Advanced Search (OLGA)

Gene: Cds2 (CDP-diacylglycerol synthase 2) Rattus norvegicus

Analyze

Symbol:

Cds2

Name:

CDP-diacylglycerol synthase 2

RGD ID:

621186

Description:

Enables phosphatidate cytidylyltransferase activity. Predicted to be involved in CDP-diacylglycerol biosynthetic process and lipid droplet formation. Located in membrane. Orthologous to human CDS2 (CDP-diacylglycerol synthase 2); PARTICIPATES IN glycerophospholipid metabolic pathway; phosphatidylinositol 3-kinase signaling pathway; INTERACTS WITH 17alpha-ethynylestradiol; 2,3,7,8-tetrachlorodibenzodioxine; acetamide.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

CDP-DAG synthase 2; CDP-DG synthase 2; CDP-DG synthetase 2; CDP-diacylglycerol synthase (phosphatidate cytidylyltransferase) 2; CDP-diglyceride pyrophosphorylase 2; CDP-diglyceride synthase 2; CDP-diglyceride synthetase 2; CDS 2; CTP:phosphatidate cytidylyltransferase 2; phosphatidate cytidylyltransferase 2

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	CDS2 (CDP-diacylglycerol synthase 2)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, Treefam
Mus musculus (house mouse):	Cds2 (CDP-diacylglycerol synthase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Cds2 (CDP-diacylglycerol synthase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	CDS2 (CDP-diacylglycerol synthase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	CDS2 (CDP-diacylglycerol synthase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Cds2 (CDP-diacylglycerol synthase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	CDS2 (CDP-diacylglycerol synthase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	CDS2 (CDP-diacylglycerol synthase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Cds2 (CDP-diacylglycerol synthase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	CDS1 (CDP-diacylglycerol synthase 1)	HGNC	OrthoDB
Alliance orthologs ³
Homo sapiens (human):	CDS2 (CDP-diacylglycerol synthase 2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Cds2 (CDP-diacylglycerol synthase 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	cds2 (CDP-diacylglycerol synthase (phosphatidate cytidylyltransferase) 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	CDS1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Cds	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	cdgs-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	cds2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	cds2	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	139,967,870 - 140,006,459 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	3	139,967,742 - 140,009,201 (+)	Ensembl				GRCr8
mRatBN7.2	3	119,514,963 - 119,553,555 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	119,515,000 - 119,553,541 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	3	123,418,698 - 123,457,545 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	132,005,897 - 132,044,962 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	129,674,802 - 129,713,654 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	124,896,657 - 124,935,221 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	124,896,618 - 124,935,226 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	3	131,392,178 - 131,430,664 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	3	120,025,455 - 120,063,992 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	3	118,312,509 - 118,351,088 (+)	NCBI		Celera
RGSC_v3.1	3	119,931,027 - 119,969,565 (+)	NCBI
Cytogenetic Map	3	q36	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Huntington's disease-like 1 (ISO)

Inosine Triphosphatase Deficiency (ISO)

pantothenate kinase-associated neurodegeneration (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (EXP)

17beta-estradiol (ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,3',4,4',5-Pentachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

3,4-methylenedioxymethamphetamine (ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

acetamide (EXP)

acrolein (ISO)

aflatoxin B1 (EXP,ISO)

all-trans-retinoic acid (ISO)

alpha-pinene (ISO)

ammonium chloride (EXP)

atrazine (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

bisphenol AF (EXP)

bisphenol F (ISO)

Brodifacoum (EXP)

bromobenzene (EXP)

carbamazepine (ISO)

carbon nanotube (ISO)

choline (ISO)

clofibrate (ISO)

cyclosporin A (ISO)

cyproconazole (ISO)

dexamethasone (ISO)

dextran sulfate (ISO)

diethyl maleate (ISO)

dioxygen (ISO)

doxorubicin (ISO)

endosulfan (EXP)

epoxiconazole (ISO)

ethanol (ISO)

Evodiamine (ISO)

folic acid (ISO)

formaldehyde (ISO)

FR900359 (ISO)

hypochlorous acid (ISO)

indometacin (ISO)

inulin (ISO)

isoprenaline (ISO)

ivermectin (ISO)

L-methionine (ISO)

lead diacetate (ISO)

methamphetamine (ISO)

methoxychlor (EXP)

methylmercury chloride (ISO)

nickel sulfate (ISO)

ozone (ISO)

paracetamol (EXP,ISO)

pentachlorophenol (ISO)

perfluorooctane-1-sulfonic acid (ISO)

phenobarbital (ISO)

pirinixic acid (ISO)

propiconazole (ISO)

rotenone (EXP)

sodium arsenite (ISO)

succimer (ISO)

sunitinib (ISO)

temozolomide (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

trichloroethene (EXP)

trimellitic anhydride (ISO)

triphenyl phosphate (ISO)

troglitazone (ISO)

valproic acid (ISO)

vinclozolin (EXP)

vorinostat (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

CDP-diacylglycerol biosynthetic process (IEA,ISO,ISS)

lipid droplet formation (IEA,ISO,ISS)

lipid metabolic process (IEA)

phospholipid biosynthetic process (IEA)

Cellular Component

endoplasmic reticulum (IEA,ISO,ISS)

endoplasmic reticulum membrane (IBA,IEA)

membrane (IDA,IEA)

Molecular Function

nucleotidyltransferase activity (IEA)

phosphatidate cytidylyltransferase activity (IDA,IEA,ISO,ISS)

protein binding (ISO)

transferase activity (IEA)

transferase activity, transferring phosphorus-containing groups (IEA)

Molecular Pathway Annotations Click to see Annotation Detail View

glycerophospholipid metabolic pathway (IEA)

phosphatidylinositol 3-kinase signaling pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Mitochondrial CDP-diacylglycerol synthase activity is due to the peripheral protein, TAMM41 and not due to the integral membrane protein, CDP-diacylglycerol synthase 1.	Blunsom NJ, etal., Biochim Biophys Acta Mol Cell Biol Lipids. 2018 Mar;1863(3):284-298. doi: 10.1016/j.bbalip.2017.12.005. Epub 2017 Dec 16.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
4.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
5.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
6.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
7.	GOA pipeline	RGD automated data pipeline
8.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
9.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:16023307	PMID:19946888	PMID:25375833	PMID:26316108	PMID:26946540	PMID:31548309

Genomics

Comparative Map Data

Cds2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	139,967,870 - 140,006,459 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	3	139,967,742 - 140,009,201 (+)	Ensembl				GRCr8
mRatBN7.2	3	119,514,963 - 119,553,555 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	119,515,000 - 119,553,541 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	3	123,418,698 - 123,457,545 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	132,005,897 - 132,044,962 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	129,674,802 - 129,713,654 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	124,896,657 - 124,935,221 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	124,896,618 - 124,935,226 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	3	131,392,178 - 131,430,664 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	3	120,025,455 - 120,063,992 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	3	118,312,509 - 118,351,088 (+)	NCBI		Celera
RGSC_v3.1	3	119,931,027 - 119,969,565 (+)	NCBI
Cytogenetic Map	3	q36	NCBI

CDS2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	20	5,127,008 - 5,197,887 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	20	5,126,879 - 5,197,887 (+)	Ensembl			hg38	GRCh38
GRCh37	20	5,107,654 - 5,178,533 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	20	5,055,482 - 5,119,989 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	20	5,055,481 - 5,119,987	NCBI
Celera	20	5,177,503 - 5,242,010 (+)	NCBI		Celera
Cytogenetic Map	20	p12.3	NCBI
HuRef	20	5,061,336 - 5,132,462 (+)	NCBI		HuRef
CHM1_1	20	5,108,785 - 5,179,904 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	20	5,166,426 - 5,237,294 (+)	NCBI		T2T-CHM13v2.0

Cds2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	132,105,068 - 132,153,970 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	132,105,068 - 132,153,970 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	2	132,253,338 - 132,312,050 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	132,263,148 - 132,312,050 (+)	Ensembl			mm10	GRCm38
MGSCv37	2	132,088,993 - 132,137,777 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	2	131,954,698 - 132,003,482 (+)	NCBI		MGSCv36	mm8
Celera	2	133,486,542 - 133,537,001 (+)	NCBI		Celera
Cytogenetic Map	2	F2	NCBI
cM Map	2	64.15	NCBI

Cds2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955415	15,792,239 - 15,806,454 (+)	Ensembl
ChiLan1.0	NW_004955415	15,762,672 - 15,806,454 (+)	NCBI	ChiLan1.0	ChiLan1.0

CDS2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	21	6,074,468 - 6,145,700 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	20	6,071,352 - 6,142,524 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	20	5,146,754 - 5,218,051 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	20	4,939,578 - 5,010,579 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	20	4,939,578 - 5,002,977 (+)	Ensembl			panPan2	panpan1.1

CDS2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	24	16,407,869 - 16,469,855 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	24	16,414,682 - 16,469,759 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	24	16,230,679 - 16,292,397 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	24	16,821,119 - 16,882,867 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	24	16,823,103 - 16,883,125 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	24	16,418,163 - 16,479,905 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	24	16,531,923 - 16,586,955 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	24	16,858,620 - 16,920,606 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Cds2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	165,253,245 - 165,322,981 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936485	13,691,724 - 13,754,397 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936485	13,684,609 - 13,754,357 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CDS2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	17	14,151,597 - 14,220,839 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	17	14,151,810 - 14,220,841 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	17	15,142,037 - 15,203,537 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

CDS2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	2	32,867,065 - 32,936,456 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	2	32,874,699 - 32,935,813 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666071	11,598,389 - 11,668,060 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Cds2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624741	6,159,573 - 6,227,419 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624741	6,159,561 - 6,231,967 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Variants

Variants in Cds2
169 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	108
Count of miRNA genes:	93
Interacting mature miRNAs:	101
Transcripts:	ENSRNOT00000028888
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2312673	Scl63	Serum cholesterol level QTL 63		0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	3	98535255	168026850	Rat
2301414	Kidm37	Kidney mass QTL 37		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	3	70653097	121056321	Rat
2302373	Gluco39	Glucose level QTL 39	5.01		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	3	98535386	161695835	Rat
70216	Cm14	Cardiac mass QTL 14	2.1		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	31172320	163586636	Rat
2292591	Esta4	Estrogen-induced thymic atrophy QTL 4			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	3	47233211	147415807	Rat
1358362	Srcrt2	Stress Responsive Cort QTL 2	2.78		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	3	38192233	133483320	Rat
1581568	Rf53	Renal function QTL 53			urine total protein amount (VT:0000032)	urine protein excretion rate to body weight ratio (CMO:0001099)	3	56395968	161299569	Rat
7387306	Bw124	Body weight QTL 124	3.2	0.0003	body mass (VT:0001259)	body weight (CMO:0000012)	3	84091273	129091273	Rat
1578754	Stresp16	Stress response QTL 16	4	0.001	blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	3	112681431	157681431	Rat
1300111	Rf12	Renal function QTL 12	3.78		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	3	61017749	121056321	Rat
8694437	Bw167	Body weight QTL 167	22.46	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	3	91797474	136797474	Rat
8662816	Vetf4	Vascular elastic tissue fragility QTL 4	4		renal artery integrity trait (VT:0010642)	number of ruptures of the internal elastic lamina of the renal arteries (CMO:0002563)	3	59242096	157323038	Rat
1559282	Emca5	Estrogen-induced mammary cancer QTL 5	3.9		mammary gland integrity trait (VT:0010552)	percentage of study population developing mammary tumors during a period of time (CMO:0000948)	3	43827364	169034231	Rat
1581503	Cm58	Cardiac mass QTL 58	2.7	0.05	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	3	43827364	121056321	Rat
1354611	Despr2	Despair related QTL 2	3.03	0.0028	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	3	97084464	142084464	Rat
631649	Bp123	Blood pressure QTL 123	3.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	89772419	134772419	Rat
631841	Niddm39	Non-insulin dependent diabetes mellitus QTL 39	3.36		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	94856903	159898684	Rat
1358204	Insglur1	Insulin/glucose ratio QTL 1	3.8		blood glucose amount (VT:0000188)	serum glucose level (CMO:0000543)	3	115638168	135181505	Rat
1576306	Schws3	Schwannoma susceptibility QTL 3		0.001	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	3	118839124	163839124	Rat
619618	Rf3	Renal disease susceptibility QTL 3	6.5	0.001	urine albumin amount (VT:0002871)	urine albumin excretion rate to body weight ratio (CMO:0001270)	3	107693393	152693393	Rat
12879848	Bw181	Body weght QTL 181		0.015	body mass (VT:0001259)	body weight (CMO:0000012)	3	70348525	121056321	Rat
2301971	Cm71	Cardiac mass QTL 71	4.63		heart left ventricle mass (VT:0007031)	heart left ventricle weight (CMO:0000776)	3	41874578	155617519	Rat
2312659	Slep7	Serum leptin concentration QTL 7		0.001	blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	3	98535255	168026850	Rat
1358885	Bp251	Blood pressure QTL 251	3.8		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	14489145	121056321	Rat
2301970	Bw81	Body weight QTL 81	5.19		body mass (VT:0001259)	body weight (CMO:0000012)	3	41874578	155617519	Rat
1581546	Pur13	Proteinuria QTL 13	2.93	0.0335	urine total protein amount (VT:0000032)	urine protein excretion rate (CMO:0000759)	3	78196190	146592722	Rat
1331758	Bp207	Blood pressure QTL 207	2.848		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	112287552	135181505	Rat
1358888	Bp264	Blood pressure QTL 264	4.43		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	14489145	121056321	Rat
2293087	Iddm27	Insulin dependent diabetes mellitus QTL 27	2.68		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	97551417	147415807	Rat
2312670	Bw94	Body weight QTL 94		0.01	inguinal fat pad mass (VT:0010424)	inguinal fat pad weight to body weight ratio (CMO:0001253)	3	98535255	168026850	Rat
724532	Cm17	Cardiac mass QTL 17	2		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	3	95735366	140735366	Rat

Markers in Region

RH144154

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	119,532,787 - 119,532,902 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	124,914,442 - 124,914,556	NCBI	Rnor6.0
Rnor_5.0	3	131,409,963 - 131,410,077	UniSTS	Rnor5.0
RGSC_v3.4	3	120,043,239 - 120,043,353	UniSTS	RGSC3.4
Celera	3	118,330,229 - 118,330,343	UniSTS
RH 3.4 Map	3	1024.3	UniSTS
Cytogenetic Map	3	q36	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	11	67	161	91	90	59	92	59	6	354	191	9	140	80	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_053643	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AB052898	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AC103170	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473949	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000003	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000028888 ⟹ ENSRNOP00000028888

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	3	139,967,742 - 140,009,201 (+)	Ensembl
mRatBN7.2 Ensembl	3	119,515,000 - 119,553,541 (+)	Ensembl
Rnor_6.0 Ensembl	3	124,896,618 - 124,935,226 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000093797 ⟹ ENSRNOP00000095068

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	119,539,777 - 119,553,541 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000114291 ⟹ ENSRNOP00000107735

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	3	139,967,742 - 140,009,201 (+)	Ensembl

RefSeq Acc Id:

NM_053643 ⟹ NP_446095

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	139,967,870 - 140,006,459 (+)	NCBI
mRatBN7.2	3	119,514,963 - 119,553,555 (+)	NCBI
Rnor_6.0	3	124,896,657 - 124,935,221 (+)	NCBI
Rnor_5.0	3	131,392,178 - 131,430,664 (+)	NCBI
RGSC_v3.4	3	120,025,455 - 120,063,992 (+)	RGD
Celera	3	118,312,509 - 118,351,088 (+)	RGD

Sequence:

show sequence

GAGAGGCCGTGCACACTGAGCCGACCTCCACAGCCACCGCGCTGCTCACTCTGGGTGACGTCGC
GCCCGGGTCCCCAGCATGACCGAGCTACGGCAGAGGGCTGTCCGCGAGGACGCACCTCCGGAGG
ACAAGGAATCAGAGTCGGAAGCAAAGTTAGATGGAGAGACCGCATCAGACAGCGAGAGTCGAGC
GGAAACAGCTCCCCCACCAACCTCCATAGATGATACCCCAGAGGTCCTTAACAGGGCCCTTTCC
AACTTGTCCTCAAGATGGAAGAACTGGTGGGTGCGAGGCATCCTGACGATGGCCATGATTGCAT
TTTTCTTCATTATCATTTACCTGGGACCAATGGTTTTGATGATGATTGTTATGTGTGTTCAGAT
TAAGTGTTTCCATGAAATAATCACTATTGGCTACAATGTATACCACTCCTACGACTTGCCCTGG
TTCAGGACCCTCAGCTGGTACTTCCTCCTGTGTGTGAACTACTTCTTCTACGGGGAGACAGTGA
CAGACTACTTCTTCACTCTGGTCCAGAGAGAGGAGCCTTTGCGCATTCTCAGTAAATACCACCG
GTTCATCTCCTTTACCCTGTATCTAACAGGATTCTGCATGTTTGTTCTGAGTCTGGTTAAGAAG
CATTATCGGCTGCAGTTCTACATGTTTGGCTGGACCCATGTGACCTTGCTTATTGTCGTAACGC
AGTCACATCTTGTTATCCATAACTTGTTTGAAGGAATGATATGGTTTATTGTTCCCATTTCATG
CGTCATCTGCAATGATATTATGGCCTATATGTTTGGCTTTTTCTTTGGTCGGACCCCACTCATT
AAGCTCTCTCCAAAGAAGACCTGGGAAGGCTTCATTGGGGGCTTCTTTGCTACTGTGGTGTTTG
GCCTTCTGCTCTCCTACGTGATGTCTGGGTACCGATGCTTCGTCTGTCCTGTGGAATACAACAA
TGACACCAACAGTTTCACTGTGGACTGTGAGCCATCTGACCTGTTCCGCCTGCAGGAGTACAAC
ATTCCCGGGGTGATCCAGTCGCTCGTTGGCTGGAAAACCATGAGGATGTACCCTTTCCAGATCC
ACAGTGCGCTCTCCACCTTCGCCTCGCTCATTGGCCCATTTGGAGGGTTCTTCGCAAGTGGATT
CAAGCGGGCCTTTAAAATCAAAGATTTTGCCAACACCATTCCTGGTCATGGAGGCATCATGGAT
CGCTTTGACTGCCAGTACCTGATGGCCACCTTTGTCAACGTGTACATCGCCAGCTTTATCAGGG
GCCCCAACCCGAGCAAACTGATTCAGCAGTTTCTGACGTTGCGGCCGGACCAGCAGCTTCACAT
CTTCAACACACTCAAGTCTCACCTGACTGACAAGGGGATTCTGATGTCTGCCTTGGAAGAGGAG
TAGTCTACCCAGGGCCAGGAGAGCCAGAATAGGACTAGAGTGAGGGGCAGGTCACCAAGGCCAG
CCCAGCTGCTGTGACTTAGATAATGAGAAGCTTCAACTCACGCCTGCAGGT

hide sequence

Protein Sequences


Protein RefSeqs	NP_446095	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	BAB61043	(Get FASTA)	NCBI Sequence Viewer
	EDL80261	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000028888
GenBank Protein	Q91XU8	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_446095 ⟸ NM_053643

- UniProtKB:

Q91XU8 (UniProtKB/Swiss-Prot), G3V8W2 (UniProtKB/TrEMBL), A6HQG0 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MTELRQRAVREDAPPEDKESESEAKLDGETASDSESRAETAPPPTSIDDTPEVLNRALSNLSSR
WKNWWVRGILTMAMIAFFFIIIYLGPMVLMMIVMCVQIKCFHEIITIGYNVYHSYDLPWFRTLS
WYFLLCVNYFFYGETVTDYFFTLVQREEPLRILSKYHRFISFTLYLTGFCMFVLSLVKKHYRLQ
FYMFGWTHVTLLIVVTQSHLVIHNLFEGMIWFIVPISCVICNDIMAYMFGFFFGRTPLIKLSPK
KTWEGFIGGFFATVVFGLLLSYVMSGYRCFVCPVEYNNDTNSFTVDCEPSDLFRLQEYNIPGVI
QSLVGWKTMRMYPFQIHSALSTFASLIGPFGGFFASGFKRAFKIKDFANTIPGHGGIMDRFDCQ
YLMATFVNVYIASFIRGPNPSKLIQQFLTLRPDQQLHIFNTLKSHLTDKGILMSALEEE

hide sequence

Ensembl Acc Id:

ENSRNOP00000028888 ⟸ ENSRNOT00000028888

Ensembl Acc Id:

ENSRNOP00000095068 ⟸ ENSRNOT00000093797

Ensembl Acc Id:

ENSRNOP00000107735 ⟸ ENSRNOT00000114291

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q91XU8-F1-model_v2	AlphaFold	Q91XU8	1-443	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13692456

Promoter ID:

EPDNEW_R2979

Type:

initiation region

Name:

Cds2_1

Description:

CDP-diacylglycerol synthase 2

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	3	124,896,596 - 124,896,656	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:621186	AgrOrtholog
BioCyc Gene	G2FUF-47780	BioCyc
BioCyc Pathway	PWY-5667 [CDP-diacylglycerol biosynthesis I]	BioCyc
BioCyc Pathway Image	PWY-5667	BioCyc
Ensembl Genes	ENSRNOG00000021265	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000028888	ENTREZGENE
InterPro	PC_trans	UniProtKB/Swiss-Prot
	PC_Trfase_euk	UniProtKB/Swiss-Prot
KEGG Report	rno:114101	UniProtKB/Swiss-Prot
NCBI Gene	114101	ENTREZGENE
PANTHER	PHOSPHATIDATE CYTIDYLYLTRANSFERASE 2	UniProtKB/Swiss-Prot
	PTHR13773	UniProtKB/Swiss-Prot
Pfam	CTP_transf_1	UniProtKB/Swiss-Prot
PhenoGen	Cds2	PhenoGen
PIRSF	PC_trans_euk	UniProtKB/Swiss-Prot
PROSITE	CDS	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000021265	RatGTEx
UniProt	A0A8I6AMA9_RAT	UniProtKB/TrEMBL
	A6HQG0	ENTREZGENE, UniProtKB/TrEMBL
	CDS2_RAT	UniProtKB/Swiss-Prot
	G3V8W2	ENTREZGENE, UniProtKB/TrEMBL
	Q91XU8	ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-12-09	Cds2	CDP-diacylglycerol synthase 2	Cds2	CDP-diacylglycerol synthase (phosphatidate cytidylyltransferase) 2	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-02-26	Cds2	CDP-diacylglycerol synthase (phosphatidate cytidylyltransferase) 2			Symbol and Name status set to approved	625702	APPROVED
2002-08-07	Cds2	CDP-diacylglycerol synthase (phosphatidate cytidylyltransferase) 2			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Annotations - KEGG (archival)

BioCyc Pathways

Send us a Message

Imported Disease Annotations - ClinVar

Imported Annotations - KEGG (archival)

BioCyc Pathways