Rab3c (RAB3C, member RAS oncogene family)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes Community Projects (beta) QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease Coronavirus Disease Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Presentations Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Rab3c (RAB3C, member RAS oncogene family) Rattus norvegicus

Analyze

Symbol:

Rab3c

Name:

RAB3C, member RAS oncogene family

RGD ID:

620923

Description:

Predicted to enable GTP-dependent protein binding activity; GTPase activity; and myosin V binding activity. Predicted to be involved in antigen processing and presentation. Predicted to act upstream of or within regulation of exocytosis. Is active in synaptic vesicle membrane. Orthologous to human RAB3C (RAB3C, member RAS oncogene family); INTERACTS WITH 17alpha-ethynylestradiol; ammonium chloride; atrazine.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

ras-related protein Rab-3C

RGD Orthologs

Alliance Genes

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	2	41,627,720 - 41,843,541 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	41,627,720 - 41,843,749 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	48,731,477 - 48,966,584 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	46,790,202 - 47,025,307 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	41,643,172 - 41,878,316 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	41,570,955 - 41,786,681 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	41,570,597 - 41,785,792 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	60,627,266 - 60,843,345 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	41,457,252 - 41,672,559 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	2	41,377,620 - 41,592,928 (-)	NCBI
Celera	2	37,457,041 - 37,671,693 (-)	NCBI		Celera
Cytogenetic Map	2	q14	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

genetic disease (ISO)

Neurodevelopmental Disorders (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dichloroethane (ISO)

17alpha-ethynylestradiol (EXP,ISO)

17beta-estradiol (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

aflatoxin B1 (ISO)

ammonium chloride (EXP)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

atrazine (EXP)

belinostat (ISO)

benzo[a]pyrene (ISO)

benzo[b]fluoranthene (ISO)

benzo[e]pyrene (ISO)

bisphenol A (EXP,ISO)

buta-1,3-diene (ISO)

cadmium atom (ISO)

carbon nanotube (ISO)

chlordecone (ISO)

chloroprene (ISO)

cocaine (EXP)

cyclosporin A (ISO)

decabromodiphenyl ether (EXP,ISO)

dimethyl sulfoxide (ISO)

dorsomorphin (ISO)

ethanol (ISO)

folic acid (ISO)

fonofos (ISO)

lead(0) (ISO)

lipopolysaccharide (ISO)

malathion (ISO)

methapyrilene (ISO)

methylmercury chloride (ISO)

O-methyleugenol (ISO)

ozone (ISO)

p-chloromercuribenzoic acid (ISO)

panobinostat (ISO)

paracetamol (ISO)

parathion (ISO)

phenobarbital (ISO)

phenylmercury acetate (ISO)

rotenone (EXP)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

SB 431542 (ISO)

silicon dioxide (ISO)

silver atom (ISO)

silver(0) (ISO)

sodium fluoride (ISO)

terbufos (ISO)

tipifarnib (EXP)

trichostatin A (ISO)

triptonide (ISO)

valproic acid (ISO)

vinclozolin (EXP)

vorinostat (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

antigen processing and presentation (ISO)

intracellular protein transport (IEA)

protein localization to plasma membrane (IBA)

protein secretion (IBA)

regulation of exocytosis (IBA,ISO)

vesicle docking involved in exocytosis (IBA)

Cellular Component

endosome (IBA)

perinuclear region of cytoplasm (ISO)

plasma membrane (IBA,IEA)

secretory vesicle (IEA)

synaptic vesicle (IBA,ISO)

synaptic vesicle membrane (IDA,IEP)

vesicle (ISO)

Molecular Function

GTP binding (IEA)

GTP-dependent protein binding (ISO)

GTPase activity (IBA,IEA,ISO)

myosin V binding (IBA,ISO)

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Insulin and okadaic acid induce Rab4 redistribution in adipocytes.	Cormont M, etal., J Biol Chem. 1993 Sep 15;268(26):19491-7.
2.	Rab3C is a synaptic vesicle protein that dissociates from synaptic vesicles after stimulation of exocytosis.	Fischer von Mollard G, etal., J Biol Chem. 1994 Apr 15;269(15):10971-4.
3.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
5.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
6.	GOA pipeline	RGD automated data pipeline
7.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
8.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
9.	Cloning and tissue expression of the rat RAB 3C GTP-binding protein.	Viggeswarapu M and Wildey GM, Biochem Biophys Res Commun 1996 Oct 23;227(3):645-50.
10.	Isolation and characterization of a GDP/GTP exchange protein specific for the Rab3 subfamily small G proteins.	Wada M, etal., J Biol Chem 1997 Feb 14;272(7):3875-8.
11.	The RIM/NIM family of neuronal C2 domain proteins. Interactions with Rab3 and a new class of Src homology 3 domain proteins.	Wang Y, etal., J Biol Chem 2000 Jun 30;275(26):20033-44.

Additional References at PubMed

PMID:8841986	PMID:9252191	PMID:12167638	PMID:12192047	PMID:19717423	PMID:21262767	PMID:22871113	PMID:24006491	PMID:24625528	PMID:24891604	PMID:29476059

Genomics

Comparative Map Data

Rab3c
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	2	41,627,720 - 41,843,541 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	41,627,720 - 41,843,749 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	48,731,477 - 48,966,584 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	46,790,202 - 47,025,307 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	41,643,172 - 41,878,316 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	41,570,955 - 41,786,681 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	41,570,597 - 41,785,792 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	60,627,266 - 60,843,345 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	41,457,252 - 41,672,559 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	2	41,377,620 - 41,592,928 (-)	NCBI
Celera	2	37,457,041 - 37,671,693 (-)	NCBI		Celera
Cytogenetic Map	2	q14	NCBI

RAB3C
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	5	58,582,152 - 58,859,394 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	5	58,582,221 - 58,859,394 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	5	57,877,979 - 58,155,221 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	5	57,914,696 - 58,183,163 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	5	57,914,695 - 58,183,162	NCBI
Celera	5	54,817,320 - 55,087,837 (+)	NCBI		Celera
Cytogenetic Map	5	q11.2	NCBI
HuRef	5	54,835,744 - 55,104,743 (+)	NCBI		HuRef
CHM1_1	5	57,878,581 - 58,147,206 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	5	59,399,478 - 59,677,989 (+)	NCBI		T2T-CHM13v2.0

Rab3c
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	13	110,190,721 - 110,417,530 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	13	110,190,721 - 110,417,530 (-)	Ensembl		GRCm39 Ensembl
GRCm38	13	110,054,187 - 110,280,996 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	13	110,054,187 - 110,280,996 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	13	110,844,395 - 111,070,414 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	13	111,181,960 - 111,400,980 (-)	NCBI		MGSCv36	mm8
Celera	13	114,388,532 - 114,614,165 (-)	NCBI		Celera
Cytogenetic Map	13	D2.1	NCBI
cM Map	13	61.19	NCBI

Rab3c
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955446	9,343,388 - 9,578,209 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955446	9,335,298 - 9,577,919 (-)	NCBI	ChiLan1.0	ChiLan1.0

RAB3C
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	5	53,214,677 - 53,493,015 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	5	55,150,508 - 55,428,094 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	5	56,787,165 - 57,063,795 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	5	56,795,195 - 57,062,710 (-)	Ensembl	panpan1.1		panPan2

RAB3C
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	2	45,459,068 - 45,731,994 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	2	45,440,473 - 45,725,487 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	2	42,530,424 - 42,803,381 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	2	45,944,023 - 46,220,176 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	2	45,925,423 - 46,220,176 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	2	43,014,052 - 43,287,216 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	2	43,820,186 - 44,092,814 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	2	44,640,261 - 44,913,449 (+)	NCBI		UU_Cfam_GSD_1.0

Rab3c
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024407213	200,393,137 - 200,649,380 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936480	9,337,166 - 9,585,960 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936480	9,559,485 - 9,585,893 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

RAB3C
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	16	37,412,909 - 37,728,502 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	16	37,411,931 - 37,729,583 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	16	40,179,105 - 40,489,378 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

RAB3C
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	4	54,741,211 - 55,028,023 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666049	3,657,742 - 3,953,967 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Rab3c
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624759	429,941 - 677,324 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624759	421,978 - 678,433 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Rab3c
1533 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	139
Count of miRNA genes:	116
Interacting mature miRNAs:	124
Transcripts:	ENSRNOT00000015871
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
61355	Bp36	Blood pressure QTL 36	2.9		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	2	5873687	102844969	Rat
1600379	Mcs18	Mammary carcinoma susceptibility QTL 18	2.6		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	2	7887772	42804738	Rat
738012	Anxrr3	Anxiety related response QTL 3	3.8		exploratory behavior trait (VT:0010471)	percentage of entries into a discrete space in an experimental apparatus (CMO:0000961)	2	9023519	54023519	Rat
10755430	Coatc6	Coat color QTL 6		0.02576	coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	2	11591100	56591100	Rat
1578664	Bmd9	Bone mineral QTL density 9	5		femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	2	11852062	49003364	Rat
731184	Mamtr4	Mammary tumor resistance QTL 4		0.0003	mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	2	16491740	61491740	Rat
1357990	Ael1	Aortic elastin QTL 1	3.1	0.00091	aorta elastin amount (VT:0003905)	aortic elastin	2	19076825	64076825	Rat
731167	Glom4	Glomerulus QTL 4	2.4	0.0082	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002)	2	20304672	65304672	Rat
2300168	Bmd47	Bone mineral density QTL 47	6.6	0.0001	femur mineral mass (VT:0010011)	bone mineral density (CMO:0001226)	2	20662448	65662448	Rat
10402051	Gdil2	Gastrointestinal dilation QTL 2			enteric ganglion morphology trait (VT:0001045)	length of intestine affected by colonic aganglionosis to total length of colon ratio (CMO:0001836)	2	24903853	74786777	Rat
1302794	Stl27	Serum triglyceride level QTL 27	4.4	0.0001	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	2	25413423	143657569	Rat
1358894	Kidm24	Kidney mass QTL 24	4.03		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	25413423	157142209	Rat
1358899	Kidm23	Kidney mass QTL 23	3.88		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	25413423	157142209	Rat
1358901	Cm38	Cardiac mass QTL 38	2		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	157142209	Rat
1358904	Cm39	Cardiac mass QTL 39	2.26		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	157142209	Rat
1358910	Kidm27	Kidney mass QTL 27	5.77		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	25413423	157142209	Rat
1358911	Kidm28	Kidney mass QTL 28	5.42		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	25413423	157142209	Rat
1358913	Cm41	Cardiac mass QTL 41	2.73		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	203928301	Rat
1358917	Cm42	Cardiac mass QTL 42	2.82		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	203928301	Rat
1358887	Bw50	Body weight QTL 50	2.39		body mass (VT:0001259)	body weight (CMO:0000012)	2	25413652	157142078	Rat
1358908	Bw49	Body weight QTL 49	3.36		body mass (VT:0001259)	body weight (CMO:0000012)	2	25413652	157142078	Rat
1354617	Bp240	Blood pressure QTL 240	4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	26917817	81754745	Rat
1354617	Bp240	Blood pressure QTL 240	4		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	26917817	81754745	Rat
1354617	Bp240	Blood pressure QTL 240	4		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	26917817	81754745	Rat
1354603	Bp243	Blood pressure QTL 243	3.9		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	26917817	127469484	Rat
2290453	Scl55	Serum cholesterol level QTL 55	2.83		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	2	26917817	136917119	Rat
1331764	Bp205	Blood pressure QTL 205	3.476		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	26999571	43154682	Rat
1643006	Pain1	Pain QTL 1	3.63	0.005	mechanical nociception trait (VT:0002734)	self mutilation severity score (CMO:0002145)	2	26999571	48268661	Rat
9590095	Sffal3	Serum free fatty acids level QTL 3	6.78	0.001	blood free fatty acid amount (VT:0001553)	plasma free fatty acids level (CMO:0000546)	2	27157160	72157160	Rat
1300160	Hrtrt3	Heart rate QTL 3	3.62		heart pumping trait (VT:2000009)	absolute change in heart rate (CMO:0000534)	2	29971593	51729300	Rat
10755434	Coatc7	Coat color QTL 7		0.04794	coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	2	30648065	75648065	Rat
731179	Mamtr3	Mammary tumor resistance QTL 3		0.0001	mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	2	32373770	43665178	Rat
10755436	Coatc8	Coat color QTL 8		0.02431	coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	2	35023117	80023117	Rat
61371	Edpm1	Estrogen-dependent pituitary mass QTL 1	4	0.05	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	2	35134841	88029593	Rat
70174	BpQTLCluster2	Blood pressure QTL cluster 2	4.24		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	40067944	102785628	Rat
70174	BpQTLCluster2	Blood pressure QTL cluster 2	4.24		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	40067944	102785628	Rat
70174	BpQTLCluster2	Blood pressure QTL cluster 2	4.24		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	40067944	102785628	Rat
70174	BpQTLCluster2	Blood pressure QTL cluster 2	4.24		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	2	40067944	102785628	Rat
70174	BpQTLCluster2	Blood pressure QTL cluster 2	4.24		arterial blood pressure trait (VT:2000000)	absolute change in mean arterial blood pressure (CMO:0000533)	2	40067944	102785628	Rat
12879863	Bp402	Blood pressure QTL 402		0.003	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	41125789	56532139	Rat

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium			2						68
Low	2	7	23	9	18	9	5	6	6	9	24	10	5
Below cutoff	1	9	5	5	1	5	3	4		24	13	1	3

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_133536	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008760719	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039101613	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039101615	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039101616	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473955	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	D78197	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000065	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U37099	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U54807	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000015871 ⟹ ENSRNOP00000015871

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	41,627,720 - 41,843,749 (-)	Ensembl
Rnor_6.0 Ensembl	2	41,570,597 - 41,785,792 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000086851 ⟹ ENSRNOP00000073277

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	41,627,720 - 41,824,745 (-)	Ensembl
Rnor_6.0 Ensembl	2	41,571,186 - 41,784,929 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000116600 ⟹ ENSRNOP00000096986

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	41,627,720 - 41,842,670 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000118628 ⟹ ENSRNOP00000094469

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	41,638,724 - 41,842,573 (-)	Ensembl

RefSeq Acc Id:

NM_133536 ⟹ NP_598220

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	2	41,627,720 - 41,842,573 (-)	NCBI
Rnor_6.0	2	41,570,955 - 41,785,702 (-)	NCBI
Rnor_5.0	2	60,627,266 - 60,843,345 (-)	NCBI
RGSC_v3.4	2	41,457,252 - 41,672,559 (-)	RGD
Celera	2	37,457,041 - 37,671,693 (-)	RGD

Sequence:

show sequence

GCAGAGAGCGCTCAGGCTGTGCACGCTTGACCAGGCTCCCGGACCAGAGCTGTCCTAGCAAGAG
AGAAAAGGACATTTGCCTACAATGAGACACGAGGCGCCCATGCAGATGGCCTCGGCACAAGATG
CCAGGTTTGGTCAGAAAGACTCTTCTGACCAGAACTTCGACTACATGTTCAAGTTGCTGATCAT
TGGCAATAGCAGCGTGGGCAAAACATCCTTCCTGTTCCGCTATGCTGATGACTCCTTCACGTCT
GCCTTTGTCAGCACGGTCGGCATCGATTTCAAAGTAAAAACTGTCTTCAAAAATGAAAAGAGAA
TCAAGCTTCAGATTTGGGACACAGCAGGCCAGGAAAGATACAGGACCATCACCACAGCCTATTA
TCGAGGGGCCATGGGCTTCATTTTAATGTATGACATCACAAATGAAGAATCCTTCAACGCTGTA
CAAGATTGGTCAACTCAGATCAAAACATATTCCTGGGATAATGCCCAGGTTATACTGGTCGGAA
ACAAATGTGACATGGAAGACGAACGGGTGGTCTCAACTGAGAGAGGGCGCCACTTAGGAGAGCA
GCTCGGGTTTGAGTTTTTTGAAACCAGCGCCAAGGATAACATCAACGTGAAGCAAACCTTTGAG
CGCCTCGTAGATATCATCTGTGACAAAATGTCAGAGAGCTTGGAGACTGACCCAGCCATCACAG
GCGCCAAGCAGAGCACGAGGCTCAAGGAAACCCCTCCTCCACCACAGCCCAACTGTGGCTGCTA
ATGTCCCCCCGCACAGGAGCTCCAAGGGCCCCCAGAGCAGCCAAGAAACCGCATTTATAAATGG
TCTATTAGCCTTCAATCATACTGCCTAATAATTATTTGAAGGAAGTCTTTGATGTCAGTGGCCC
ATATATGCATTCAAACCGTGAGCAATTTCCTGTGGTAATATGTGGCGAATTTGCTCTTATATTT
GTAAGGATTATTCATCTATAAACACCTGCTACTTGCA

hide sequence

RefSeq Acc Id:

XM_008760719 ⟹ XP_008758941

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	2	41,627,720 - 41,843,541 (-)	NCBI
Rnor_6.0	2	41,570,955 - 41,786,681 (-)	NCBI

Sequence:

show sequence

GAGTAGGGGAGGGGCTGCCTGGCGCTGGTGCCCCTGGCACTTCCTAGGAGACTCACAGCCCTTT
CTTTGCAGCTGTCACTAGAAGACTTCTGGGTTTCCCTCTGGAAGAAAGCCTCCCATCTAAGCCT
GCTGCCCTTCCATCCCTTATTCGCTCTCTGCAAACCGCTCCTCCAAGCCTTTCCATTGTGCTCT
GCCTCCAGCATAAGACCTTCACCTCCTTTGTAGTGGGGAGACTTACTTGAGGCTCTCTGAACCT
CCGGCTGCAATGGAGCTGTATGGAAAGATGGCCTCGGCACAAGATGCCAGGTTTGGTCAGAAAG
ACTCTTCTGACCAGAACTTCGACTACATGTTCAAGTTGCTGATCATTGGCAATAGCAGCGTGGG
CAAAACATCCTTCCTGTTCCGCTATGCTGATGACTCCTTCACGTCCGCCTTTGTCAGCACGGTC
GGCATCGATTTCAAAGTAAAAACTGTCTTCAAAAATGAAAAGAGAATCAAGCTTCAGATTTGGG
ACACAGCAGGCCAGGAAAGATACAGGACCATCACCACAGCCTATTATCGAGGGGCCATGGGCTT
CATTTTAATGTATGACATCACAAATGAAGAATCCTTCAACGCTGTACAAGATTGGTCAACTCAG
ATCAAAACATATTCCTGGGATAATGCCCAGGTTATCCTGGCCGGAAACAAATGTGACATGGAAG
ACGAACGGGTGGTCTCAACTGAGAGAGGGCAGCGCTTAGGAGAGCAGCTCGGGTTTGAGTTTTT
TGAAACCAGCGCCAAGGATAACATCAACGTGAAGCAAACCTTTGAGCGCCTCGTAGATATCATC
TGTGACAAAATGTCAGAGAGCTTGGAGACTGACCCAGCCATCACAGCCGCCAAGCAGAGCACGA
GGCTCAAGGAAACCCCTCCTCCACCACAGCCCAACTGTGGCTGCTAATGTCCCCCCGCACAGGA
GCTCCAAGGGGCTCCAGAGCAGCCAAGAAACAGCATTTATAAATGGTCTATTAGCCTTCAATCA
TACTGCCTAATAATTATTTGAAGGAAGTCTTTGATGTCAGTGGCCCATATATGCATTCAAACCA
TGAGCAATTTCCTGTGGTAATATGTGGCGAATTTGCTCTTATATTTGTAAGGATTATTCATCTA
TAAACACCTGCTACTTGCA

hide sequence

RefSeq Acc Id:

XM_039101613 ⟹ XP_038957541

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	2	41,627,720 - 41,841,900 (-)	NCBI

RefSeq Acc Id:

XM_039101615 ⟹ XP_038957543

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	2	41,627,720 - 41,842,672 (-)	NCBI

RefSeq Acc Id:

XM_039101616 ⟹ XP_038957544

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	2	41,627,720 - 41,819,496 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_598220	(Get FASTA)	NCBI Sequence Viewer
	XP_008758941	(Get FASTA)	NCBI Sequence Viewer
	XP_038957541	(Get FASTA)	NCBI Sequence Viewer
	XP_038957543	(Get FASTA)	NCBI Sequence Viewer
	XP_038957544	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAC52704	(Get FASTA)	NCBI Sequence Viewer
	AAC52879	(Get FASTA)	NCBI Sequence Viewer
	BAA11302	(Get FASTA)	NCBI Sequence Viewer
	EDM10329	(Get FASTA)	NCBI Sequence Viewer
	EDM10330	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000015871
	ENSRNOP00000015871.4
	ENSRNOP00000073277
	ENSRNOP00000073277.2
	ENSRNOP00000094469.1
	ENSRNOP00000096986
GenBank Protein	P62824	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_598220 ⟸ NM_133536

- UniProtKB:

A0A8L2R781 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MRHEAPMQMASAQDARFGQKDSSDQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVG
IDFKVKTVFKNEKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQI
KTYSWDNAQVILVGNKCDMEDERVVSTERGRHLGEQLGFEFFETSAKDNINVKQTFERLVDIIC
DKMSESLETDPAITGAKQSTRLKETPPPPQPNCGC

hide sequence

RefSeq Acc Id:	XP_008758941 ⟸ XM_008760719
- Peptide Label:	isoform X2
- UniProtKB:	A0A8L2Q7P7 (UniProtKB/TrEMBL), A6I5M1 (UniProtKB/TrEMBL), A0A8L2R781 (UniProtKB/TrEMBL)
- Sequence:	show sequence MELYGKMASAQDARFGQKDSSDQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGID FKVKTVFKNEKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKT YSWDNAQVILAGNKCDMEDERVVSTERGQRLGEQLGFEFFETSAKDNINVKQTFERLVDIICDK MSESLETDPAITAAKQSTRLKETPPPPQPNCGC hide sequence

RefSeq Acc Id:

ENSRNOP00000015871 ⟸ ENSRNOT00000015871

RefSeq Acc Id:

ENSRNOP00000073277 ⟸ ENSRNOT00000086851

RefSeq Acc Id:	XP_038957543 ⟸ XM_039101615
- Peptide Label:	isoform X3
- UniProtKB:	A0A8L2R781 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038957541 ⟸ XM_039101613
- Peptide Label:	isoform X1
- UniProtKB:	P62824 (UniProtKB/Swiss-Prot), A6I5M2 (UniProtKB/TrEMBL), A0A8L2R781 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038957544 ⟸ XM_039101616
- Peptide Label:	isoform X4

RefSeq Acc Id:

ENSRNOP00000096986 ⟸ ENSRNOT00000116600

RefSeq Acc Id:

ENSRNOP00000094469 ⟸ ENSRNOT00000118628

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P62824-F1-model_v2	AlphaFold	P62824	1-227	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:620923	AgrOrtholog
BioCyc Gene	G2FUF-54437	BioCyc
Ensembl Genes	ENSRNOG00000011623	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000015871	ENTREZGENE
	ENSRNOT00000015871.7	UniProtKB/TrEMBL
	ENSRNOT00000086851	ENTREZGENE
	ENSRNOT00000086851.2	UniProtKB/TrEMBL
	ENSRNOT00000116600	ENTREZGENE, UniProtKB/Swiss-Prot
	ENSRNOT00000118628.1	UniProtKB/TrEMBL
Gene3D-CATH	3.40.50.300	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	P-loop_NTPase	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Rab3	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Small_GTP-bd_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Small_GTPase	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:171058	UniProtKB/Swiss-Prot
NCBI Gene	171058	ENTREZGENE
PANTHER	LD44762P	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	RAS-RELATED PROTEIN RAB-3C	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Ras	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Rab3c	PhenoGen
PRINTS	RASTRNSFRMNG	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	RAB	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	RAS	UniProtKB/TrEMBL
	RHO	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000011623	RatGTEx
SMART	RAB	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	RAN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	RAS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	RHO	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF52540	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A8I6AM94_RAT	UniProtKB/TrEMBL
	A0A8L2Q7P7	ENTREZGENE, UniProtKB/TrEMBL
	A0A8L2R781	ENTREZGENE, UniProtKB/TrEMBL
	A6I5M1	ENTREZGENE, UniProtKB/TrEMBL
	A6I5M2	ENTREZGENE, UniProtKB/TrEMBL
	P62824	ENTREZGENE, UniProtKB/Swiss-Prot
UniProt Secondary	Q62858	UniProtKB/Swiss-Prot
	Q62974	UniProtKB/Swiss-Prot
	Q63482	UniProtKB/Swiss-Prot
	Q9CXQ1	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2004-02-26	Rab3c	RAB3C, member RAS oncogene family			Symbol and Name status set to approved	625702	APPROVED
2002-08-07	Rab3c	RAB3C, member RAS oncogene family			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar