Advanced Search (OLGA)

Gene: Rab3b (RAB3B, member RAS oncogene family) Rattus norvegicus

Analyze

Symbol:

Rab3b

Name:

RAB3B, member RAS oncogene family

RGD ID:

620922

Description:

Predicted to enable several functions, including GDP binding activity; GTP-dependent protein binding activity; and myosin V binding activity. Predicted to be involved in several processes, including positive regulation of dopamine uptake involved in synaptic transmission; regulation of synaptic vesicle cycle; and regulation of vesicle size. Predicted to act upstream of or within peptidyl-cysteine methylation and regulation of exocytosis. Is active in synaptic vesicle membrane. Orthologous to human RAB3B (RAB3B, member RAS oncogene family); INTERACTS WITH 1,1,1-trichloro-2,2-bis(4-hydroxyphenyl)ethane; 2,3,7,8-tetrachlorodibenzodioxine; 3',5'-cyclic AMP.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

ras-related protein Rab-3B

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	RAB3B (RAB3B, member RAS oncogene family)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Rab3b (RAB3B, member RAS oncogene family)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Rab3b (RAB3B, member RAS oncogene family)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	RAB3B (RAB3B, member RAS oncogene family)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	RAB3B (RAB3B, member RAS oncogene family)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Rab3b (RAB3B, member RAS oncogene family)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	RAB3B (RAB3B, member RAS oncogene family)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	RAB3B (RAB3B, member RAS oncogene family)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Rab3b (RAB3B, member RAS oncogene family)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	RAB3C (RAB3C, member RAS oncogene family)	HGNC	OrthoDB
Homo sapiens (human):	RAB3A (RAB3A, member RAS oncogene family)	HGNC	OrthoDB
Alliance orthologs ³
Homo sapiens (human):	RAB3B (RAB3B, member RAS oncogene family)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Rab3b (RAB3B, member RAS oncogene family)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	rab3b (RAB3B, member RAS oncogene family)	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	SEC4	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER)
Caenorhabditis elegans (roundworm):	rab-3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Rab3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	rab3b	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	rab3b	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	128,859,034 - 128,926,087 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	5	128,841,716 - 128,926,086 (+)	Ensembl				GRCr8
mRatBN7.2	5	123,629,562 - 123,697,410 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	123,644,423 - 123,697,401 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	5	126,253,240 - 126,320,296 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	127,976,344 - 128,043,394 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	128,027,632 - 128,094,680 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	128,501,789 - 128,568,170 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	128,501,847 - 128,568,188 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	5	132,343,152 - 132,408,838 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	5	130,185,155 - 130,284,038 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	5	122,364,678 - 122,431,394 (+)	NCBI		Celera
RGSC_v3.1	5	130,229,349 - 130,288,894 (+)	NCBI
Cytogenetic Map	5	q34	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,1,1-trichloro-2,2-bis(4-hydroxyphenyl)ethane (EXP)

1,2-dimethylhydrazine (ISO)

17beta-estradiol (ISO)

17beta-hydroxy-5alpha-androstan-3-one (ISO)

2,3',4,4',5-Pentachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2-bromohexadecanoic acid (ISO)

2-hydroxypropanoic acid (ISO)

3',5'-cyclic AMP (EXP)

3,3',5-triiodo-L-thyronine (ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

6-propyl-2-thiouracil (EXP)

aflatoxin B1 (ISO)

aldehydo-D-glucose (ISO)

all-trans-retinoic acid (ISO)

alpha-Zearalanol (EXP)

amitrole (EXP)

ammonium chloride (EXP)

arsenite(3-) (ISO)

atrazine (ISO)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (EXP,ISO)

bisphenol A (ISO)

butanal (ISO)

Butylbenzyl phthalate (EXP)

C60 fullerene (EXP)

cadmium atom (ISO)

cadmium dichloride (ISO)

carbon nanotube (ISO)

CGP 52608 (ISO)

chlorpyrifos (ISO)

cisplatin (EXP,ISO)

copper(II) sulfate (ISO)

cyclosporin A (ISO)

D-glucose (ISO)

decabromodiphenyl ether (EXP)

dexamethasone (ISO)

dibutyl phthalate (EXP)

dichlorine (EXP)

diethyl phthalate (EXP)

diethylstilbestrol (ISO)

diisobutyl phthalate (EXP)

diisononyl phthalate (EXP)

disodium selenite (ISO)

dorsomorphin (ISO)

doxorubicin (ISO)

ethanol (ISO)

fenamidone (ISO)

flavonoids (EXP)

folic acid (ISO)

geldanamycin (ISO)

gentamycin (EXP)

glucose (ISO)

GSK-J4 (ISO)

hydroquinone (ISO)

indometacin (ISO)

ivermectin (ISO)

ketoconazole (ISO)

L-ascorbic acid (EXP,ISO)

lead(0) (ISO)

methimazole (EXP)

methylmercury chloride (ISO)

nickel atom (ISO)

okadaic acid (ISO)

ozone (EXP)

paracetamol (EXP)

paraquat (EXP)

pentanal (ISO)

perfluorohexanesulfonic acid (ISO)

perfluorooctanoic acid (EXP)

phenylephrine (EXP)

pirinixic acid (ISO)

progesterone (ISO)

propanal (ISO)

quercetin (ISO)

rac-lactic acid (ISO)

SB 431542 (ISO)

Se-methyl-L-selenocysteine (ISO)

Se-methylselenocysteine (ISO)

silicon dioxide (ISO)

sodium arsenite (ISO)

sodium fluoride (ISO)

streptozocin (ISO)

sulfadimethoxine (EXP)

temozolomide (ISO)

tetrachloromethane (EXP)

thapsigargin (EXP)

thimerosal (ISO)

titanium dioxide (ISO)

torcetrapib (ISO)

triadimefon (ISO)

tributylstannane (EXP)

trichostatin A (EXP,ISO)

urethane (ISO)

valproic acid (ISO)

vorinostat (ISO)

zidovudine (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

antigen processing and presentation (IEA,ISO)

exocytosis (IBA,IEA)

peptidyl-cysteine methylation (ISO)

positive regulation of dopamine uptake involved in synaptic transmission (IEA,ISO)

protein transport (IEA)

regulation of exocytosis (IEA,ISO,TAS)

regulation of synaptic vesicle cycle (IEA,ISO)

regulation of vesicle size (IEA,ISO)

Cellular Component

cytoplasm (IEA,ISO)

dopaminergic synapse (IEA,ISO)

endosome (IBA)

Golgi apparatus (IEA)

membrane (IEA)

perinuclear region of cytoplasm (IEA,ISO)

plasma membrane (IBA,IEA)

secretory granule (IEA,ISO)

synaptic vesicle (IBA,IEA,ISO)

synaptic vesicle membrane (EXP,IDA,IEA,IEP,ISO)

vesicle (IEA,ISO)

Molecular Function

GDP binding (IEA,ISO)

GTP binding (IEA,NAS)

GTP-dependent protein binding (IEA,ISO)

GTPase activity (IBA,IEA,ISO)

hydrolase activity (IEA)

metal ion binding (IEA)

myosin V binding (IBA,IEA,ISO)

nucleotide binding (IEA)

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Insulin and okadaic acid induce Rab4 redistribution in adipocytes.	Cormont M, etal., J Biol Chem. 1993 Sep 15;268(26):19491-7.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
4.	Differential expression of Rab3 isoforms during differentiation of pancreatic acinar cell line AR42J.	Klengel R, etal., Biochem Biophys Res Commun 1997 Jul 30;236(3):719-22.
5.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
6.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
7.	Quantitative analysis of synaptic vesicle Rabs uncovers distinct yet overlapping roles for Rab3a and Rab27b in Ca2+-triggered exocytosis.	Pavlos NJ, etal., J Neurosci. 2010 Oct 6;30(40):13441-53. doi: 10.1523/JNEUROSCI.0907-10.2010.
8.	GOA pipeline	RGD automated data pipeline
9.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
10.	Molecular anatomy of a trafficking organelle.	Takamori S, etal., Cell. 2006 Nov 17;127(4):831-46.

Additional References at PubMed

PMID:7508866	PMID:7532276	PMID:8889548	PMID:9252191	PMID:10748113	PMID:11121396	PMID:12167638	PMID:12192047	PMID:12477932	PMID:16043482	PMID:16822953	PMID:19056867
PMID:19717423	PMID:20007772	PMID:20807725	PMID:21262767	PMID:22321395	PMID:23533145	PMID:24006491	PMID:24891604	PMID:28131823	PMID:29476059

Genomics

Comparative Map Data

Rab3b
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	128,859,034 - 128,926,087 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	5	128,841,716 - 128,926,086 (+)	Ensembl				GRCr8
mRatBN7.2	5	123,629,562 - 123,697,410 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	123,644,423 - 123,697,401 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	5	126,253,240 - 126,320,296 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	127,976,344 - 128,043,394 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	128,027,632 - 128,094,680 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	128,501,789 - 128,568,170 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	128,501,847 - 128,568,188 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	5	132,343,152 - 132,408,838 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	5	130,185,155 - 130,284,038 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	5	122,364,678 - 122,431,394 (+)	NCBI		Celera
RGSC_v3.1	5	130,229,349 - 130,288,894 (+)	NCBI
Cytogenetic Map	5	q34	NCBI

RAB3B
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	51,907,956 - 51,990,700 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	51,907,956 - 51,990,700 (-)	Ensembl			hg38	GRCh38
GRCh37	1	52,373,628 - 52,456,372 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	52,157,420 - 52,228,936 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	1	52,096,857 - 52,168,369	NCBI
Celera	1	50,660,966 - 50,743,913 (-)	NCBI		Celera
Cytogenetic Map	1	p32.3	NCBI
HuRef	1	50,490,781 - 50,573,849 (-)	NCBI		HuRef
CHM1_1	1	52,491,166 - 52,573,953 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	1	51,789,104 - 51,872,214 (-)	NCBI		T2T-CHM13v2.0

Rab3b
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	108,736,267 - 108,800,521 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	108,736,260 - 108,800,521 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	4	108,879,070 - 108,943,324 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	108,879,063 - 108,943,324 (+)	Ensembl			mm10	GRCm38
MGSCv37	4	108,551,675 - 108,615,929 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	4	108,377,002 - 108,441,256 (+)	NCBI		MGSCv36	mm8
Celera	4	107,216,795 - 107,279,795 (+)	NCBI		Celera
Cytogenetic Map	4	C7	NCBI
cM Map	4	50.67	NCBI

Rab3b
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955464	7,117,883 - 7,177,534 (+)	Ensembl
ChiLan1.0	NW_004955464	7,117,908 - 7,177,138 (+)	NCBI	ChiLan1.0	ChiLan1.0

RAB3B
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	174,868,518 - 174,951,571 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	174,010,062 - 174,093,098 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	51,170,956 - 51,242,828 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	52,655,120 - 52,737,856 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	52,666,713 - 52,723,975 (-)	Ensembl			panPan2	panpan1.1

RAB3B
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	15	9,305,495 - 9,378,003 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	15	9,319,057 - 9,372,518 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	15	9,452,491 - 9,534,833 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	15	9,425,030 - 9,507,475 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	15	9,386,741 - 9,503,119 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	15	9,235,627 - 9,317,897 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	15	9,324,977 - 9,407,250 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	15	9,342,565 - 9,424,929 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Rab3b
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	66,430,985 - 66,491,578 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936522	8,924,617 - 8,989,734 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936522	8,924,724 - 8,985,309 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

RAB3B
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	160,194,555 - 160,255,632 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	6	160,194,488 - 160,255,635 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	147,898,185 - 147,958,774 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

RAB3B
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	80,963,320 - 81,036,058 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	20	80,963,398 - 81,035,657 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666033	36,204,690 - 36,280,528 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Rab3b
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624859	1,193,503 - 1,249,972 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624859	1,184,733 - 1,250,402 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Variants

Variants in Rab3b
588 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	278
Count of miRNA genes:	179
Interacting mature miRNAs:	200
Transcripts:	ENSRNOT00000010645
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1331796	Thshl2	Thyroid stimulating hormone level QTL 2	2.3		blood thyroid-stimulating hormone amount (VT:0005119)	serum thyroid stimulating hormone level (CMO:0001248)	5	102105698	152749382	Rat
2303586	Gluco52	Glucose level QTL 52	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	100826632	145826632	Rat
1549845	Scl44	Serum cholesterol level QTL 44	6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	44924861	153890773	Rat
8552960	Pigfal15	Plasma insulin-like growth factor 1 level QTL 15			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	116702075	161702075	Rat
70212	Niddm25	Non-insulin dependent diabetes mellitus QTL 25	3.54		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	38207390	136631402	Rat
1298070	Scl18	Serum cholesterol level QTL 18	3.7		blood LDL cholesterol amount (VT:0000181)	calculated plasma low density lipoprotein cholesterol level (CMO:0001245)	5	84630798	129630798	Rat
61452	Ciaa5	CIA Autoantibody QTL 5	3.5		blood autoantibody amount (VT:0003725)	calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281)	5	99905133	172190305	Rat
1331801	Rf33	Renal function QTL 33	4.149		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	5	48523123	134369373	Rat
1582230	Bw78	Body weight QTL 78	3.2	0.0016	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	5	124314582	133270832	Rat
7411582	Foco3	Food consumption QTL 3	7.5	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	5	92583776	137583776	Rat
61393	Bp7	Blood pressure QTL 7	4.5	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	65089051	166764498	Rat
1598859	Cm66	Cardiac mass QTL 66	2		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	5	84630798	129630798	Rat
7207486	Bss109	Bone structure and strength QTL 109			femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	5	112142946	157142946	Rat
7207481	Bss106	Bone structure and strength QTL 106	7.9		femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	5	112142946	157142946	Rat
1302790	Scl20	Serum cholesterol level QTL 20	6.4	0.0001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	110770739	155770739	Rat
1578766	Tcas11	Tongue tumor susceptibility QTL 11	4.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	5	51657967	166600247	Rat
1549838	Bss4	Bone structure and strength QTL 4	9.2		femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	5	112142946	157142946	Rat
7411564	Bw135	Body weight QTL 135		0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	92583776	137583776	Rat
8657050	Bw146	Body weight QTL 146	19.84	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	98972960	143972960	Rat
1581510	Cm54	Cardiac mass QTL 54	3.4	0.05	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	5	125969677	172190305	Rat
1576312	Emca8	Estrogen-induced mammary cancer QTL 8	4.1		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	55124766	172190305	Rat
7411601	Foco12	Food consumption QTL 12	19.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	5	92583776	137583776	Rat
2303618	Vencon1	Ventilatory control QTL 1	3.8		respiration trait (VT:0001943)	oxygen consumption (CMO:0002169)	5	100826632	145826632	Rat
2317056	Wbc3	White blood cell count QTL 3	2.51	0.01	leukocyte quantity (VT:0000217)	white blood cell count (CMO:0000027)	5	111236572	156236572	Rat
1598846	Bp293	Blood pressure QTL 293	3.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	84630798	129630798	Rat
7394710	Emca12	Estrogen-induced mammary cancer QTL 12			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	94034903	139034903	Rat
1598847	Cm62	Cardiac mass QTL 62	3.4		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	5	114131300	159131300	Rat
2293642	Bss37	Bone structure and strength QTL 37	4.64	0.0001	femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	5	125969677	156302135	Rat
1358909	Kidm25	Kidney mass QTL 25	1.87		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	5	95062526	133270832	Rat
70189	Mcs5	Mammary carcinoma susceptibility QTL 5	10.51		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	60601597	137492949	Rat
7207488	Bss110	Bone structure and strength QTL 1	8.4		femur strength trait (VT:0010010)	femur stiffness (CMO:0001674)	5	112142946	157142946	Rat
8694441	Bw169	Body weight QTL 169	17.61	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	5	116702075	161702075	Rat
7207491	Bss112	Bone structure and strength QTL 112	7		femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	5	112142946	157142946	Rat
8694389	Bw160	Body weight QTL 160	6.17	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	5	116702075	161702075	Rat
2290448	Scl54	Serum cholesterol level QTL 54	2.93		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	36460764	136631402	Rat
1354598	Srn6	Serum renin concentration QTL 6	3.8		blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	5	74335621	156302135	Rat
8694198	Abfw3	Abdominal fat weight QTL 3	16.13	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	5	116702075	161702075	Rat
1298086	Bp156	Blood pressure QTL 156			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	89369373	134369373	Rat
2306971	Anxrr21	Anxiety related response QTL 21	9.47		fear/anxiety-related behavior trait (VT:1000241)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	5	70969494	136328156	Rat
1298089	Scl14	Serum cholesterol level QTL 14	5.8	0.0004	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	114131300	159131300	Rat
1358895	Bp254	Blood pressure QTL 254	3.6	0.0003	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	5	97492524	133270832	Rat
6903316	Bw113	Body weight QTL 113	2	0.0103	body mass (VT:0001259)	body weight (CMO:0000012)	5	92881678	137881678	Rat
1358889	Bp261	Blood pressure QTL 261	2.86		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	5	95062526	133270832	Rat
1358187	Emca1	Estrogen-induced mammary cancer QTL 1	4.4		mammary gland integrity trait (VT:0010552)	post-insult time to mammary tumor formation (CMO:0000345)	5	104262817	153890625	Rat

Markers in Region

RH128978

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	123,697,183 - 123,697,368 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	128,567,944 - 128,568,128	NCBI	Rnor6.0
Rnor_5.0	5	132,408,612 - 132,408,796	UniSTS	Rnor5.0
RGSC_v3.4	5	130,283,815 - 130,283,999	UniSTS	RGSC3.4
Celera	5	122,431,171 - 122,431,355	UniSTS
RH 3.4 Map	5	812.5	UniSTS
Cytogenetic Map	5	q35	UniSTS

RH136876

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	123,697,117 - 123,697,267 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	128,567,878 - 128,568,027	NCBI	Rnor6.0
Rnor_5.0	5	132,408,546 - 132,408,695	UniSTS	Rnor5.0
RGSC_v3.4	5	130,283,749 - 130,283,898	UniSTS	RGSC3.4
Celera	5	122,431,105 - 122,431,254	UniSTS
RH 3.4 Map	5	812.7	UniSTS
Cytogenetic Map	5	q35	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	150	61	60	30	40	30	6	265	139	11	129	72	87	30	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_031091	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006238531	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063288471	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063288472	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC060562	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BF524240	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BI293875	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CB711467	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474008	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000005	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U68184	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	Y14019	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000010645 ⟹ ENSRNOP00000010645

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	5	128,873,109 - 128,926,086 (+)	Ensembl
mRatBN7.2 Ensembl	5	123,644,423 - 123,697,401 (+)	Ensembl
Rnor_6.0 Ensembl	5	128,501,847 - 128,568,188 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000098899 ⟹ ENSRNOP00000078014

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	5	128,841,716 - 128,926,086 (+)	Ensembl
mRatBN7.2 Ensembl	5	123,644,423 - 123,688,140 (+)	Ensembl

RefSeq Acc Id:

NM_031091 ⟹ NP_112353

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	128,859,091 - 128,926,087 (+)	NCBI
mRatBN7.2	5	123,630,402 - 123,697,407 (+)	NCBI
Rnor_6.0	5	128,501,833 - 128,568,167 (+)	NCBI
Rnor_5.0	5	132,343,152 - 132,408,838 (+)	NCBI
RGSC_v3.4	5	130,185,155 - 130,284,038 (+)	RGD
Celera	5	122,364,678 - 122,431,394 (+)	RGD

Sequence:

show sequence

TCAACCCTCCGTAGCCGAGGTGGGAACCAGACCCGCCCCGCCTGCCTCTCGTCCACTACTGCCA
GGTGCAACAGTCCGGCTGCAGTGTGCCGCGAGCCAGCTCTTATCCGAGATGGCCTCAGTAACTG
ATGGTAACACTGGAATCAGAGATGCCTCTGACCAGAACTTTGACTACATGTTCAAACTGCTCAT
CATTGGCAACAGCAGCGTCGGGAAGACCTCCTTCCTTTTCCGCTATGCTGATGACACCTTCACC
CCTGCCTTTGTCAGCACTGTGGGTATCGACTTCAAAGTGAAGACAGTTTACCGTCATGAGAAGC
GTGTGAAGCTGCAGATATGGGACACGGCAGGGCAAGAGCGGTACCGGACCATCACCACAGCCTA
CTACCGCGGGGCCATGGGCTTCATTCTCATGTATGACATCACCAACGAGGAGTCCTTCAACGCT
GTCCAGGACTGGGCTACTCAGATCAAGACCTACTCCTGGGACAACGCACAGGTCATTCTCGTGG
GGAATAAATGTGATATGGAAGAGGAAAGGGTGATCCCGACTGAGAAGGGCCGGCTCCTAGCAGA
GCAACTTGGGTTTGACTTCTTTGAAGCCAGTGCCAAGGAGAACATCAGTGTGAGGCAGGCCTTC
GAGCGTCTGGTGGACGCCATCTGCGATAAGATGTCTGACTCAATGGACACAGACCCCTCCGTGC
TGGGCGCCTCCAAGACCACACGGCTCTCGGACACCCCGCCGCTGCTCCAGCAGAACTGCTCTTG
CTAGGCAAGGCCCGCCCTGCTGTTCCCCCCATGTCATGCCCACTTCTCCTCTGCTTCTCTCTGT
TACTGTCTGCTCCCCGAACCCCAAGCCAGCTGAGTTCTTTGCCAGCCCCTGTGGTTCTCTGCAG
ACGGCCCCAGCTACAGATACTAACTGCAGGTTACTGTGTGGGTGAAGACTCCTCTTACAACAGA
AAACTCCCTCTTAGGAAGGAGGTTCAACATAGAGACTTGGAAAGAACCTTTTCTGCCCTTAAAA
TAAAATTCCCTTCATTTACCAAGATACAACTCCCACACGCACTCCTTAGGGGTTGACCAGTGTG
TAAAGTGAGGCCCACCTGCACAGCTGATACTATTAAAGAAAATGTCTCAAAGCAAAAAAAAAAA
AAAAAAA

hide sequence

RefSeq Acc Id:

XM_006238531 ⟹ XP_006238593

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	128,859,034 - 128,926,087 (+)	NCBI
mRatBN7.2	5	123,630,351 - 123,697,410 (+)	NCBI
Rnor_6.0	5	128,501,789 - 128,568,170 (+)	NCBI
Rnor_5.0	5	132,343,152 - 132,408,838 (+)	NCBI

Sequence:

show sequence

GGGCCTGGACCCAGCGGGAACCCAACCCATCTTCTGCCAGAGCCTCAACCCTCCGTAGCCGAGG
TGGGAACCAGACCCGCCCCGCCTGCCTCTCGTCCACTACTGCCAGGTGCAACAGTCCGGCTGCA
GTGTGCCGCGAGCCAGCTCTTATCCGAGATGGCCTCAGTAACTGATGGTAACACTGGAATCAGA
GATGCCTCTGACCAGAACTTTGACTACATGTTCAAACTGCTCATCATTGGCAACAGCAGCGTCG
GGAAGACCTCCTTCCTTTTCCGCTATGCTGATGACACCTTCACCCCTGCCTTTGTCAGCACTGT
GGGTATCGACTTCAAAGTGAAGACAGTTTACCGTCATGAGAAGCGTGTGAAGCTGCAGATATGG
GACACGGCAGGGCAAGAGCGGTACCGGACCATCACCACAGCCTACTACCGCGGGGCCATGGGCT
TCATTCTCATGTATGACATCACCAACGAGGAGTCCTTCAACGCTGTCCAGGACTGGGCTACTCA
GATCAAGACCTACTCCTGGGACAACGCACAGGTCATTCTCGTGGGGAATAAATGTGATATGGAA
GAGGAAAGGGTTATCCCGACTGAGAAGGGCCGGCTCCTAGCAGAGCAACTTGGTATGCACACGG
CACATACGTACACATGGTTTGACTTCTTTGAAGCCAGTGCCAAGGAGAACATCAGTGTGAGGCA
GGCCTTCGAGCGTCTGGTGGACGCCATCTGCGATAAGATGTCTGACTCAATGGACACAGACCCC
TCCGTGCTGGGCGCCTCCAAGACCACACGGCTCTCGGACACCCCGCCGCTGCTCCAGCAGAACT
GCTCTTGCTAGGCAAGGCCCGCCCTGCTGTTCCCCCCATGTCATGCCCACTTCTCCTCTGCTTC
TCTCTGTTACTGTCCGCTCCCCGAACCCCAAGCCAGCTGAGTTCTTTGCCAGCCCCTGTGGTTC
TCTGCAGACGGCCCCAGCTACAGATACTAACTGCAGGTTACTGTGTGGGTGAAGACTCCTCTTA
CAACAGAAAACTCCCTCTTAGGAAGGAGGTTCAACATAGAGACTTGGAAAGAACCTTTTCTGCC
CTTAAAATAAAATTCCCTTCATTTACCAAGATACAACTCCCACACGCACTCCTTAGGGGTTGAC
CAGTGTGTAAAGTGAGGCCCACCTGCACAGCTGATACTATTAAAGAAAATGTCTCAAAGCATAA

hide sequence

RefSeq Acc Id:

XM_063288471 ⟹ XP_063144541

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	128,859,078 - 128,926,087 (+)	NCBI

RefSeq Acc Id:

XM_063288472 ⟹ XP_063144542

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	128,859,093 - 128,926,087 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_112353	(Get FASTA)	NCBI Sequence Viewer
	XP_006238593	(Get FASTA)	NCBI Sequence Viewer
	XP_063144541	(Get FASTA)	NCBI Sequence Viewer
	XP_063144542	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAD53965	(Get FASTA)	NCBI Sequence Viewer
	AAH60562	(Get FASTA)	NCBI Sequence Viewer
	CAA74341	(Get FASTA)	NCBI Sequence Viewer
	EDL90382	(Get FASTA)	NCBI Sequence Viewer
	EDL90383	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000010645
GenBank Protein	Q63941	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_112353 ⟸ NM_031091

- UniProtKB:

Q63941 (UniProtKB/Swiss-Prot), A6JYX0 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MASVTDGNTGIRDASDQNFDYMFKLLIIGNSSVGKTSFLFRYADDTFTPAFVSTVGIDFKVKTV
YRHEKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWATQIKTYSWDNA
QVILVGNKCDMEEERVIPTEKGRLLAEQLGFDFFEASAKENISVRQAFERLVDAICDKMSDSMD
TDPSVLGASKTTRLSDTPPLLQQNCSC

hide sequence

RefSeq Acc Id:	XP_006238593 ⟸ XM_006238531
- Peptide Label:	isoform X1
- UniProtKB:	Q6P9W6 (UniProtKB/TrEMBL)
- Sequence:	show sequence MASVTDGNTGIRDASDQNFDYMFKLLIIGNSSVGKTSFLFRYADDTFTPAFVSTVGIDFKVKTV YRHEKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWATQIKTYSWDNA QVILVGNKCDMEEERVIPTEKGRLLAEQLGMHTAHTYTWFDFFEASAKENISVRQAFERLVDAI CDKMSDSMDTDPSVLGASKTTRLSDTPPLLQQNCSC hide sequence

Ensembl Acc Id:

ENSRNOP00000010645 ⟸ ENSRNOT00000010645

Ensembl Acc Id:

ENSRNOP00000078014 ⟸ ENSRNOT00000098899

RefSeq Acc Id:	XP_063144541 ⟸ XM_063288471
- Peptide Label:	isoform X1
- UniProtKB:	Q6P9W6 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063144542 ⟸ XM_063288472
- Peptide Label:	isoform X2
- UniProtKB:	Q63941 (UniProtKB/Swiss-Prot), A6JYX0 (UniProtKB/TrEMBL)

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q63941-F1-model_v2	AlphaFold	Q63941	1-219	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13693906

Promoter ID:

EPDNEW_R4430

Type:

initiation region

Name:

Rab3b_1

Description:

RAB3B, member RAS oncogene family

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	5	128,501,835 - 128,501,895	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:620922	AgrOrtholog
BioCyc Gene	G2FUF-40370	BioCyc
Ensembl Genes	ENSRNOG00000008001	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000010645	ENTREZGENE
Gene3D-CATH	3.40.50.300	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:6918181	IMAGE-MGC_LOAD
InterPro	P-loop_NTPase	UniProtKB/Swiss-Prot
	Rab3	UniProtKB/Swiss-Prot
	Small_GTP-bd_dom	UniProtKB/Swiss-Prot
	Small_GTPase	UniProtKB/Swiss-Prot
	Small_GTPase_Rab	UniProtKB/Swiss-Prot
KEGG Report	rno:81755	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:72799	IMAGE-MGC_LOAD
NCBI Gene	81755	ENTREZGENE
PANTHER	LD44762P	UniProtKB/Swiss-Prot
Pfam	Ras	UniProtKB/Swiss-Prot
PhenoGen	Rab3b	PhenoGen
PRINTS	RASTRNSFRMNG	UniProtKB/Swiss-Prot
PROSITE	RAB	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000008001	RatGTEx
SMART	RAB	UniProtKB/Swiss-Prot
	RAN	UniProtKB/Swiss-Prot
	RAS	UniProtKB/Swiss-Prot
	RHO	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF52540	UniProtKB/Swiss-Prot
UniProt	A0A8I5Y826_RAT	UniProtKB/TrEMBL
	A6JYX0	ENTREZGENE, UniProtKB/TrEMBL
	A6JYX1_RAT	UniProtKB/TrEMBL
	Q63941	ENTREZGENE
	Q6P9W6	ENTREZGENE, UniProtKB/TrEMBL
	Q9QYT8_RAT	UniProtKB/TrEMBL
	RAB3B_RAT	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2004-09-10	Rab3b	RAB3B, member RAS oncogene family		Rab3B protein	Name updated	1299863	APPROVED
2002-08-07	Rab3b	Rab3B protein			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_regulation	mRNA expression is induced by dexamethasone in pancreatic acinar cells	729749

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message