Hand1 (heart and neural crest derivatives expressed 1)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Hand1 (heart and neural crest derivatives expressed 1) Rattus norvegicus

Analyze

Symbol:

Hand1

Name:

heart and neural crest derivatives expressed 1

RGD ID:

621206

Description:

Predicted to enable several functions, including DNA-binding transcription factor activity, RNA polymerase II-specific; DNA-binding transcription factor binding activity; and protein homodimerization activity. Predicted to contribute to transcription cis-regulatory region binding activity. Predicted to be involved in cardiac chamber morphogenesis; in utero embryonic development; and regulation of DNA-templated transcription. Predicted to act upstream of or within several processes, including cartilage morphogenesis; circulatory system development; and regulation of transcription by RNA polymerase II. Located in nucleus. Orthologous to human HAND1 (heart and neural crest derivatives expressed 1); INTERACTS WITH (S)-nicotine; 2,2',4,4'-Tetrabromodiphenyl ether; all-trans-retinoic acid.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

eHand; extraembryonic tissues, heart, autonomic nervous system and neural crest derivatives-expressed protein 1; heart and neural crest derivatives expressed transcript 1; heart- and neural crest derivatives-expressed protein 1; MGC114332

RGD Orthologs

Alliance Genes

More Info

more info ...

Allele / Splice:

Hand1^m1Mcwi

Genetic Models:

BN-Hand1^m1Mcwi

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	10	42,006,646 - 42,009,213 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	42,006,651 - 42,009,213 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	46,669,274 - 46,671,841 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	46,159,536 - 46,162,103 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	41,663,162 - 41,665,729 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	43,250,729 - 43,253,296 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	43,250,745 - 43,253,296 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	43,050,068 - 43,052,635 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	43,423,366 - 43,425,933 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	10	43,436,993 - 43,439,556 (-)	NCBI
Celera	10	41,298,555 - 41,301,122 (-)	NCBI		Celera
Cytogenetic Map	10	q22	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Cardiomegaly (IEP,ISO)

familial adenomatous polyposis 1 (ISO)

genetic disease (ISO)

Hereditary Neoplastic Syndromes (ISO)

hypoplastic left heart syndrome (ISO)

Hypoplastic Left Heart Syndrome 1 (ISO)

Poisoning (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(S)-nicotine (EXP,ISO)

1,2-dichloroethane (ISO)

1,2-dimethylhydrazine (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (EXP)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

4,4'-sulfonyldiphenol (ISO)

5-fluorouracil (ISO)

alcohol (ISO)

all-trans-retinoic acid (EXP)

ammonium chloride (EXP)

arsenite(3-) (ISO)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

C60 fullerene (EXP)

cadmium atom (ISO)

cocaine (EXP)

curcumin (ISO)

cytarabine (ISO)

dimethyl sulfoxide (ISO)

dorsomorphin (ISO)

doxorubicin (ISO)

entinostat (ISO)

hydroquinone O-beta-D-glucopyranoside (ISO)

kojic acid (ISO)

leflunomide (ISO)

lipopolysaccharide (ISO)

mercury dibromide (ISO)

methylisothiazolinone (ISO)

methylmercury chloride (ISO)

nicotine (EXP,ISO)

Octicizer (ISO)

panobinostat (ISO)

pentachlorophenol (ISO)

phenylmercury acetate (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

SB 431542 (ISO)

sodium arsenite (ISO)

sunitinib (ISO)

tributylstannane (ISO)

trichloroethene (EXP,ISO)

triclosan (ISO)

triptonide (ISO)

valproic acid (ISO)

vorinostat (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

angiogenesis (ISO)

biological_process (ND)

blastocyst development (ISO)

cardiac left ventricle formation (ISO)

cardiac right ventricle formation (ISO)

cardiac septum morphogenesis (ISO)

cartilage morphogenesis (ISO)

cell differentiation (ISO)

determination of heart left/right asymmetry (ISO)

embryonic heart tube development (ISO)

embryonic heart tube formation (ISO)

heart development (IBA,ISO)

heart looping (ISO)

in utero embryonic development (ISO)

mesenchyme development (ISO)

mesoderm formation (ISO)

negative regulation of DNA-templated transcription (ISO)

negative regulation of transcription by RNA polymerase II (ISO)

odontogenesis of dentin-containing tooth (ISO)

positive regulation of transcription by RNA polymerase II (ISO)

regulation of transcription by RNA polymerase II (IBA)

trophectodermal cell differentiation (ISO)

trophoblast giant cell differentiation (ISO,ISS)

ventricular cardiac muscle tissue morphogenesis (ISO)

Cellular Component

cytoplasm (ISO)

nucleolus (ISO)

nucleoplasm (ISO)

nucleus (IDA,ISO)

RNA polymerase II transcription regulator complex (ISO)

Molecular Function

bHLH transcription factor binding (ISO)

DNA binding (ISO)

DNA-binding transcription activator activity, RNA polymerase II-specific (ISO)

DNA-binding transcription factor activity, RNA polymerase II-specific (IBA,ISO)

DNA-binding transcription repressor activity, RNA polymerase II-specific (ISO)

enzyme binding (ISO)

identical protein binding (ISO)

protein binding (ISO)

protein homodimerization activity (ISO)

RNA polymerase II cis-regulatory region sequence-specific DNA binding (ISO)

RNA polymerase II transcription regulatory region sequence-specific DNA binding (IBA)

RNA polymerase II-specific DNA-binding transcription factor binding (ISO)

sequence-specific DNA binding (ISO)

transcription cis-regulatory region binding (ISO)

transcription coregulator binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	The basic helix-loop-helix transcription factor Hand1 regulates mouse development as a homodimer.	Hu D, etal., Dev Biol. 2013 Oct 15;382(2):470-81. doi: 10.1016/j.ydbio.2013.07.025. Epub 2013 Aug 1.
4.	Regulation of dHAND protein expression by all-trans retinoic acid through ET-1/ETAR signaling in H9c2 cells.	Li W and Li Y, J Cell Biochem. 2006 Oct 1;99(2):478-84.
5.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
6.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
7.	GOA pipeline	RGD automated data pipeline
8.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
9.	Comprehensive gene review and curation	RGD comprehensive gene curation
10.	HAND1 and HAND2 are expressed in the adult-rodent heart and are modulated during cardiac hypertrophy.	Thattaliyath BD, etal., Biochem Biophys Res Commun 2002 Oct 4;297(4):870-5.

Additional References at PubMed

PMID:7814632	PMID:9500550	PMID:9500551	PMID:10924525	PMID:11076684	PMID:11802795	PMID:12070084	PMID:12477932	PMID:15073150	PMID:15509787	PMID:15576406	PMID:16043483
PMID:16759287	PMID:17764670	PMID:17891141	PMID:18276607	PMID:19144722	PMID:19170063	PMID:19586923

Genomics

Comparative Map Data

Hand1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	10	42,006,646 - 42,009,213 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	42,006,651 - 42,009,213 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	46,669,274 - 46,671,841 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	46,159,536 - 46,162,103 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	41,663,162 - 41,665,729 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	43,250,729 - 43,253,296 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	43,250,745 - 43,253,296 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	43,050,068 - 43,052,635 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	43,423,366 - 43,425,933 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	10	43,436,993 - 43,439,556 (-)	NCBI
Celera	10	41,298,555 - 41,301,122 (-)	NCBI		Celera
Cytogenetic Map	10	q22	NCBI

HAND1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	5	154,474,972 - 154,478,227 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	5	154,474,972 - 154,478,227 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	5	153,854,532 - 153,857,787 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	5	153,834,725 - 153,838,017 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	5	153,834,725 - 153,838,017	NCBI
Celera	5	149,930,197 - 149,933,489 (-)	NCBI		Celera
Cytogenetic Map	5	q33.2	NCBI
HuRef	5	148,995,253 - 148,998,545 (-)	NCBI		HuRef
CHM1_1	5	153,286,949 - 153,290,241 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	5	155,008,931 - 155,012,186 (-)	NCBI		T2T-CHM13v2.0

Hand1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	11	57,719,539 - 57,722,973 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	11	57,719,531 - 57,723,644 (-)	Ensembl		GRCm39 Ensembl
GRCm38	11	57,828,713 - 57,832,147 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	11	57,828,705 - 57,832,818 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	11	57,642,215 - 57,645,649 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	11	57,644,908 - 57,648,342 (-)	NCBI		MGSCv36	mm8
Celera	11	62,581,753 - 62,585,188 (-)	NCBI		Celera
Cytogenetic Map	11	B1.3	NCBI
cM Map	11	35.27	NCBI

Hand1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955408	8,848,559 - 8,851,994 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955408	8,848,723 - 8,851,804 (-)	NCBI	ChiLan1.0	ChiLan1.0

HAND1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	5	147,821,649 - 147,825,030 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	5	149,876,970 - 149,880,269 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	5	155,875,100 - 155,878,374 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	5	155,875,935 - 155,878,166 (-)	Ensembl	panpan1.1		panPan2

HAND1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	4	55,231,061 - 55,234,640 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	4	55,231,481 - 55,234,265 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	4	55,122,337 - 55,125,872 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	4	55,665,601 - 55,669,141 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	4	55,665,977 - 55,668,761 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	4	55,496,014 - 55,499,549 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	4	55,594,450 - 55,597,985 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	4	56,097,022 - 56,100,557 (+)	NCBI		UU_Cfam_GSD_1.0

Hand1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024407213	109,840,418 - 109,843,804 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936515	8,289,315 - 8,293,175 (+)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936515	8,289,764 - 8,292,937 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

HAND1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	16	68,677,963 - 68,683,342 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	16	68,679,977 - 68,683,346 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	16	74,589,577 - 74,592,407 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

HAND1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	23	56,928,164 - 56,935,675 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	23	56,928,676 - 56,931,785 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666034	20,731,670 - 20,734,953 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Hand1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624733	34,731,671 - 34,733,759 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624733	34,731,671 - 34,733,759 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Hand1
4 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	124
Count of miRNA genes:	109
Interacting mature miRNAs:	118
Transcripts:	ENSRNOT00000003486
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
7411611	Foco17	Food consumption QTL 17	18.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	10	1	42315980	Rat
70223	Bp57	Blood pressure QTL 57	5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	1	80676123	Rat
10401803	Kidm50	Kidney mass QTL 50			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	10	418344	45418344	Rat
631554	Bp133	Blood pressure QTL 133		0.005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	743364	63851208	Rat
2313064	Bmd71	Bone mineral density QTL 71	0.9	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	10	5387014	50387014	Rat
2313066	Bss63	Bone structure and strength QTL 63	1.4	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	10	5387014	50387014	Rat
2313081	Bss64	Bone structure and strength QTL 64	1.3	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	10	5387014	50387014	Rat
2313095	Bss62	Bone structure and strength QTL 62	1.5	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	10	5387014	50387014	Rat
2313104	Bss61	Bone structure and strength QTL 61	0.9	0.0001	tibia area (VT:1000281)	tibia midshaft cross-sectional area (CMO:0001717)	10	5387014	50387014	Rat
2298544	Neuinf9	Neuroinflammation QTL 9	4.6		nervous system integrity trait (VT:0010566)	spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126)	10	5801990	62146030	Rat
8662860	Vetf10	Vascular elastic tissue fragility QTL 10			artery integrity trait (VT:0010639)	number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562)	10	6154182	73453136	Rat
61427	Cia16	Collagen induced arthritis QTL 16	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	6357896	96121100	Rat
1578761	Stresp21	Stress response QTL 21	3.3		thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	10	6375746	51375746	Rat
2303118	Mamtr7	Mammary tumor resistance QTL 7		0.003	mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	10	9658275	104670812	Rat
9590310	Scort19	Serum corticosterone level QTL 19	6.3	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	11474010	56474010	Rat
9590268	Scort13	Serum corticosterone level QTL 13	3.26	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	11474010	56474010	Rat
9589136	Insul27	Insulin level QTL 27	10.46	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	10	11474010	56474010	Rat
2301967	Cm73	Cardiac mass QTL 73	4.55		heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	10	14487011	89062041	Rat
631268	Cia21	Collagen induced arthritis QTL 21	3.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	14487011	104060283	Rat
2316949	Gluco60	Glucose level QTL 60	3.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	10	14487011	107057807	Rat
1354587	Kidm21	Kidney mass QTL 21	3.3		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	10	15028513	60430477	Rat
631564	Apr3	Acute phase response QTL 3	3.9		blood interleukin-6 amount (VT:0008595)	plasma interleukin-6 level (CMO:0001927)	10	15275955	60275955	Rat
6893350	Bw99	Body weight QTL 99	0.87	0.16	body mass (VT:0001259)	body weight (CMO:0000012)	1	15906665	60906665	Rat
6893352	Bw100	Body weight QTL 100	0.33	0.6	body mass (VT:0001259)	body weight (CMO:0000012)	1	15906665	60906665	Rat
631532	Cm50	Cardiac mass QTL 50	6.6		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	10	17907113	51786432	Rat
1598852	Anxrr19	Anxiety related response QTL 19	5.07		body movement coordination trait (VT:0005424)	number of rearing movements in an experimental apparatus (CMO:0001752)	10	18167841	63167841	Rat
2313055	Bw96	Body weight QTL 96	3.6	0.0001	body mass (VT:0001259)	body weight (CMO:0000012)	10	19606483	64606483	Rat
2313087	Bmd80	Bone mineral density QTL 80	3.2	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	10	19606483	64606483	Rat
1554317	Bmd4	Bone mineral density QTL 4	9.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	10	19816042	99406971	Rat
1581497	Esta1	Estrogen-induced thymic atrophy QTL 1			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	10	21329805	61345413	Rat
724556	Pur2	Proteinuria QTL 2	5.5		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	10	22427500	90627625	Rat
61354	Pia10	Pristane induced arthritis QTL 10		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
631267	Cia20	Collagen induced arthritis QTL 20	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
61325	Aia5	Adjuvant induced arthritis QTL 5		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
70224	Eae3	Experimental allergic encephalomyelitis QTL 3	4.1		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	10	26521957	61345413	Rat
1298069	Bp168	Blood pressure QTL 168	5.5		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	10	26521957	98003205	Rat
631542	Bp82	Blood pressure QTL 82	6.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	26521957	98952741	Rat
2300171	Bmd58	Bone mineral density QTL 58	4.9	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	10	26944628	71944628	Rat
10402859	Bp381	Blood pressure QTL 381		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	27606468	72606468	Rat
2292441	Bp308	Blood pressure QTL 308			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	27606468	72606468	Rat
724527	Bp148	Blood pressure QTL 148		0.0001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	28453136	73453136	Rat
1600371	Mcs21	Mammary carcinoma susceptibility QTL 21	3		mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	10	28875650	52200160	Rat
1331762	Rf40	Renal function QTL 40	3.873		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	10	29299504	64155584	Rat
1331791	Cm31	Cardiac mass QTL 31	3.84606		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	10	29299504	107211142	Rat
631557	Bp136	Blood pressure QTL 136		0.003	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	30632053	75632053	Rat
1576311	Pia26	Pristane induced arthritis QTL 26			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	31224026	75632053	Rat
1578779	Tcas10	Tongue tumor susceptibility QTL 10	3.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	10	31297439	76297439	Rat
1576319	Cia29	Collagen induced arthritis QTL 29			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	33973921	78973921	Rat
61332	Eau3	Experimental allergic uveoretinitis QTL 3		0.004	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	10	34490559	45579777	Rat
1354614	Hpcl1	Hepatic cholesterol level QTL 1	3.3		liver cholesterol amount (VT:0010498)	liver cholesterol level (CMO:0001597)	10	35392267	51793994	Rat
1358897	Stresp6	Stress response QTL 6	4.17	0.022	blood norepinephrine amount (VT:0005663)	plasma norepinephrine level (CMO:0001010)	10	35392267	64155584	Rat
61441	Btemp1	Thermal response to stress QTL 1	4		body temperature trait (VT:0005535)	core body temperature (CMO:0001036)	10	35392457	63642539	Rat
2317042	Aia20	Adjuvant induced arthritis QTL 20	3.38		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	10	37565079	82565079	Rat
2317043	Aia7	Adjuvant induced arthritis QTL 7	3.82		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	10	37565079	82565079	Rat
1576308	Schws1	Schwannoma susceptibility QTL 1		0.0041	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	10	40035094	102359817	Rat
631269	Cia22	Collagen induced arthritis QTL 22	8.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	40035094	104060283	Rat
631270	Cia23	Collagen induced arthritis QTL 23	3.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	40035094	104060283	Rat
631552	Vetf2	Vascular elastic tissue fragility QTL 2	4.5	0.0002	aorta elastic tissue integrity trait (VT:0010556)	artery internal elastic lamina non-tumorous lesion count (CMO:0001913)	10	41142633	86142633	Rat
61463	Bp12	Blood pressure QTL 12	6.3	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	41333258	86333258	Rat
8552805	Bw145	Body weight QTL 145	2.2		body mass (VT:0001259)	change in body weight to body weight ratio (CMO:0002216)	10	41944526	78307017	Rat

Markers in Region

RH94691

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	78,449,862 - 78,449,971 (+)	MAPPER	mRatBN7.2
mRatBN7.2	1	78,431,293 - 78,431,402 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	79,708,680 - 79,708,788	NCBI	Rnor6.0
Rnor_6.0	1	79,690,305 - 79,690,413	NCBI	Rnor6.0
Rnor_5.0	1	80,970,974 - 80,971,082	UniSTS	Rnor5.0
Rnor_5.0	1	80,946,931 - 80,947,039	UniSTS	Rnor5.0
RGSC_v3.4	1	78,135,062 - 78,135,170	UniSTS	RGSC3.4
RGSC_v3.4	1	78,153,863 - 78,153,971	UniSTS	RGSC3.4
Celera	1	72,916,982 - 72,917,090	UniSTS
Celera	1	72,898,941 - 72,899,049	UniSTS
Cytogenetic Map	10	q22	UniSTS
Cytogenetic Map	1	q21	UniSTS

RH140305

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	78,439,939 - 78,440,147 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	79,698,757 - 79,698,964	NCBI	Rnor6.0
Rnor_5.0	1	80,960,864 - 80,961,071	UniSTS	Rnor5.0
RGSC_v3.4	1	78,143,940 - 78,144,147	UniSTS	RGSC3.4
Celera	1	72,907,059 - 72,907,266	UniSTS
RH 3.4 Map	1	789.3	UniSTS
Cytogenetic Map	10	q22	UniSTS
Cytogenetic Map	1	q21	UniSTS

Genetic Models

This gene Hand1 is modified in the following models/strains

BN-Hand1^m1Mcwi

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium		12	2	2		2					3
Low	3	16	12	4		4					15
Below cutoff		7	16	12	10	12	5	6	10	10	13	7	5

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_021592	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC132502	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC097324	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473948	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000219	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	Y08140	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000003486 ⟹ ENSRNOP00000003486

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	42,006,651 - 42,009,213 (-)	Ensembl
Rnor_6.0 Ensembl	10	43,250,745 - 43,253,296 (-)	Ensembl

RefSeq Acc Id:

NM_021592 ⟹ NP_067603

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	10	42,006,646 - 42,009,213 (-)	NCBI
Rnor_6.0	10	43,250,729 - 43,253,296 (-)	NCBI
Rnor_5.0	10	43,050,068 - 43,052,635 (-)	NCBI
RGSC_v3.4	10	43,423,366 - 43,425,933 (-)	RGD
Celera	10	41,298,555 - 41,301,122 (-)	RGD

Sequence:

show sequence

CCCGCTCTTTGGAAATCCGAACCCTTCTCTCTCGCTGCCTACAGAAACCTTCAAGAAGTCCGCA
GGTCCTTCGTGTCATCTCCAGCCTTGCTCAGGACTCCTCCAAAACCCAGCCAATTCGCTGCATT
GGAGCCCACGGTGACCCCCTTCTGTGGGGCGCATGGGGCGGTGCTAATTGGGCTGGCAGCACAG
GCCAGGAGGCTCTCCAACATGAACCTCGTGGGCAGCTACGCACACCATCACCACCATCACCACT
CACACCCGCCGCACCCCATGCTGCACGAACCCTTCCTCTTTGGTCCGGCCTCGCGTTGCCACCA
GGAGCGGCCTTACTTCCAGAGCTGGCTGCTGAGCCCGGCTGATGCTGCCCCAGATTTCCCTGCC
GGCGGGCCACCACCTACCACCGCAGTAGCAGCGGCTGCCTATGGTCCCGATGCCAGGCCGAGTC
AGAGCCCAGGTCGGCTGGAGGCTCTTGGAGGCCGCCTGCCCAGGCGAAAAGGTTCAGGACCCAA
AAAGGAGCGGAGGCGCACAGAGAGCATTAACAGTGCGTTCGCGGAGCTGCGTGAGTGCATCCCC
AATGTGCCTGCGGACACCAAGCTCTCCAAGATCAAGACTCTGCGCCTGGCCACCAGCTACATCG
CCTACTTGATGGACGTGCTGGCCAAGGATGCACAAGCAGGTGACCCCGAGGCCTTCAAGGCTGA
ACTAAAAAAGACGGATGGCGGTCGCGAAAGCAAGCGGAAAAGGGAGTCGCCTCAGCAGCACGAA
GGCCTTCCTCCTGCCCTGGGGCCAAGCGAGAAGAGGATTAAAGGACGCACTGGCTGGCCTCAGC
AAGTCTGGGCGCTGGAGCTAAATCAGTGAGAAGAGGCCGGCACCGAGGACCCGGCCAAGGCTGG
CCCACCTGGCTATCCGGAGAGGAGAGGGCAGGACGCAGCGGCCACGGCAAGTCTCCGGGTACCC
GCGCGCGTCTTGCCCAGTCTCTGCGAGCGCCGGCGGGTCGGCGGTTGCAACTACCCACTAGAAT
CGCACGTGCAATGTCATTTGAATTTGTTAATACATAAGAGAAAGAGAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_067603	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH97324	(Get FASTA)	NCBI Sequence Viewer
	CAA69334	(Get FASTA)	NCBI Sequence Viewer
	EDM04506	(Get FASTA)	NCBI Sequence Viewer
	P97832	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_067603 ⟸ NM_021592

- UniProtKB:

Q4V8L8 (UniProtKB/Swiss-Prot), P97832 (UniProtKB/Swiss-Prot), A6HEQ1 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MNLVGSYAHHHHHHHSHPPHPMLHEPFLFGPASRCHQERPYFQSWLLSPADAAPDFPAGGPPPT
TAVAAAAYGPDARPSQSPGRLEALGGRLPRRKGSGPKKERRRTESINSAFAELRECIPNVPADT
KLSKIKTLRLATSYIAYLMDVLAKDAQAGDPEAFKAELKKTDGGRESKRKRESPQQHEGLPPAL
GPSEKRIKGRTGWPQQVWALELNQ

hide sequence

RefSeq Acc Id:

ENSRNOP00000003486 ⟸ ENSRNOT00000003486

Protein Domains

bHLH

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P97832-F1-model_v2	AlphaFold	P97832	1-216	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:621206	AgrOrtholog
BioCyc Gene	G2FUF-25015	BioCyc
Ensembl Genes	ENSRNOG00000002582	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Protein	ENSRNOP00000003486	ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000003486	ENTREZGENE, UniProtKB/Swiss-Prot
Gene3D-CATH	4.10.280.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7444552	IMAGE-MGC_LOAD
	IMAGE:7460879	IMAGE-MGC_LOAD
InterPro	bHLH_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	HLH_DNA-bd_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:59112	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:114327	IMAGE-MGC_LOAD
	MGC:114332	IMAGE-MGC_LOAD
NCBI Gene	59112	ENTREZGENE
PANTHER	BASIC HELIX-LOOP-HELIX TRANSCRIPTION FACTOR, TWIST	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	HEART- AND NEURAL CREST DERIVATIVES-EXPRESSED PROTEIN 1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	HLH	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Hand1	PhenoGen
PROSITE	BHLH	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
SMART	HLH	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	HLH, helix-loop-helix DNA-binding domain	UniProtKB/TrEMBL, UniProtKB/Swiss-Prot
UniProt	A6HEQ1	ENTREZGENE, UniProtKB/TrEMBL
	HAND1_RAT	UniProtKB/Swiss-Prot, ENTREZGENE
	Q4V8L8	ENTREZGENE
UniProt Secondary	Q4V8L8	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-10-17	Hand1	heart and neural crest derivatives expressed 1	Hand1	heart and neural crest derivatives expressed transcript 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-12-14	Hand1	heart and neural crest derivatives expressed transcript 1		eHand protein	Name updated	1299863	APPROVED
2002-08-07	Hand1	eHand protein			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_expression	present in adult heart	727442

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD