825

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	11	37,368,045 - 37,375,097 (-)	NCBI
mRatBN7.2	11	23,881,594 - 23,888,706 (-)	NCBI
Rnor_6.0	11	24,286,806 - 24,293,845 (-)	NCBI

Sequence:

show sequence

GTCGAACGACTGAAGCGGTGGCCCATAGTGCATTGCGATGGCGGGTAGGCGTGTGTAGGCGGAG
CCAGGGCCGGAAGTAGAACGGTGGCGGCGGCGGTGACTCTGGCAGCTCGGGACTCAGTGCAAGA
CTCAACCATGACTGTTCAGAGGATCTTCAGGCTCTCCTCTGTCCTTCGGTCAGCAGTCTCTGTG
CATTTGAGGAGGAACATTGGTGTTACAGCTGTGGCGTTTAATAAGGAACTTGATCCTGTACAGA
AACTCTTCTTGGACAAGATAAGAGAGTACAAAGCAAAGCGACTGGCGTCTGGAGGACCTGTTGA
TACTGGCCCAGAATATCAGCAAGAGGTGGACAGAGAGCTTTTTAAGCTTAAACAAATGTATGGT
AAAGGAGAGATGGATAAGTTTCCTACCTTCAATTTTGAGGATCCCAAATTTGAAGTCCTCGACA
AACCCCAGTCCTGAGGAACATACAAACCATGTGGTAATTTGTCATGACTTAGTTGTACAATTAA
TCTAAAAAATTCAAATAAACATTCACTTCACAGTTC

hide sequence

RefSeq Acc Id:

XM_017598085 ⟹ XP_017453574

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	11	37,368,045 - 37,375,721 (-)	NCBI
mRatBN7.2	11	23,881,595 - 23,888,777 (-)	NCBI
Rnor_6.0	11	24,286,806 - 24,293,924 (-)	NCBI

Sequence:

show sequence

CCTCCTCCTGTTTGGCTTCTGTCTCACCTAGAGGCGTCCGGTCGCAGACTCTCTTCGAGGCGCT
TCCTGTCCGTACCACAGACTCAACCATGACTGTTCAGAGGATCTTCAGGCTCTCCTCTGTCCTT
CGGTCAGCAGTCTCTGTGCATTTGAGGAGGAACATTGGTGTTACAGCTGTGGCGTTTAATAAGG
AACTTGATCCTGTACAGAAACTCTTCTTGGACAAGATAAGAGAGTACAAAGCAAAGCGACTGGC
GTCTGGAGGACCTGTTGATACTGGCCCAGAATATCAGCAAGAGGTGGACAGAGAGCTTTTTAAG
CTTAAACAAATGTATGGTAAAGGAGAGATGGATAAGTTTCCTACCTTCAATTTTGAGGATCCCA
AATTTGAAGTCCTCGACAAACCCCAGTCCTGAGGAACATACAAACCATGTGGTAATTTGTCATG
ACTTAGTTGTACAATTAATCTAAAAAATTCAAATAAACATTCACTTCACAGTTC

hide sequence

RefSeq Acc Id:

XM_017598086 ⟹ XP_017453575

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	11	37,368,045 - 37,375,267 (-)	NCBI
mRatBN7.2	11	23,881,594 - 23,888,699 (-)	NCBI
Rnor_6.0	11	24,286,806 - 24,293,920 (-)	NCBI

Sequence:

show sequence

CTCCTGTTTGGCTTCTGTCTCACCTAGAGGCGTCCGGTCGCAGACTCTCTTCGAGGCGCTTCCT
GTCCGACTCAACCATGACTGTTCAGAGGATCTTCAGGCTCTCCTCTGTCCTTCGGTCAGCAGTC
TCTGTGCATTTGAGGAGGAACATTGGTGTTACAGCTGTGGCGTTTAATAAGGAACTTGATCCTG
TACAGAAACTCTTCTTGGACAAGATAAGAGAGTACAAAGCAAAGCGACTGGCGTCTGGAGGACC
TGTTGATACTGGCCCAGAATATCAGCAAGAGGTGGACAGAGAGCTTTTTAAGCTTAAACAAATG
TATGGTAAAGGAGAGATGGATAAGTTTCCTACCTTCAATTTTGAGGATCCCAAATTTGAAGTCC
TCGACAAACCCCAGTCCTGAGGAACATACAAACCATGTGGTAATTTGTCATGACTTAGTTGTAC
AATTAATCTAAAAAATTCAAATAAACATTCACTTCACAGTTC

hide sequence

Protein Sequences


Protein RefSeqs	NP_001415925	(Get FASTA)	NCBI Sequence Viewer
	NP_001415926	(Get FASTA)	NCBI Sequence Viewer
	NP_446054	(Get FASTA)	NCBI Sequence Viewer
	XP_008766825	(Get FASTA)	NCBI Sequence Viewer
	XP_017453574	(Get FASTA)	NCBI Sequence Viewer
	XP_017453575	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA40954	(Get FASTA)	NCBI Sequence Viewer
	AAH59121	(Get FASTA)	NCBI Sequence Viewer
	CAA38369	(Get FASTA)	NCBI Sequence Viewer
	EDM10624	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000002116
GenBank Protein	P21571	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_446054 ⟸ NM_053602
- Peptide Label:	precursor
- UniProtKB:	P21571 (UniProtKB/Swiss-Prot), A6JL59 (UniProtKB/TrEMBL)
- Sequence:	show sequence MTVQRIFRLSSVLRSAVSVHLRRNIGVTAVAFNKELDPVQKLFLDKIREYKAKRLASGGPVDTG PEYQQEVDRELFKLKQMYGKGEMDKFPTFNFEDPKFEVLDKPQS hide sequence

RefSeq Acc Id:	XP_008766825 ⟸ XM_008768603
- Peptide Label:	isoform X2
- Sequence:	show sequence MTVQRIFRLSSVLRSAVSVHLRRNIGVTAVAFNKELDPVQKLFLDKIREYKAKRLASGGPVDTG PEYQQEVDRELFKLKQMYGKGEMDKFPTFNFEDPKFEVLDKPQS hide sequence

RefSeq Acc Id:	XP_017453574 ⟸ XM_017598085
- Peptide Label:	isoform X2
- Sequence:	show sequence MTVQRIFRLSSVLRSAVSVHLRRNIGVTAVAFNKELDPVQKLFLDKIREYKAKRLASGGPVDTG PEYQQEVDRELFKLKQMYGKGEMDKFPTFNFEDPKFEVLDKPQS hide sequence

RefSeq Acc Id:	XP_017453575 ⟸ XM_017598086
- Peptide Label:	isoform X1
- Sequence:	show sequence MTVQRIFRLSSVLRSAVSVHLRRNIGVTAVAFNKELDPVQKLFLDKIREYKAKRLASGGPVDTG PEYQQEVDRELFKLKQMYGKGEMDKFPTFNFEDPKFEVLDKPQS hide sequence

Ensembl Acc Id:

ENSRNOP00000002116 ⟸ ENSRNOT00000002116

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P21571-F1-model_v2	AlphaFold	P21571	1-108	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13698014

Promoter ID:

EPDNEW_R8539

Type:

multiple initiation site

Name:

Atp5pf_1

Description:

ATP synthase peripheral stalk subunit F6

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	11	24,293,767 - 24,293,827	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:621376	AgrOrtholog
BioCyc Gene	G2FUF-22082	BioCyc
BioCyc Pathway	PWY-7980 [ATP biosynthesis]	BioCyc
BioCyc Pathway Image	PWY-7980	BioCyc
Ensembl Genes	ENSRNOG00000001551	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000002116	ENTREZGENE
Gene3D-CATH	1.10.246.110	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:6919556	IMAGE-MGC_LOAD
InterPro	ATP_synth_f6_mt	UniProtKB/Swiss-Prot
	ATP_synth_f6_sf_mt	UniProtKB/Swiss-Prot
KEGG Report	rno:94271	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:72739	IMAGE-MGC_LOAD
NCBI Gene	94271	ENTREZGENE
PANTHER	ATP SYNTHASE-COUPLING FACTOR 6, MITOCHONDRIAL	UniProtKB/Swiss-Prot
	PTHR12441	UniProtKB/Swiss-Prot
Pfam	ATP-synt_F6	UniProtKB/Swiss-Prot
PhenoGen	Atp5pf	PhenoGen
PIRSF	ATP_synthase_coupling_factor_6	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000001551	RatGTEx
Superfamily-SCOP	SSF111357	UniProtKB/Swiss-Prot
UniProt	A0A8L2Q0A6_RAT	UniProtKB/TrEMBL
	A6JL59	ENTREZGENE, UniProtKB/TrEMBL
	ATP5J_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2021-03-09	Atp5pf	ATP synthase peripheral stalk subunit F6	LOC102551946	uncharacterized LOC102551946	Data merged from RGD:7542027	737654	PROVISIONAL
2017-12-01	Atp5pf	ATP synthase peripheral stalk subunit F6	Atp5j	ATP synthase, H+ transporting, mitochondrial Fo complex, subunit F6	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2013-12-17	LOC102551946	uncharacterized LOC102551946			Symbol and Name status set to provisional	70820	PROVISIONAL
2011-12-01	Atp5j	ATP synthase, H+ transporting, mitochondrial Fo complex, subunit F6	Atp5j	ATP synthase, H+ transporting, mitochondrial F0 complex, subunit F6	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-12-14	Atp5j	ATP synthase, H+ transporting, mitochondrial F0 complex, subunit F6			Symbol and Name status set to approved	1299863	APPROVED
2002-08-07	Atp5j	ATP synthase, H+ transporting, mitochondrial F0 complex, subunit F6			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)

BioCyc Pathways

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)

BioCyc Pathways