Advanced Search (OLGA)

Gene: Rpl18 (ribosomal protein L18) Rattus norvegicus

Analyze

Symbol:

Rpl18

Name:

ribosomal protein L18

RGD ID:

621182

Description:

Predicted to enable RNA binding activity. Predicted to be a structural constituent of ribosome. Involved in liver regeneration. Part of cytosolic large ribosomal subunit. Is active in synapse. Human ortholog(s) of this gene implicated in Diamond-Blackfan anemia 18. Orthologous to human RPL18 (ribosomal protein L18); PARTICIPATES IN ribosome biogenesis pathway; translation pathway; INTERACTS WITH 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane; 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

60S ribosomal protein L18; large ribosomal subunit protein eL18

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	RPL18 (ribosomal protein L18)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Rpl18 (ribosomal protein L18)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Rpl18 (ribosomal protein L18)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	RPL18 (ribosomal protein L18)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	RPL18 (ribosomal protein L18)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Rpl18 (ribosomal protein L18)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	RPL18 (ribosomal protein L18)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	RPL18 (ribosomal protein L18)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Rpl18 (ribosomal protein L18)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	RPL18 (ribosomal protein L18)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Rpl18 (ribosomal protein L18)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	rpl18 (ribosomal protein L18)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	rpl-18	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	RPL18A	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	RPL18B	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	RpL18	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	rpl18	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	105,325,269 - 105,327,911 (+)	NCBI		GRCr8
mRatBN7.2	1	96,188,811 - 96,191,452 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	96,188,112 - 96,191,452 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	101,574,246 - 101,576,887 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	110,046,944 - 110,049,585 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	103,337,321 - 103,339,962 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	101,700,910 - 101,703,551 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	101,701,975 - 101,703,550 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	102,779,742 - 102,782,383 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	96,186,553 - 96,189,194 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	96,265,737 - 96,267,304 (+)	NCBI
Celera	1	90,442,010 - 90,444,651 (+)	NCBI		Celera
Cytogenetic Map	1	q22	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Diamond-Blackfan anemia 18 (ISO)

Disease Progression (ISO)

Stomach Neoplasms (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-catechin (ISO)

1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane (EXP)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (EXP)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4,6-tribromophenol (ISO)

2,4-dinitrotoluene (EXP)

2,6-dimethoxyphenol (ISO)

2,6-dinitrotoluene (EXP)

2-amino-14,16-dimethyloctadecan-3-ol (ISO)

3,3',5,5'-tetrabromobisphenol A (ISO)

4,4'-sulfonyldiphenol (ISO)

acrolein (ISO)

alpha-pinene (ISO)

ammonium chloride (EXP)

aristolochic acid A (ISO)

Aroclor 1254 (ISO)

arsenite(3-) (ISO)

arsenous acid (ISO)

benzo[a]pyrene (ISO)

beta-lapachone (ISO)

bisphenol A (EXP,ISO)

Bisphenol B (ISO)

bisphenol F (ISO)

Brodifacoum (EXP)

caffeine (ISO)

cannabidiol (ISO)

capivasertib (ISO)

chloropicrin (ISO)

chlorpyrifos (ISO)

chromium(6+) (ISO)

clobetasol (ISO)

clofibric acid (EXP)

cylindrospermopsin (ISO)

D-glucitol (ISO)

decabromodiphenyl ether (ISO)

diarsenic trioxide (ISO)

dibutyl phthalate (EXP)

dihydroartemisinin (ISO)

endosulfan (EXP)

enzyme inhibitor (ISO)

epoxiconazole (ISO)

ethanol (ISO)

fenthion (ISO)

flutamide (EXP)

folic acid (ISO)

FR900359 (ISO)

furfural (ISO)

gentamycin (EXP)

glyphosate (EXP)

indometacin (EXP)

ivermectin (ISO)

lead(0) (ISO)

N-methyl-4-phenylpyridinium (ISO)

N-nitrosodiethylamine (EXP)

nefazodone (EXP)

nimesulide (EXP)

nitrates (ISO)

ozone (EXP,ISO)

paracetamol (ISO)

perfluorooctanoic acid (ISO)

rimonabant (ISO)

rotenone (EXP)

SB 431542 (ISO)

silicon dioxide (EXP)

sodium arsenite (ISO)

sodium chloride (ISO)

sodium dichromate (EXP)

sodium fluoride (ISO)

sunitinib (ISO)

testosterone (EXP)

triphenyl phosphate (ISO)

trovafloxacin (ISO)

tungsten (ISO)

valproic acid (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cytoplasmic translation (ISO,ISS)

liver regeneration (IEP)

translation (IEA)

translation at postsynapse (NAS)

translation at presynapse (NAS)

Cellular Component

cytoplasm (IEA,ISO)

cytosol (IEA,ISO)

cytosolic large ribosomal subunit (IBA,IDA,ISO)

cytosolic ribosome (ISO)

endoplasmic reticulum (IEA,ISO)

nucleolus (ISO)

postsynapse (NAS)

presynapse (NAS)

ribonucleoprotein complex (IEA)

ribosome (IEA,NAS)

rough endoplasmic reticulum (IEA)

synapse (EXP,IDA)

Molecular Function

protein binding (ISO)

RNA binding (IBA)

structural constituent of ribosome (IBA,IEA,ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

ribosome biogenesis pathway (ISO)

translation pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Structures of the human and Drosophila 80S ribosome.	Anger AM, etal., Nature. 2013 May 2;497(7447):80-5. doi: 10.1038/nature12104.
2.	The primary structure of rat ribosomal protein L18.	Devi KR, etal., DNA 1988 Apr;7(3):157-62.
3.	Coordinate regulation of ribosomal protein mRNA level in regenerating rat liver. Study with the corresponding mouse cloned cDNAs.	Faliks D and Meyuhas O, Nucleic Acids Res. 1982 Feb 11;10(3):789-801.
4.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
5.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
6.	Selective high-efficiency cross-linking of mammalian ribosomal proteins with cleavable thiol-directed heterobifunctional reagents: identification and binding directions of major protein complexes.	Hultin T Biochim Biophys Acta. 1986 Aug 15;872(3):226-35.
7.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
8.	Semiquantitative proteomic analysis of rat forebrain postsynaptic density fractions by mass spectrometry.	Peng J, etal., J Biol Chem. 2004 May 14;279(20):21003-11. doi: 10.1074/jbc.M400103200. Epub 2004 Mar 12.
9.	GOA pipeline	RGD automated data pipeline
10.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
11.	Comprehensive gene review and curation	RGD comprehensive gene curation
12.	Differential expression of diacylglycerol kinase iota and L18A mRNAs in the brains of alcohol-preferring AA and alcohol-avoiding ANA rats.	Sommer W, etal., Mol Psychiatry. 2001 Jan;6(1):103-8; 5.

Additional References at PubMed

PMID:12477932	PMID:12962325	PMID:15489334	PMID:16751257	PMID:19946888	PMID:21423176	PMID:21630459	PMID:22871113	PMID:24625528	PMID:25957688	PMID:30053369	PMID:35352799

Genomics

Comparative Map Data

Rpl18
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	105,325,269 - 105,327,911 (+)	NCBI		GRCr8
mRatBN7.2	1	96,188,811 - 96,191,452 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	96,188,112 - 96,191,452 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	101,574,246 - 101,576,887 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	110,046,944 - 110,049,585 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	103,337,321 - 103,339,962 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	101,700,910 - 101,703,551 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	101,701,975 - 101,703,550 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	102,779,742 - 102,782,383 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	96,186,553 - 96,189,194 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	96,265,737 - 96,267,304 (+)	NCBI
Celera	1	90,442,010 - 90,444,651 (+)	NCBI		Celera
Cytogenetic Map	1	q22	NCBI

RPL18
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	19	48,615,331 - 48,619,178 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	19	48,615,328 - 48,619,184 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	19	49,118,588 - 49,122,435 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	19	53,810,400 - 53,814,245 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	19	53,810,400 - 53,814,245	NCBI
Celera	19	45,983,453 - 45,987,298 (-)	NCBI		Celera
Cytogenetic Map	19	q13.33	NCBI
HuRef	19	45,497,774 - 45,501,866 (-)	NCBI		HuRef
CHM1_1	19	49,120,459 - 49,124,550 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	19	51,609,800 - 51,613,662 (-)	NCBI		T2T-CHM13v2.0

Rpl18
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	7	45,364,891 - 45,370,255 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	7	45,364,881 - 45,370,260 (+)	Ensembl		GRCm39 Ensembl
GRCm38	7	45,715,467 - 45,720,835 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	7	45,715,457 - 45,720,836 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	7	52,973,441 - 52,976,205 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	7	45,586,113 - 45,588,877 (+)	NCBI		MGSCv36	mm8
MGSCv36	11	97,001,760 - 97,002,425 (+)	NCBI		MGSCv36	mm8
Celera	7	41,180,612 - 41,183,376 (+)	NCBI		Celera
Cytogenetic Map	7	B3	NCBI
cM Map	7	29.45	NCBI

Rpl18
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955559	1,930,614 - 1,933,037 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955559	1,929,643 - 1,933,077 (+)	NCBI	ChiLan1.0	ChiLan1.0

RPL18
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	20	54,720,714 - 54,724,737 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	19	56,647,054 - 56,650,980 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	19	45,617,033 - 45,620,954 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	19	54,209,224 - 54,213,293 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	19	54,209,173 - 54,213,293 (-)	Ensembl	panpan1.1		panPan2

RPL18
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	1	107,690,021 - 107,694,586 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	1	107,688,074 - 107,694,596 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	1	107,211,515 - 107,216,012 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	1	108,214,085 - 108,218,589 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	1	108,212,137 - 108,218,599 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	1	107,880,621 - 107,885,114 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	1	107,527,916 - 107,532,404 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	1	108,363,625 - 108,368,119 (+)	NCBI		UU_Cfam_GSD_1.0

Rpl18
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409349	21,046,894 - 21,050,552 (-)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936664	2,665,084 - 2,668,706 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

RPL18
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	53,974,309 - 53,978,544 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	6	53,974,353 - 53,978,681 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	49,641,378 - 49,645,068 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

RPL18
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Vero_WHO_p1.0	NW_023666073	21,734,896 - 21,738,778 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Rpl18
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624832	5,254,263 - 5,257,865 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Rpl18
8 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	135
Count of miRNA genes:	124
Interacting mature miRNAs:	131
Transcripts:	ENSRNOT00000028555
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2313059	Bss55	Bone structure and strength QTL 55	3.2	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	1	43284731	118944897	Rat
70209	Niddm23	Non-insulin dependent diabetes mellitus QTL 23	2.82		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	94494440	198324465	Rat
631688	Hcas2	Hepatocarcinoma susceptibility QTL 2	3	0.0001	liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	5925874	115540829	Rat
1582234	Gluco18	Glucose level QTL 18	3.4	0.0003	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	78479925	123479925	Rat
1358359	Sradr1	Stress Responsive Adrenal Weight QTL 1	4.74		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	30882023	123479925	Rat
634314	Niddm44	Non-insulin dependent diabetes mellitus QTL 44			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	49393289	199050459	Rat
1578780	Cm52	Cardiac mass QTL 52	3.3	0.0001	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	1	81591954	219808434	Rat
1331793	Bp200	Blood pressure QTL 200	3.71601		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	94494440	172949803	Rat
1578654	Bss10	Bone structure and strength QTL 10	4		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	1	49393172	159356837	Rat
2300324	Fetw1	Fetal weight QTL 1	12.1	0.005	fetal growth trait (VT:0004201)	fetal body weight (CMO:0002080)	1	85424647	100358001	Rat
1300121	Hrtrt1	Heart rate QTL 1	3.7		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	1	65789093	115540829	Rat
1331800	Scl25	Serum cholesterol level QTL 25	3.013		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	1	94494440	117601394	Rat
7421628	Bp361	Blood pressure QTL 361		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	66023617	118608521	Rat
631495	Bp96	Blood pressure QTL 96	4.52		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	22340647	102268831	Rat
70225	Bp58	Blood pressure QTL 58	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32356093	162846471	Rat
2298545	Neuinf8	Neuroinflammation QTL 8	4.6		nervous system integrity trait (VT:0010566)	spinal cord beta-2 microglobulin mRNA level (CMO:0002125)	1	57336763	151090257	Rat
2313072	Bss53	Bone structure and strength QTL 53	4.3	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	1	43284731	118944897	Rat
10059597	Bp377	Blood pressure QTL 377	3.42	0.025	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32737458	199368955	Rat
2313078	Bss54	Bone structure and strength QTL 54	3.5	0.0001	tibia area (VT:1000281)	tibia midshaft cross-sectional area (CMO:0001717)	1	43284731	118944897	Rat
1302788	Scl19	Serum cholesterol QTL 19	4.6	0.001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	1	90532338	123479925	Rat
1549903	Bp267	Blood pressure QTL 267			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	77876254	106047988	Rat
2313083	Bmd74	Bone mineral density QTL 74	4	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	1	82174743	118944897	Rat
2313402	Anxrr24	Anxiety related response QTL 24			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	1	48963584	144267916	Rat
4889494	Scort2	Serum corticosterone level QTL 2	4.2		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	1	80592172	125592172	Rat
724567	Tcas6	Tongue tumor susceptibility QTL 6	6.85		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	1	92948896	144267916	Rat
61342	Bp27	Blood pressure QTL 27	3.4	0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	56732668	98773277	Rat
61344	Bp29	Blood pressure QTL 29	7.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	78350581	123350581	Rat
724521	Uae1	Urinary albumin excretion QTL 1	3.8	0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	90508614	173018436	Rat
1358902	Bw47	Body weight QTL 47	1.67		body mass (VT:0001259)	body weight (CMO:0000012)	1	90508614	180359386	Rat
1358192	Ept13	Estrogen-induced pituitary tumorigenesis QTL 13	3.4		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	1	77494165	122494165	Rat
2313094	Bss58	Bone structure and strength QTL 58	3.7	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	1	43284731	118944897	Rat
2300164	Bmd44	Bone mineral density QTL 44	5.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	1	56949932	101949932	Rat
2313099	Bss56	Bone structure and strength QTL 56	2.4	0.0001	tibia size trait (VT:0100001)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	1	43284731	118944897	Rat
2313098	Bmd70	Bone mineral density QTL 70	3.6	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	1	43284731	118944897	Rat
1300153	Bp171	Blood pressure QTL 171	3.37		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	90664883	143200202	Rat
731168	Bp154	Blood pressure QTL 154	3.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	94642644	214537671	Rat
738022	Anxrr13	Anxiety related response QTL 13	4.6	0.00039	locomotor behavior trait (VT:0001392)	measurement of voluntary locomotion into, out of, or within a discrete space in an open field apparatus (CMO:0001514)	1	83547917	128547917	Rat
152025249	Scl82	Serum cholesterol level QTL 82	4.77		blood cholesterol amount (VT:0000180)		1	50343510	99980958	Rat
10054135	Gmadr2	Adrenal mass QTL 2	1.97	0.0129	adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	77857876	122857876	Rat
7411712	Strs4	Sensitivity to stroke QTL 4	8.7		cerebrum integrity trait (VT:0010549)	percentage of study population developing cerebrovascular lesions during a period of time (CMO:0000932)	1	78430536	123430536	Rat
1331749	Hrtrt11	Heart rate QTL 11	2.973		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	1	94494440	198211706	Rat
1331751	Bp199	Blood pressure QTL 199	3.60022		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	94494440	181830018	Rat
2293142	Bp314	Blood pressure QTL 314			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	92184926	137184926	Rat
2313051	Bss57	Bone structure and strength QTL 57	3.7	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	1	43284731	118944897	Rat
724529	Cm16	Cardiac mass QTL 16	2.7		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	1	87580395	150700247	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_031102	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006229161	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC095693	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC084727	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CB577548	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473979	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DQ403026	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ211765	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ221110	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ222651	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ228615	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229922	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229993	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M20156	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000028555 ⟹ ENSRNOP00000028555

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	96,188,760 - 96,191,451 (+)	Ensembl
Rnor_6.0 Ensembl	1	101,701,975 - 101,703,550 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000097220 ⟹ ENSRNOP00000077861

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	96,188,826 - 96,191,452 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000098847 ⟹ ENSRNOP00000085693

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	96,188,770 - 96,191,452 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000103343 ⟹ ENSRNOP00000096539

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	96,188,112 - 96,191,452 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000116041 ⟹ ENSRNOP00000088224

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	96,188,841 - 96,191,450 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000116461 ⟹ ENSRNOP00000095503

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	96,188,112 - 96,191,452 (+)	Ensembl

RefSeq Acc Id:

NM_031102 ⟹ NP_112364

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	105,325,270 - 105,327,911 (+)	NCBI
mRatBN7.2	1	96,188,811 - 96,191,452 (+)	NCBI
Rnor_6.0	1	101,700,910 - 101,703,551 (+)	NCBI
Rnor_5.0	1	102,779,742 - 102,782,383 (+)	NCBI
RGSC_v3.4	1	96,186,553 - 96,189,194 (+)	RGD
Celera	1	90,442,010 - 90,444,651 (+)	RGD

Sequence:

show sequence

GCAGGAGGCGCCATCATGGGTGTTGACATTCGCCACAACAAGGACCGAAAGGTTCGGCGCAAGG
AGCCCAAGAGCCAGGATATCTACCTGCGGCTGCTAGTCAAGCTGTACAGGTTTCTGGCCAGACG
GACCAACTCCACCTTCAACCAGGTTGTGCTGAAAAGGTTATTTATGAGCCGAACTAACCGGCCA
CCTCTGTCCCTGTCCCGAATGATCCGGAAGATGAAGCTTCCTGGTCGGGAGAACAAAACTGCTG
TGGTTGTGGGGACGATCACAGATGATGTGCGGATTCTGGAAGTGCCCAAGCTGAAGGTGTGTGC
ACTGAGGGTGAGCAGCCGGGCCCGAAGTCGGATCCTCAAGGCTGGGGGTAAGATCCTGACCTTC
GACCAGCTGGCCCTGGAGTCTCCCAAGGGCAGGGGCACTGTGCTCTTGTCTGGTCCTCGGAAGG
GCCGAGAGGTGTACCGACACTTTGGCAAGGCCCCAGGAACTCCACACAGCCACACCAAACCCTA
TGTCCGTTCCAAGGGCCGGAAGTTCGAGCGTGCCAGAGGCCGAAGGGCCAGCCGAGGCTACAAA
AACTAACCCTGGCTCTTACTGTTAATAAAAAAGCTTTGGATGTTGAAAAAAAAAAAAAAAAAAA
AAAAAAAA

hide sequence

RefSeq Acc Id:

XM_006229161 ⟹ XP_006229223

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	105,325,269 - 105,327,911 (+)	NCBI
mRatBN7.2	1	96,189,300 - 96,191,452 (+)	NCBI
Rnor_6.0	1	101,701,001 - 101,703,551 (+)	NCBI
Rnor_5.0	1	102,779,742 - 102,782,383 (+)	NCBI

Sequence:

show sequence

GGAGGGGTGCGGGTGGTGCTATGGGAGACTGGAGGATAGTCTGGGGCCTTCAGCCGGGACTTAT
CGGAACCGATAGCCGGCCCCAGGAGCCTCCGGAGGCCCGTCGTTTTCTTTACAAAGTTTGACTC
CGTGATAACCAGCAAATTGCAACTCTCAATGACTCTAGTCTGGCCTCGAACCCACGGCAGCTCC
CTTGCCTCAATCTTTCCAGTGCCAGGATTCCAGGCGGGACCACTATGCCCGATTTCCGTGGTTC
TTAACTTGCATTTGGGAAGTTGAGTCCTACGGGGAGTGAAGCGCCACATTGCTGGGTTTGGGGA
CAAGCGGACGTCAGTCCTCCCCTCCGTACTTACCGGAACTGTGCTCCCAGTGTCTTTGGTCGGA
AGGGTGTGTAGTAATCCCGTCTGTTTTGTGAGTTGCGAAGATGCCTGCCGTAGGGTCTTGAAGG
TGCAAAGAAACTGCTGTTAGTATTTCGGTAATTACTTCTGGATGCTAACAGCTTTGAAAGGTGT
TGACATTCGCCACAACAAGGACCGAAAGGTTCGGCGCAAGGAGCCCAAGAGCCAGGATATCTAC
CTGCGGCTGCTAGTCAAGCTGTACAGGTTTCTGGCCAGACGGACCAACTCCACCTTCAACCAGG
TTGTGCTGAAAAGGTTATTTATGAGCCGAACTAACCGGCCACCTCTGTCCCTGTCCCGAATGAT
CCGGAAGATGAAGCTTCCTGGTCGGGAGAACAAAACTGCTGTGGTTGTGGGGACGATCACAGAT
GATGTGCGGATTCTGGAAGTGCCCAAGCTGAAGGTGTGTGCACTGAGGGTGAGCAGCCGGGCCC
GAAGTCGGATCCTCAAGGCTGGGGGTAAGATCCTGACCTTCGACCAGCTGGCCCTGGAGTCTCC
CAAGGGCAGGGGCACTGTGCTCTTGTCTGGTCCTCGGAAGGGCCGAGAGGTGTACCGACACTTT
GGCAAGGCCCCAGGAACTCCACACAGCCACACCAAACCCTATGTCCGTTCCAAGGGCCGGAAGT
TCGAGCGTGCCAGAGGCCGAAGGGCCAGCCGAGGCTACAAAAACTAACCCTGGCTCTTACTGTT
AATAAAAAAGCTTTGGATGTTGA

hide sequence

Protein Sequences


Protein RefSeqs	NP_112364	(Get FASTA)	NCBI Sequence Viewer
	XP_006229223	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA42070	(Get FASTA)	NCBI Sequence Viewer
	AAH84727	(Get FASTA)	NCBI Sequence Viewer
	ABD77159	(Get FASTA)	NCBI Sequence Viewer
	EDM07307	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000077861
	ENSRNOP00000088224
	ENSRNOP00000096539.1
GenBank Protein	P12001	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_112364 ⟸ NM_031102
- UniProtKB:	P12001 (UniProtKB/Swiss-Prot), A6JB77 (UniProtKB/TrEMBL), Q0QEW8 (UniProtKB/TrEMBL)
- Sequence:	show sequence MGVDIRHNKDRKVRRKEPKSQDIYLRLLVKLYRFLARRTNSTFNQVVLKRLFMSRTNRPPLSLS RMIRKMKLPGRENKTAVVVGTITDDVRILEVPKLKVCALRVSSRARSRILKAGGKILTFDQLAL ESPKGRGTVLLSGPRKGREVYRHFGKAPGTPHSHTKPYVRSKGRKFERARGRRASRGYKN hide sequence

RefSeq Acc Id:	XP_006229223 ⟸ XM_006229161
- Peptide Label:	isoform X1
- UniProtKB:	A0A8I6A4M9 (UniProtKB/TrEMBL), Q0QEW8 (UniProtKB/TrEMBL)
- Sequence:	show sequence MLTALKGVDIRHNKDRKVRRKEPKSQDIYLRLLVKLYRFLARRTNSTFNQVVLKRLFMSRTNRP PLSLSRMIRKMKLPGRENKTAVVVGTITDDVRILEVPKLKVCALRVSSRARSRILKAGGKILTF DQLALESPKGRGTVLLSGPRKGREVYRHFGKAPGTPHSHTKPYVRSKGRKFERARGRRASRGYK N hide sequence

Ensembl Acc Id:

ENSRNOP00000028555 ⟸ ENSRNOT00000028555

Ensembl Acc Id:

ENSRNOP00000085693 ⟸ ENSRNOT00000098847

Ensembl Acc Id:

ENSRNOP00000077861 ⟸ ENSRNOT00000097220

Ensembl Acc Id:

ENSRNOP00000096539 ⟸ ENSRNOT00000103343

Ensembl Acc Id:

ENSRNOP00000095503 ⟸ ENSRNOT00000116461

Ensembl Acc Id:

ENSRNOP00000088224 ⟸ ENSRNOT00000116041

Protein Domains

Large ribosomal subunit protein uL15/eL18

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P12001-F1-model_v2	AlphaFold	P12001	1-188	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:621182	AgrOrtholog
BioCyc Gene	G2FUF-59653	BioCyc
Ensembl Genes	ENSRNOG00000021035	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000097220	ENTREZGENE
	ENSRNOT00000103343.1	UniProtKB/Swiss-Prot
	ENSRNOT00000116041	ENTREZGENE
Gene3D-CATH	3.100.10.10	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7308070	IMAGE-MGC_LOAD
InterPro	L18e/L15P_sf	UniProtKB/Swiss-Prot
	Ribosomal_L18e	UniProtKB/Swiss-Prot
	Ribosomal_L18e/L15P	UniProtKB/Swiss-Prot
	Ribosomal_L18e_CS	UniProtKB/Swiss-Prot
KEGG Report	rno:81766	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:105408	IMAGE-MGC_LOAD
NCBI Gene	81766	ENTREZGENE
PANTHER	60S RIBOSOMAL PROTEIN L18	UniProtKB/Swiss-Prot
	PTHR10934	UniProtKB/Swiss-Prot
Pfam	Ribosomal_L18	UniProtKB/Swiss-Prot
PhenoGen	Rpl18	PhenoGen
PROSITE	RIBOSOMAL_L18E	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000021035	RatGTEx
Superfamily-SCOP	SSF52080	UniProtKB/Swiss-Prot
UniProt	A0A0H2UHS7_RAT	UniProtKB/TrEMBL
	A0A8I5YC25_RAT	UniProtKB/TrEMBL
	A0A8I6A4M9	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6B2T7_RAT	UniProtKB/TrEMBL
	A0A8I6GD73_RAT	UniProtKB/TrEMBL
	A6JB77	ENTREZGENE, UniProtKB/TrEMBL
	P12001	ENTREZGENE
	Q0QEW8	ENTREZGENE, UniProtKB/TrEMBL
	RL18_RAT	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2004-02-26	Rpl18	ribosomal protein L18			Symbol and Name status set to approved	625702	APPROVED
2002-08-07	Rpl18	ribosomal protein L18			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_homology	amino acid sequence has 87% identity to X. laevis ribosomal protein L14	633847

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations