Arf4 (ADP-ribosylation factor 4) - Rat Genome Database

Name: Arf4
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

Advanced Search (OLGA)

Gene: Arf4 (ADP-ribosylation factor 4) Rattus norvegicus

Analyze

Symbol:

Arf4

Name:

ADP-ribosylation factor 4

RGD ID:

621275

Description:

Predicted to enable several functions, including GTP binding activity; NAD+-protein-arginine ADP-ribosyltransferase activity; and epidermal growth factor receptor binding activity. Involved in epidermal growth factor receptor signaling pathway and response to axon injury. Predicted to be located in several cellular components, including Golgi membrane; dendritic spine; and ruffle membrane. Predicted to be active in cytoplasm; glutamatergic synapse; and plasma membrane. Orthologous to human ARF4 (ADP ribosylation factor 4); INTERACTS WITH (+)-schisandrin B; 17alpha-ethynylestradiol; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	ARF4 (ADP ribosylation factor 4)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Arf4 (ADP-ribosylation factor 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Arf4 (ADP ribosylation factor 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	ARF4 (ADP ribosylation factor 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	ARF4 (ADP ribosylation factor 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Arf4 (ADP ribosylation factor 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	ARF4 (ADP ribosylation factor 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	ARF4 (ADP ribosylation factor 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Arf4 (ADP ribosylation factor 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	ARF5 (ADP ribosylation factor 5)	HGNC	OrthoDB
Homo sapiens (human):	LIMK2 (LIM domain kinase 2)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	ARF4 (ADP ribosylation factor 4)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Arf4 (ADP-ribosylation factor 4)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Arf102F	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	arf-3	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	arf4	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	16	1,903,238 - 1,920,012 (+)	NCBI		GRCr8
mRatBN7.2	16	1,896,692 - 1,913,267 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	16	1,896,546 - 1,913,261 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	16	1,903,319 - 1,919,895 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	16	3,049,015 - 3,065,591 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	16	1,909,772 - 1,926,348 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	16	2,338,333 - 2,354,909 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	16	2,338,333 - 2,354,909 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	16	2,313,358 - 2,330,255 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	16	1,955,745 - 1,972,321 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	16	1,955,744 - 1,972,321 (+)	NCBI
Celera	16	1,865,523 - 1,882,099 (+)	NCBI		Celera
Cytogenetic Map	16	p16	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Pyruvate Dehydrogenase E1-Beta Deficiency (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (EXP,ISO)

17beta-estradiol (ISO)

17beta-hydroxy-5alpha-androstan-3-one (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2-nitrotoluene (EXP)

6-propyl-2-thiouracil (EXP)

acrylamide (EXP)

ammonium chloride (EXP)

Aroclor 1254 (ISO)

azoxystrobin (ISO)

bisphenol A (EXP,ISO)

Bisphenol B (ISO)

bisphenol F (ISO)

bleomycin A5 (ISO)

bromochloroacetic acid (EXP)

cadmium dichloride (ISO)

carbon nanotube (ISO)

CGP 52608 (ISO)

chloropicrin (ISO)

chlorpyrifos (ISO)

clobetasol (ISO)

cocaine (EXP)

Cuprizon (EXP)

cyclosporin A (ISO)

DDE (ISO)

Dibutyl phosphate (ISO)

dibutyl phthalate (EXP,ISO)

dichlorine (EXP)

dioxygen (ISO)

diuron (ISO)

epoxiconazole (ISO)

ethanol (ISO)

fipronil (EXP)

flutamide (EXP)

folic acid (ISO)

genistein (ISO)

gentamycin (EXP)

glafenine (EXP)

glyphosate (ISO)

indirubin (ISO)

inulin (ISO)

isoprenaline (ISO)

ivermectin (ISO)

mercury atom (ISO)

mercury(0) (ISO)

methylmercury chloride (ISO)

ozone (EXP)

paracetamol (EXP,ISO)

perfluorooctane-1-sulfonic acid (ISO)

phenobarbital (ISO)

picoxystrobin (ISO)

propiconazole (ISO)

resveratrol (ISO)

rotenone (ISO)

silver atom (ISO)

silver(0) (ISO)

sodium arsenite (ISO)

Soman (EXP)

tamoxifen (ISO)

tetrachloromethane (EXP,ISO)

thapsigargin (EXP,ISO)

thiram (ISO)

titanium dioxide (ISO)

tolcapone (EXP)

trichloroethene (EXP)

triphenyl phosphate (ISO)

triptonide (ISO)

tunicamycin (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

apical protein localization (IEA,ISO)

cell migration (IEA,ISO)

dendritic spine development (IEA,ISO)

epidermal growth factor receptor signaling pathway (IDA)

establishment or maintenance of epithelial cell apical/basal polarity (IEA,ISO)

intracellular protein transport (IBA)

learning (IEA,ISO)

negative regulation of apoptotic process (IEA,ISO)

positive regulation of transcription by RNA polymerase II (IEA,ISO)

protein localization to cilium (IEA,ISO)

protein transport (IEA)

regulation of cilium assembly (IEA,ISO,ISS)

regulation of postsynapse organization (IEA,ISO)

regulation of reactive oxygen species metabolic process (IEA,ISO)

regulation of synapse organization (ISO)

response to axon injury (IEP)

retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum (IEA,ISO)

vesicle-mediated transport (IBA)

Cellular Component

cytoplasm (ISO)

cytosol (IEA,ISO)

dendritic spine (IEA,ISO)

glutamatergic synapse (IEA,ISO)

Golgi apparatus (ISO)

Golgi membrane (IEA,ISO,ISS)

plasma membrane (IBA,ISO)

ruffle membrane (IEA,ISO)

Molecular Function

epidermal growth factor receptor binding (IEA,ISO)

GTP binding (IEA,ISO)

GTPase activity (IEA)

NAD+-protein-arginine ADP-ribosyltransferase activity (IEA,ISO)

phospholipase D activator activity (IEA,ISO)

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	P-CIP1, a novel protein that interacts with the cytosolic domain of peptidylglycine alpha-amidating monooxygenase, is associated with endosomes.	Chen L, etal., J Biol Chem 1998 Dec 11;273(50):33524-32.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	ADP-ribosylation factor 4 small GTPase mediates epidermal growth factor receptor-dependent phospholipase D2 activation.	Kim SW, etal., J Biol Chem 2003 Jan 24;278(4):2661-8.
4.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
5.	Regulation of ADP-ribosylation factor (ARF) expression. Cross-species conservation of the developmental and tissue-specific alternative polyadenylation of ARF 4 mRNA.	Mishima K, etal., J Biol Chem 1992 Nov 25;267(33):24109-16.
6.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
7.	Interspecies relationships among ADP-ribosylation factors (ARFs): evidence of evolutionary pressure to maintain individual identities.	Price SR, etal., Mol Cell Biochem 1996 Jun 7;159(1):15-23.
8.	GOA pipeline	RGD automated data pipeline
9.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
10.	Comprehensive gene review and curation	RGD comprehensive gene curation
11.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
12.	Localization of mRNAs for six ARFs (ADP-ribosylation factors) in the brain of developing and adult rats and changes in the expression in the hypoglossal nucleus after its axotomy.	Suzuki I, etal., Brain Res Mol Brain Res. 2001 Mar 31;88(1-2):124-34.

Additional References at PubMed

PMID:1899243	PMID:8947846	PMID:15489334	PMID:19041174	PMID:19946888	PMID:20458337	PMID:20921225	PMID:21700703	PMID:22004728	PMID:23050017	PMID:23376485	PMID:23979707
PMID:24586199	PMID:24768165	PMID:29476059	PMID:33450132

Genomics

Comparative Map Data

Arf4
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	16	1,903,238 - 1,920,012 (+)	NCBI		GRCr8
mRatBN7.2	16	1,896,692 - 1,913,267 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	16	1,896,546 - 1,913,261 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	16	1,903,319 - 1,919,895 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	16	3,049,015 - 3,065,591 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	16	1,909,772 - 1,926,348 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	16	2,338,333 - 2,354,909 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	16	2,338,333 - 2,354,909 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	16	2,313,358 - 2,330,255 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	16	1,955,745 - 1,972,321 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	16	1,955,744 - 1,972,321 (+)	NCBI
Celera	16	1,865,523 - 1,882,099 (+)	NCBI		Celera
Cytogenetic Map	16	p16	NCBI

ARF4
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	3	57,571,363 - 57,597,344 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	3	57,571,363 - 57,598,220 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	3	57,557,090 - 57,583,071 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	3	57,532,130 - 57,558,118 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	3	57,532,129 - 57,558,118	NCBI
Celera	3	57,570,930 - 57,583,662 (-)	NCBI		Celera
Cytogenetic Map	3	p14.3	NCBI
HuRef	3	57,654,526 - 57,680,689 (-)	NCBI		HuRef
CHM1_1	3	57,507,192 - 57,533,313 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	3	57,611,733 - 57,637,720 (-)	NCBI		T2T-CHM13v2.0

Arf4
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	14	26,359,289 - 26,377,997 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	14	26,359,229 - 26,386,239 (+)	Ensembl		GRCm39 Ensembl
GRCm38	14	26,638,134 - 26,656,842 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	14	26,638,074 - 26,665,084 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	14	27,457,683 - 27,476,744 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	14	25,471,381 - 25,490,442 (+)	NCBI		MGSCv36	mm8
Celera	14	22,881,059 - 22,899,926 (+)	NCBI		Celera
Cytogenetic Map	14	A3	NCBI
cM Map	14	16.09	NCBI

Arf4
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955430	7,288,386 - 7,319,449 (-)	NCBI	ChiLan1.0	ChiLan1.0

ARF4
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	2	57,539,666 - 57,566,805 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	3	57,544,439 - 57,571,074 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	3	57,504,701 - 57,530,545 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	3	58,710,897 - 58,736,315 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	3	58,710,897 - 58,736,816 (-)	Ensembl	panpan1.1		panPan2

ARF4
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	20	32,849,725 - 32,871,127 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	20	32,849,757 - 32,870,721 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	20	32,777,874 - 32,799,283 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	20	33,122,306 - 33,143,713 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	20	33,122,415 - 33,159,515 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	20	32,578,184 - 32,599,566 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	20	32,936,246 - 32,957,656 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	20	33,106,867 - 33,128,487 (+)	NCBI		UU_Cfam_GSD_1.0

Arf4
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	174,768,725 - 174,788,135 (-)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936473	7,907,277 - 7,926,816 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

ARF4
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	13	39,409,376 - 39,430,129 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	13	39,410,094 - 39,430,177 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	13	43,338,149 - 43,361,729 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

ARF4
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	22	18,879,064 - 18,904,234 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	22	18,877,715 - 18,903,891 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666041	147,967,881 - 147,993,267 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Arf4
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624821	346,579 - 362,021 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Arf4
43 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	492
Count of miRNA genes:	236
Interacting mature miRNAs:	284
Transcripts:	ENSRNOT00000017692
Prediction methods:	Microtar, Miranda, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
631561	Hcuc2	Hepatic copper content QTL 2	2.8		liver copper amount (VT:0003065)	liver total copper weight (CMO:0001507)	16	1	39533949	Rat
1582235	Insul8	Insulin level QTL 8	3.3	0.0063	blood insulin amount (VT:0001560)	calculated serum insulin level (CMO:0000359)	16	1	26727669	Rat
1549842	Bp248	Blood pressure QTL 248		0.01	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	16	380245	2995463	Rat
2307172	Activ4	Activity QTL 4	3.71	0.00023	locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	16	1	33418960	Rat
1354584	Despr6	Despair related QTL 6	3.1	0.0067	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	16	1	39533930	Rat
1357403	Slep4	Serum leptin concentration QTL 4	3.91		blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	16	1	9639137	Rat
2302380	Slep6	Serum leptin concentration QTL 6	3.36		blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	16	1	32139025	Rat
12903952	Cm117	Cardiac mass QTL 117		0.001	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	16	832380	2995225	Rat
9590151	Scort8	Serum corticosterone level QTL 8	8.45	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	16	1	30836262	Rat
1354625	Despr7	Despair related QTL 7	3.16	0.016	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	16	1	44977551	Rat
12903954	Bw186	Body weight QTL 186		0.011	body mass (VT:0001259)	body weight (CMO:0000012)	16	832380	2995225	Rat
12903955	Kidm69	Kidney mass QTL 69		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	16	832380	4227609	Rat
631830	Alc7	Alcohol consumption QTL 7	2.9		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	16	1	26727669	Rat
7411664	Foco30	Food consumption QTL 30	11	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	16	1	44588133	Rat
1600378	Arunc4	Aerobic running capacity QTL 4		0.03	exercise endurance trait (VT:0002332)	maximum distance run on treadmill (CMO:0001406)	16	380245	80345693	Rat
1600369	Hcas8	Hepatocarcinoma susceptibility QTL 8			liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	16	1	22477621	Rat
12903278	Am16	Aortic mass QTL 16		0.019	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	16	832380	2995225	Rat
12903279	Cm115	Cardiac mass QTL 115		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	16	832380	2995225	Rat
2325838	Bp347	Blood pressure QTL 347		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	16	1	3080679	Rat
2303566	Bw90	Body weight QTL 90	2		body mass (VT:0001259)	body weight (CMO:0000012)	16	1	39533930	Rat
2312663	Slep9	Serum leptin concentration QTL 9		0.001	blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	16	832236	59492508	Rat
12903281	Cm116	Cardiac mass QTL 116		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	16	832380	2995225	Rat
2312660	Bw95	Body weight QTL 95		0.05	inguinal fat pad mass (VT:0010424)	inguinal fat pad weight to body weight ratio (CMO:0001253)	16	832236	59492508	Rat
2312666	Insul16	Insulin level QTL 16		0.01	blood insulin amount (VT:0001560)	serum insulin level (CMO:0000358)	16	832236	59492508	Rat
634355	Rends4	Renal damage susceptibility QTL 4		0.05	kidney blood vessel morphology trait (VT:0000530)	organ lesion measurement (CMO:0000677)	16	1	26727669	Rat
2293343	Glom16	Glomerulus QTL 16	7.4		kidney glomerulus integrity trait (VT:0010546)	kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269)	16	832236	46053497	Rat
6903319	Bw114	Body weight QTL 114	2.7	0.0037	body mass (VT:0001259)	body weight (CMO:0000012)	16	1	43534949	Rat
2312669	Stl23	Serum triglyceride level QTL 23		0.01	blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	16	832236	59492508	Rat
2301404	Bp321	Blood pressure QTL 321		0.05	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	16	832380	2995225	Rat

Markers in Region

RH125729

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	16	1,912,966 - 1,913,213 (+)	MAPPER	mRatBN7.2
Rnor_6.0	16	2,354,609 - 2,354,855	NCBI	Rnor6.0
Rnor_5.0	16	2,329,955 - 2,330,201	UniSTS	Rnor5.0
RGSC_v3.4	16	1,972,021 - 1,972,267	UniSTS	RGSC3.4
Celera	16	1,881,799 - 1,882,045	UniSTS
Cytogenetic Map	16	p16	UniSTS

RH129316

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	16	1,912,978 - 1,913,143 (+)	MAPPER	mRatBN7.2
Rnor_6.0	16	2,354,621 - 2,354,785	NCBI	Rnor6.0
Rnor_5.0	16	2,329,967 - 2,330,131	UniSTS	Rnor5.0
RGSC_v3.4	16	1,972,033 - 1,972,197	UniSTS	RGSC3.4
Celera	16	1,881,811 - 1,881,975	UniSTS
RH 3.4 Map	16	16.3	UniSTS
Cytogenetic Map	16	p16	UniSTS

RH129652

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	16	1,913,052 - 1,913,245 (+)	MAPPER	mRatBN7.2
Rnor_6.0	16	2,354,695 - 2,354,887	NCBI	Rnor6.0
Rnor_5.0	16	2,330,041 - 2,330,233	UniSTS	Rnor5.0
RGSC_v3.4	16	1,972,107 - 1,972,299	UniSTS	RGSC3.4
Celera	16	1,881,885 - 1,882,077	UniSTS
RH 3.4 Map	16	16.3	UniSTS
Cytogenetic Map	16	p16	UniSTS

AW533731

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	16	1,896,445 - 1,896,636 (+)	MAPPER	mRatBN7.2
Rnor_6.0	16	2,338,087 - 2,338,277	NCBI	Rnor6.0
Rnor_5.0	16	2,313,112 - 2,313,302	UniSTS	Rnor5.0
RGSC_v3.4	16	1,955,499 - 1,955,689	UniSTS	RGSC3.4
Celera	16	1,865,277 - 1,865,467	UniSTS
Cytogenetic Map	16	p16	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

alimentary part of gastrointestinal system

circulatory system

endocrine system

exocrine system

hemolymphoid system

hepatobiliary system

integumental system

musculoskeletal system

nervous system

renal system

reproductive system

respiratory system

appendage

High

Medium

141

227

147

250

115

145

Low

Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_024151	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063275756	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC118794	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC063167	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474067	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ213125	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ213804	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ226707	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ228422	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ234083	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ234248	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000016	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	L12383	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M86705	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000017692 ⟹ ENSRNOP00000017692

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	16	1,896,626 - 1,913,261 (+)	Ensembl
Rnor_6.0 Ensembl	16	2,338,333 - 2,354,909 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000104253 ⟹ ENSRNOP00000077700

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	16	1,896,546 - 1,911,447 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000117367 ⟹ ENSRNOP00000094601

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	16	1,896,908 - 1,913,261 (+)	Ensembl

RefSeq Acc Id:

NM_024151 ⟹ NP_077065

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	16	1,903,436 - 1,920,012 (+)	NCBI
mRatBN7.2	16	1,896,692 - 1,913,267 (+)	NCBI
Rnor_6.0	16	2,338,333 - 2,354,909 (+)	NCBI
Rnor_5.0	16	2,313,358 - 2,330,255 (+)	NCBI
RGSC_v3.4	16	1,955,745 - 1,972,321 (+)	RGD
Celera	16	1,865,523 - 1,882,099 (+)	RGD

Sequence:

show sequence

GACAGCCGAACACTTAACGCCGCGCCGGAGCCACCGCACCAGTCGCCGAGCAGGTCCCGGTCCC
GCTACGTCGTGTCCCGCGGCTCTGCCGACACTCCGGCCTGAGAGACGGGTCTTCAGCCTTTTCT
CTTCCGCCCACTCAGTTGTGAGCCGGAACCGTGAAGGCCCGAGGGCGGACCAGACCCTCTCTTT
TTTTGACCATCAAGTGCCACCACCGCTATGGGCCTCACCATCTCCTCTCTCTTCTCGCGCCTCT
TCGGCAAGAAGCAGATGCGCATTTTGATGGTTGGATTGGATGCTGCGGGCAAGACGACGATTCT
GTATAAACTGAAACTAGGGGAGATAGTCACCACCATTCCTACCATTGGTTTTAATGTGGAAACA
GTAGAATATAAGAACATTTGTTTCACAGTTTGGGATGTTGGTGGTCAAGATAAAATTAGGCCTC
TCTGGAGGCATTACTTCCAGAATACCCAGGGTCTCATTTTCGTGGTAGATAGCAATGATCGTGA
AAGAATTCAGGAAGGAGCAGCCGTGCTGCAGAAAATGCTTCTGGAAGATGAGCTGCAGGATGCT
GTGCTGCTGCTTTTTGCCAACAAACAGGATTTGCCAAATGCTATGGCCATCAGTGAGATGACAG
ACAAGTTAGGTCTTCAGTCTCTCCGGAACAGAACATGGTATGTCCAAGCCACTTGTGCTACACA
AGGAACTGGTCTGTACGAGGGGCTGGATTGGCTGTCAAATGAACTTTCAAAACGCTAAATGAAA
CTGGATATCTAACCAAGGACATGTTTGATAGAATTGGTCTAGGCTTGTTACAACAAAATTAGTT
TGCATCTTGGTTATTAAAGGATATCTGAGACGGTTTGGGCAGAAATTACAGCATTTAAAACTTG
TTTTGTTGCCAATTATTGTTTACCAAGAACAATGTTGCTGTTTAGCAATATGCTTGGGTTTAAG
AGAAATTCTCCTTGGGGGAAAAAAGTGTCCATTATTATACTTCCCCTGAACCTGAATGCCTGGA
TAGATAGCGATTGTGACACCCTTAAATAAATCTGTTTTGAGTGTTTTTTGAGCCCACACCAATA
ATGTTTTAAAGTTACCCCCTTGGAACTCACTGATACCTATCATTCCTCGGGCAGTCTGCTGAGT
TAAAAATGTAGCATTCCATTTGTATTTATTTCCCCCTTGCCAAAAAGATTTTTCTAATAATGCT
TGTACTGGCCAGGGATGAGCTCCACAACACTATTCAGTTTTCTTGTACTGAGGATTCCCCCACC
TCCCTCACATTATTGACTCCTGGCTTCTATCAGCCAAACTTTGATGTAGTTTGGATTTGATAGC
TAATTCTGGGCTGGTTTCAAAGAGTTCATATTGAGATAACTTTTAATACTCAGCAAATTGTCTT
CCTTTATATTATCTTTTTTATGTTGCATGTTGCCTTTTGGAATCAGCCTGACTCTTTGCCCAGC
ATATGATAGTTCTGCTGGTATTTTACTGTTTACTGATGAACATATCTTCATTAAGAATTTTTTG
AAAACTCATCAAATTCAATGAATAAGTTTTCTTCATAACCCATTTGGAATTATTCCTAATAAAA
TGATTTTT

hide sequence

RefSeq Acc Id:

XM_063275756 ⟹ XP_063131826

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	16	1,903,238 - 1,919,475 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_077065	(Get FASTA)	NCBI Sequence Viewer
	XP_063131826	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA40688	(Get FASTA)	NCBI Sequence Viewer
	AAH63167	(Get FASTA)	NCBI Sequence Viewer
	EDL75072	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000017692.2
	ENSRNOP00000077700.1
	ENSRNOP00000094601.1
	ENSRNOP00055029876
	ENSRNOP00060018020
	ENSRNOP00065018252
GenBank Protein	P61751	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_077065 ⟸ NM_024151
- UniProtKB:	P36403 (UniProtKB/Swiss-Prot), P61751 (UniProtKB/Swiss-Prot), A6KMJ6 (UniProtKB/TrEMBL), A0A8I6AL60 (UniProtKB/TrEMBL)
- Sequence:	show sequence MGLTISSLFSRLFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFT VWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERIQEGAAVLQKMLLEDELQDAVLLLFANKQ DLPNAMAISEMTDKLGLQSLRNRTWYVQATCATQGTGLYEGLDWLSNELSKR hide sequence

Ensembl Acc Id:

ENSRNOP00000017692 ⟸ ENSRNOT00000017692

Ensembl Acc Id:

ENSRNOP00000094601 ⟸ ENSRNOT00000117367

Ensembl Acc Id:

ENSRNOP00000077700 ⟸ ENSRNOT00000104253

RefSeq Acc Id:	XP_063131826 ⟸ XM_063275756
- Peptide Label:	isoform X1
- UniProtKB:	A0A8I5ZJK0 (UniProtKB/TrEMBL)

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P61751-F1-model_v2	AlphaFold	P61751	1-180	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13699895

Promoter ID:

EPDNEW_R10419

Type:

initiation region

Name:

Arf4_1

Description:

ADP-ribosylation factor 4

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	16	2,338,372 - 2,338,432	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:621275	AgrOrtholog
BioCyc Gene	G2FUF-12252	BioCyc
Ensembl Genes	ENSRNOG00000012623	Ensembl, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ENSRNOG00055021532	UniProtKB/Swiss-Prot
	ENSRNOG00060013369	UniProtKB/Swiss-Prot
	ENSRNOG00065014219	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000017692.6	UniProtKB/Swiss-Prot
	ENSRNOT00000104253.1	UniProtKB/TrEMBL
	ENSRNOT00000117367.1	UniProtKB/TrEMBL
	ENSRNOT00055036788	UniProtKB/Swiss-Prot
	ENSRNOT00060022774	UniProtKB/Swiss-Prot
	ENSRNOT00065023462	UniProtKB/Swiss-Prot
Gene3D-CATH	3.40.50.300	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:6921397	IMAGE-MGC_LOAD
InterPro	Arf1-5-like	UniProtKB/TrEMBL, UniProtKB/Swiss-Prot
	P-loop_NTPase	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Small_GTP-bd_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Small_GTPase_ARF	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Small_GTPase_ARF/SAR	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:79120	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGC_CLONE	MGC:72808	IMAGE-MGC_LOAD
NCBI Gene	79120	ENTREZGENE
PANTHER	ADP-RIBOSYLATION FACTOR 4	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR11711	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Arf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PharmGKB	ARF4	RGD
PhenoGen	Arf4	PhenoGen
PRINTS	SAR1GTPBP	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	ARF	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000012623	RatGTEx
	ENSRNOG00055021532	RatGTEx
	ENSRNOG00060013369	RatGTEx
	ENSRNOG00065014219	RatGTEx
SMART	ARF	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	RAB	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SAR	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF52540	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A8I5ZJK0	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6AL60	ENTREZGENE, UniProtKB/TrEMBL
	A6KMJ6	ENTREZGENE, UniProtKB/TrEMBL
	ARF4_RAT	UniProtKB/Swiss-Prot
	P36403	ENTREZGENE
	P61751	ENTREZGENE
UniProt Secondary	P36403	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2004-09-10	Arf4	ADP-ribosylation factor 4			Symbol and Name status set to approved	1299863	APPROVED
2002-08-07	Arf4	ADP-ribosylation factor 4			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar