Advanced Search (OLGA)

Gene: Wipf1 (WAS/WASL interacting protein family, member 1) Rattus norvegicus

Analyze

Symbol:

Wipf1

Name:

WAS/WASL interacting protein family, member 1

RGD ID:

620887

Description:

Predicted to enable SH3 domain binding activity and protein folding chaperone. Involved in actin cytoskeleton organization and positive regulation of protein export from nucleus. Located in actin filament. Orthologous to human WIPF1 (WAS/WASL interacting protein family member 1); INTERACTS WITH 1-naphthyl isothiocyanate; 17beta-estradiol; 2,2',4,4'-Tetrabromodiphenyl ether.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

LOC108350583; translation initiation factor IF-2-like; WAS/WASL-interacting protein family member 1; WASP interacting protein; WASP-interacting protein; Waspip; Wip; Wiskott-Aldrich syndrome protein interacting protein; wiskott-Aldrich syndrome protein-interacting protein

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	78,721,486 - 78,824,199 (-)	NCBI		GRCr8
mRatBN7.2	3	58,314,521 - 58,416,668 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	58,314,542 - 58,372,742 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	61,708,219 - 61,766,593 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	70,291,875 - 70,350,246 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	68,056,896 - 68,115,269 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	60,150,001 - 60,207,125 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	60,150,021 - 60,166,013 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	66,633,154 - 66,690,278 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	55,944,490 - 56,003,310 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	55,840,874 - 55,899,682 (-)	NCBI
Celera	3	57,842,394 - 57,900,610 (-)	NCBI		Celera
Cytogenetic Map	3	q23	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

atrial fibrillation (ISO)

Experimental Liver Cirrhosis (ISO)

genetic disease (ISO)

split hand-foot malformation 5 (ISO)

Wiskott-Aldrich syndrome (ISO)

Wiskott-Aldrich Syndrome 2 (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

1-naphthyl isothiocyanate (EXP)

17beta-estradiol (EXP,ISO)

2,2',4,4'-Tetrabromodiphenyl ether (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

acetamide (EXP)

acrylamide (ISO)

aflatoxin B1 (ISO)

Aflatoxin B2 alpha (ISO)

all-trans-retinoic acid (ISO)

ammonium chloride (EXP)

antirheumatic drug (ISO)

aristolochic acid A (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenous acid (ISO)

benzo[a]pyrene (ISO)

beta-lapachone (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

buta-1,3-diene (ISO)

cadmium dichloride (EXP,ISO)

calcitriol (ISO)

carmustine (ISO)

CGP 52608 (ISO)

choline (ISO)

cisplatin (ISO)

clofibric acid (EXP)

cobalt dichloride (ISO)

cytarabine (ISO)

dexamethasone (ISO)

diarsenic trioxide (ISO)

Dibutyl phosphate (ISO)

dioxygen (ISO)

dorsomorphin (ISO)

ethanol (ISO)

folic acid (ISO)

gentamycin (EXP)

glyphosate (EXP)

indometacin (ISO)

ivermectin (ISO)

ketoconazole (EXP)

L-methionine (ISO)

methyl methanesulfonate (ISO)

methylmercury chloride (ISO)

N-nitrosodiethylamine (EXP)

N-nitrosodimethylamine (EXP)

nickel atom (ISO)

nickel dichloride (ISO)

nickel sulfate (ISO)

ochratoxin A (ISO)

oxaliplatin (EXP)

paracetamol (EXP,ISO)

phenylmercury acetate (ISO)

Salinomycin (ISO)

SB 431542 (ISO)

silicon dioxide (ISO)

silver atom (ISO)

silver(0) (ISO)

succimer (ISO)

temozolomide (ISO)

testosterone enanthate (ISO)

tetrachloromethane (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

topotecan (EXP)

trichostatin A (ISO)

trimellitic anhydride (ISO)

triptonide (ISO)

troglitazone (ISO)

tungsten (ISO)

valproic acid (ISO)

vinclozolin (EXP)

zinc atom (ISO)

zinc(0) (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

actin cytoskeleton organization (IMP)

actin filament-based movement (IBA,IEA,ISO)

actin filament-based process (IEA)

positive regulation of protein export from nucleus (IDA)

protein folding (IEA)

response to other organism (IEA,ISO)

Cellular Component

actin cytoskeleton (ISO)

actin filament (IBA,IDA,IEA,ISO)

cytoplasmic vesicle (IEA)

ruffle (IEA)

Molecular Function

actin binding (IEA)

cytoskeletal anchor activity (ISO)

protein binding (IPI,ISO)

protein folding chaperone (ISO)

SH3 domain binding (IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	SPIN90/WISH interacts with PSD-95 and regulates dendritic spinogenesis via an N-WASP-independent mechanism.	Lee S, etal., EMBO J. 2006 Oct 18;25(20):4983-95. Epub 2006 Sep 21.
4.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
5.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
6.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
7.	GOA pipeline	RGD automated data pipeline
8.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
9.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
10.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
11.	The rat homologue of Wiskott-Aldrich syndrome protein (WASP)-interacting protein (WIP) associates with actin filaments, recruits N-WASP from the nucleus, and mediates mobilization of actin from stress fibers in favor of filopodia formation.	Vetterkind S, etal., J Biol Chem 2002 Jan 4;277(1):87-95.
12.	Structure of the N-WASP EVH1 domain-WIP complex: insight into the molecular basis of Wiskott-Aldrich Syndrome.	Volkman BF, etal., Cell 2002 Nov 15;111(4):565-76.

Additional References at PubMed

PMID:12147689	PMID:15489334	PMID:17229736	PMID:19798448	PMID:22966049

Genomics

Comparative Map Data

Wipf1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	78,721,486 - 78,824,199 (-)	NCBI		GRCr8
mRatBN7.2	3	58,314,521 - 58,416,668 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	58,314,542 - 58,372,742 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	61,708,219 - 61,766,593 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	70,291,875 - 70,350,246 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	68,056,896 - 68,115,269 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	60,150,001 - 60,207,125 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	60,150,021 - 60,166,013 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	66,633,154 - 66,690,278 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	55,944,490 - 56,003,310 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	55,840,874 - 55,899,682 (-)	NCBI
Celera	3	57,842,394 - 57,900,610 (-)	NCBI		Celera
Cytogenetic Map	3	q23	NCBI

WIPF1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	2	174,559,574 - 174,682,913 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	2	174,559,572 - 174,682,916 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	2	175,424,302 - 175,547,641 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	2	175,132,548 - 175,255,873 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	2	175,249,808 - 175,324,811	NCBI
Celera	2	169,037,733 - 169,161,112 (-)	NCBI		Celera
Cytogenetic Map	2	q31.1	NCBI
HuRef	2	167,305,224 - 167,428,467 (-)	NCBI		HuRef
CHM1_1	2	175,430,425 - 175,553,733 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	2	175,048,279 - 175,171,613 (-)	NCBI		T2T-CHM13v2.0

Wipf1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	73,259,954 - 73,359,831 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	73,259,954 - 73,360,078 (-)	Ensembl		GRCm39 Ensembl
GRCm38	2	73,429,610 - 73,529,487 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	73,429,610 - 73,529,734 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	2	73,267,674 - 73,367,467 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	2	73,230,456 - 73,330,249 (-)	NCBI		MGSCv36	mm8
Celera	2	75,116,177 - 75,216,066 (-)	NCBI		Celera
Cytogenetic Map	2	C3	NCBI
cM Map	2	43.68	NCBI

Wipf1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955449	760,382 - 831,007 (+)	NCBI	ChiLan1.0	ChiLan1.0

WIPF1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	13	77,223,785 - 77,347,483 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	2B	77,238,760 - 77,362,431 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	2B	61,837,128 - 61,960,468 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	2B	179,290,685 - 179,316,694 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	2B	179,290,685 - 179,316,695 (-)	Ensembl	panpan1.1		panPan2

WIPF1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	36	18,574,298 - 18,653,255 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	36	18,576,813 - 18,697,103 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	36	18,583,586 - 18,706,041 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	36	18,710,269 - 18,832,843 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	36	18,710,269 - 18,832,790 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	36	18,787,537 - 18,909,829 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	36	18,785,832 - 18,908,163 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	36	18,896,780 - 19,019,287 (-)	NCBI		UU_Cfam_GSD_1.0

Wipf1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405303	135,759,301 - 135,874,065 (-)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936509	4,314,376 - 4,427,960 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

WIPF1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1	15	80,521,032 - 80,646,462 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	15	89,758,529 - 89,797,790 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

WIPF1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	10	60,067,384 - 60,188,234 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	10	60,067,015 - 60,142,823 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666040	139,407,277 - 139,526,553 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Wipf1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624787	11,787,295 - 11,822,523 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624787	11,787,384 - 11,908,727 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Wipf1
897 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	498
Count of miRNA genes:	242
Interacting mature miRNAs:	318
Transcripts:	ENSRNOT00000024922
Prediction methods:	Microtar, Miranda, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1582238	Bw68	Body weight QTL 68	3.2	0.0064	body mass (VT:0001259)	body weight (CMO:0000012)	3	53184593	115665732	Rat
1582239	Epfw1	Epididymal fat weight QTL 1	4.5	0.0006	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	3	53184593	115665732	Rat
2298542	Neuinf11	Neuroinflammation QTL 11	3.9		nervous system integrity trait (VT:0010566)	spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126)	3	15005422	76927699	Rat
1358362	Srcrt2	Stress Responsive Cort QTL 2	2.78		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	3	38192233	133483320	Rat
737818	Hcar12	Hepatocarcinoma resistance QTL 12	2.6		liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	3	29463235	118376539	Rat
1582218	Bw74	Body weight QTL 74	3.9	0.0021	body mass (VT:0001259)	body weight (CMO:0000012)	3	53184593	115665732	Rat
1581568	Rf53	Renal function QTL 53			urine total protein amount (VT:0000032)	urine protein excretion rate to body weight ratio (CMO:0001099)	3	56395968	161299569	Rat
9590286	Uminl1	Urine mineral level QTL 1	3.5	0.001	urine mineral amount (VT:0015086)	urine electrolyte level (CMO:0000593)	3	28249687	73249687	Rat
724523	Tsu1	Thymus enlargement suppressive QTL 1	3.84		thymus mass (VT:0004954)	thymus weight to body weight ratio (CMO:0000612)	3	50437504	115638231	Rat
1581503	Cm58	Cardiac mass QTL 58	2.7	0.05	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	3	43827364	121056321	Rat
2292613	Ept16	Estrogen-induced pituitary tumorigenesis QTL 16	8.3		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	47233430	110362260	Rat
731180	Bp152	Blood pressure QTL 152		0.03	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	53781112	91609953	Rat
61356	Bp37	Blood pressure QTL 37	3		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	3	30684642	75684642	Rat
1358905	Hrtrt17	Heart rate QTL 17	5.9	0.000014	heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	3	10861912	89878372	Rat
8694196	Abfw2	Abdominal fat weight QTL 2	16.58	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	3	28249687	73249687	Rat
2301971	Cm71	Cardiac mass QTL 71	4.63		heart left ventricle mass (VT:0007031)	heart left ventricle weight (CMO:0000776)	3	41874578	155617519	Rat
1358885	Bp251	Blood pressure QTL 251	3.8		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	14489145	121056321	Rat
2301970	Bw81	Body weight QTL 81	5.19		body mass (VT:0001259)	body weight (CMO:0000012)	3	41874578	155617519	Rat
1582249	Bw77	Body weight QTL 77	3.2	0.0025	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	3	53184593	64655484	Rat
2290452	Scl56	Serum cholesterol level QTL 56	2.26		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	3	1	91609953	Rat
12879868	Am6	Aortic mass QTL 6		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	3	31426403	70668733	Rat
11565451	Bw177	Body weight QTL 177		0.002	body mass (VT:0001259)	body weight (CMO:0000012)	3	31426403	70668733	Rat
1358888	Bp264	Blood pressure QTL 264	4.43		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	14489145	121056321	Rat
11565452	Kidm57	Kidney mass QTL 57		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	3	31426403	70668733	Rat
12879866	Cm94	Cardiac mass QTL 94		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	3	31426403	70668733	Rat
12879867	Cm95	Cardiac mass QTL 95		0.047	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	3	31426403	70668733	Rat
1300178	Hrtrt4	Heart rate QTL 4	3.74		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	3	43827364	90905114	Rat
61377	Edpm3	Estrogen-dependent pituitary mass QTL 3	7.05	0.038	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	53184692	89878207	Rat
2302055	Pia30	Pristane induced arthritis QTL 30	3.5	0.001	blood autoantibody amount (VT:0003725)	serum immunoglobulin M-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002111)	3	27936919	72936919	Rat
1331795	Rf30	Renal function QTL 30	3.708		urine potassium amount (VT:0010539)	urine potassium level (CMO:0000128)	3	39454637	89115240	Rat
70216	Cm14	Cardiac mass QTL 14	2.1		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	31172320	163586636	Rat
1354589	Bw31	Body weight QTL 31	3.3		body mass (VT:0001259)	body weight (CMO:0000012)	3	33703347	78196190	Rat
2303593	Gluco46	Glucose level QTL 46	3		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	28468571	73468571	Rat
1354590	Despr11	Despair related QTL 11		0.000031	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	3	28468571	73468571	Rat
2292591	Esta4	Estrogen-induced thymic atrophy QTL 4			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	3	47233211	147415807	Rat
1331777	Bw24	Body weight QTL 24	3.503		body mass (VT:0001259)	body weight (CMO:0000012)	3	39454637	89115240	Rat
631647	Bp122	Blood pressure QTL 122	6.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	30684642	75684642	Rat
1300169	Bp177	Blood pressure QTL 177	2.96		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	3	33703347	61017857	Rat
1559282	Emca5	Estrogen-induced mammary cancer QTL 5	3.9		mammary gland integrity trait (VT:0010552)	percentage of study population developing mammary tumors during a period of time (CMO:0000948)	3	43827364	169034231	Rat
2302276	Bw82	Body weight QTL 82	4.32		body mass (VT:0001259)	body weight (CMO:0000012)	3	39454637	62951183	Rat
738019	Anxrr10	Anxiety related response QTL 10	3.9		exploratory behavior trait (VT:0010471)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	3	38517803	83517803	Rat
9590136	Scort3	Serum corticosterone level QTL 3	23.37	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	3	28249687	73249687	Rat
10450804	Scl70	Serum cholesterol level QTL 70	4.7	0.001	blood LDL cholesterol amount (VT:0000181)	blood low density lipoprotein cholesterol level (CMO:0000053)	3	20714090	65714090	Rat
61419	Cia11	Collagen induced arthritis QTL 11	5.6		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	3	30356773	98535386	Rat
1354597	Kidm13	Kidney mass QTL 13	2.9		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	3	41874578	104104347	Rat
8552950	Pigfal12	Plasma insulin-like growth factor 1 level QTL 12	7.3		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	3	28249687	73249687	Rat
631676	Cm8	Cardiac mass QTL 8	7.03	0.0001	aorta mass (VT:0002845)	aorta weight (CMO:0000076)	3	16954708	61954708	Rat
10450794	Scl69	Serum cholesterol level QTL 69	6.3	0.001	blood LDL cholesterol amount (VT:0000181)	blood low density lipoprotein cholesterol level (CMO:0000053)	3	20714090	65714090	Rat
8694386	Bw159	Body weight QTL 159	4.52	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	3	28249687	73249687	Rat
1354604	Bw36	Body weight QTL 36	2.9		body mass (VT:0001259)	body weight (CMO:0000012)	3	33703347	104104347	Rat
631665	Bw8	Body weight QTL 8	5.5		body mass (VT:0001259)	body weight (CMO:0000012)	3	50437042	119183768	Rat
2301400	Cm68	Cardiac mass QTL 68		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	3	31426403	70668733	Rat
1358186	Ept2	Estrogen-induced pituitary tumorigenesis QTL 2	8.3		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	47233430	110362260	Rat

Markers in Region

RH142360

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	58,314,165 - 58,314,327 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	60,149,646 - 60,149,807	NCBI	Rnor6.0
Rnor_5.0	3	66,632,799 - 66,632,960	UniSTS	Rnor5.0
RGSC_v3.4	3	55,944,135 - 55,944,296	UniSTS	RGSC3.4
Celera	3	57,842,039 - 57,842,200	UniSTS
Cytogenetic Map	3	q23	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001429723	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001429724	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001429725	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001429726	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_057192	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039104135	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039104136	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039104137	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039104138	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AJ303456	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC072475	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473949	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ226326	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ227856	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ233281	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ233413	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ235110	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000003	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000024922 ⟹ ENSRNOP00000024922

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	58,314,542 - 58,372,742 (-)	Ensembl
Rnor_6.0 Ensembl	3	60,150,021 - 60,166,013 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000109439 ⟹ ENSRNOP00000082687

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	58,319,190 - 58,330,691 (-)	Ensembl

RefSeq Acc Id:

NM_057192 ⟹ NP_476540

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	78,722,042 - 78,780,277 (-)	NCBI
mRatBN7.2	3	58,314,521 - 58,372,742 (-)	NCBI
Rnor_6.0	3	60,150,001 - 60,207,125 (-)	NCBI
Rnor_5.0	3	66,633,154 - 66,690,278 (-)	NCBI
RGSC_v3.4	3	55,944,490 - 56,003,310 (-)	RGD
Celera	3	57,842,394 - 57,900,610 (-)	RGD

Sequence:

show sequence

GGAAGTCCTCGGTCTAAGAGGCCACACAACCTGGACTAAGGCTAAGCAGGTTTGGAGAAGCCTC
GAGGCTTGGTGGTGACTAGAGCCTCCTGTCCACACGCCGGTGTTTCACATGGTAAAGAAGATTG
GATTTACCCTCAAGACTGCTGAAATTCTAACTATCCAAGATGCCTGTCCCTCCCCCACCAGCAC
CCCCACCGCCACCGACGTTTGCTCTCGCCAATACTGAGAAACCCTCCTTGAATAAGACAGAACA
GGCTGGGAGGAATGCCCTTCTCTCCGACATCAGCAAAGGGAAGAAGCTAAAGAAGACAGTCACC
AATGACAGAAGCGCTCCAATATTGGACAAACCTAAGGGGGCTGGCGGTGGCTATGGTGGAGGCA
GCGGAGGCGGAGGAGGAGGAGGCAGCAGCGGTGGCGGTGGAAATTTTGGAGGGGGTGGTCCTCC
AGGACTGGGAGGACTGTTCCAGGCCGGCATGCCGAAGCTGAGGTCCACCGCCAACAGGGACAAC
GATTCTGGGGGAAGCCGACCACCGATTTTGCCACCAGGAGGAAGAGCCACATCTGCCAAGCCCT
TTTCACCCCCAAGTGGCCCGGGGAGGTTTCCCGCACCCTCACCAGGCCACAGGAGTGGGCCCCC
AGAGCCGCCCAGGAACAGAATGCCTCCCCCGAGGCCTGATGTGGGCTCAAAACCAGATAGCCTT
CCCCCTCCGGTACCAAATACGCCAAGACCCATTCCGTCGAGTCTGCACAACCGGGGATCCCCAG
CAGGGCTGGGAGCCCCCAGACCCCCCTTTCCCGGAAACCGAGGTGCTGCTTTTGGAGCAGGCTC
TGTGCGCCAGAACCTCTCGAGCTCCTCCTCTCCGTTCCCCAGGCCCCCTTTGCCCCCGACCCCA
AGCCGGGCCTTGGATGACAAGCCCCCTCCACCACCTCCTCCCGTGGGCAACAGGCCCTCCATGC
ACAGAGAAGCGGTTCCCCCTCCCCCATCACAAAACAGCAAACCTCCAGTGCCTTCCACCCCGCG
GCCGGGGGCGGGTTCACAGGCACCACCTCCGCCACCGCCCAGCCGGCCAGGACCCCCTCCACTG
CCTCCGACTTCCAGCGACGAGATCCCCAGGCTGCCACAGCGGAACCTGTCCCTCACCTCCCCTA
CACCTCCCTTGCCTTCACCTGGACGCTCGGGGCCTCTCCCTCCCCCACCCACCGAGAGGCCCCC
TCCTCCCGTGAGGGATCCGCCAGGCAGATCAGGCCCCCTCCCACCACCACCTCCAATAAACAGA
AATGGAAGCACAGCTCGGGCCCTGCCTGCCACCCCTCAGTTGCCATCCAGGAGTGGAATGGACA
GTCCCAGAAGTGGGCCTAGGCCTCCTCTTCCTCCTGACAGGCCTGGTGCTGGGGCCCCGCCCCC
ACCCCCACCATCCACATCAGTTCGAAATGGCTTCCAAGACTCATCTTGCGAAGATGAGTGGGAA
AGCAGGTTCTACTTCCATCCGATTTCCGACTTACCGCCTCCAGAGCCGTATGTGCCAACGACCA
AGACGTACCCCAGCAAAGTGGCCAGAAGTGAAAGCCGAAGTGGATCCAACAGAAGAGAAAGGGG
CGCCCCACCCCTTCCTCCCATCCCGAGGTGATCTCTGCCTGCTCCGCTCTACCCAAACCTCCAA
AGCTGCCTCTATTGTTGCTGTTTGAGAACTGCACTCGCCCCGCCCTCTTTCTTTGCCCCCCTCA
GAGAGAGGAGGAGGGAGGAACGGAAGCTGAGGAGGGGATCCCTGCATGTGGGGCTGGGGATCGG
GAAAGAAGGGCCTGTTTATGTTGTATATATTCCTGAGCTATTGCTTGTGTCAGCCGCAGCCTGC
CAGGGTCGGCTGCTGGGATCGATAGGCTTTTGTTATAAGGAGGCAGAGAAGAATCGTATCCCAG
CTTTCAGCCCCACGAGGTCAGGCATTCACTGCTTTTTTGCTACAGGCAGTAGCTGTTAAATCCC
CTGAGAGCTGGTTTTCTCTATGCCTTTCTTGCTTACTTGGCCTCCGGTCTGGTTCCGAACGAAC
CACAGACCGCCCAAGCAAGTTGCTGAGCAAGCCCTACGTGAAGCCCTGTGGTTGCAGGATGTTC
AATCTTTGGCAGTCTGAGGTAGGCTCCAGGGCAGAGCTGTCTAACAGAAACCTAATGTGAGCCC
CATACCCAGTCTTAAAATGACCAGCAGCCATGTTTATAAGGGTAAAAGGAAACAGATGAAAAGA
ATTCCATTTTACTTAGCTCTGTGCATCTGAAATGTCACTTCCACCTGGATTATTAATGAGGTAT
TCACATTTTTGGTACTAAGTCCTCTCACTCCAGTAACCATTCTGTATTTAGAACAAGCATATGG
ACAGATTTCAAGTGTCTACACGTGCTTAAGCACCTCACAGTCAGCCGGTCTGGAAGACAGGAGC
TAGTACGGAAAGCTTGTGCCTAAAAAGGCAAATTGAATTTTAGCAATTCAAGAGATGTCCCAAG
ACCAAGTCATAACTTGATACAATGTTAGGCAGACAGTGAGACCTTAGCTTTTTGACCCTTATTT
TGCCTTTTTCCTTAATATGTATGTACAGGTGTTTCTTCAGAGTATCATTATCTAGTCAGAAATG
TATCTAGTCCAGTTTACCATAGCATGGAATAAATCCACTGCAAGAGAAAGGGAAACGTGTAGTG
TGGGCTCTTCCTGGCTCAGAACCAGCTGGCTTGTGCACTCACTGGTCACTGGCCTTGCAGATCT
TCTGTGGTTCTTCAGTCCTCCACTCCAGAGAAAACTTCTTCCTCAGGTCAGGAAAAGCTAGGAG
GGCAAGATAGGAGAAGAAAGTCAGAGAATGTATCAAATCAGAATTATGGGAGAAGGGGACAGCT
TTGATGATGGGCAGAATTCTACACAACCAACTGGGTCAAGTAGATTAAGGAGCTTACCAGTAGA
ACCCGGAAAGCACTGGTTTTGGATTTCTTGGGAGAATCGTTTTGGATCTGTGCAAGTAAGTTCC
GCTAAAGGACCGACCGTGAAAAGCGTCAGGCATGCCTTTTATATACATAGAATTTTGTTTACAA
TGTTTTACTGGGACTTTGAAATCTAGCTGTAGAGTTGGAAAATGATTTCCACTTTGATGTTTTG
TATCGTCGTGTTTAATGTTACTGTTGTCTTTTAAAGCACATGGCCACATGTGTATCTACCTGAG
CTTTGTATTTTGGGTCCAGTGTATTGCTCACGTGTTGCTGGGAGATGCTAATGACAACAAAAAA
AAAAATCAATCCAAAGAAAAATGGAAAGACATTCCTATTTATAGAATGATTGTTTCATTTATAT
AAAAGCATAACGTAGGAGTTCTAATAGATGAAACGTCTAATAAATTATAAAGTGATTGATTTGA
ATATATTGTATTTTTATAACTTTCCTTGCCAAAGCTCTGGACCTAGTTCTTTAGAGAGTAACTT
TCCTTTCTTCTCCTCCACCATTTGTCTGCCTTTCATGAAAACAAAGAAATAAAAGGTTCAACAA
GCTTGACAATTTTTTTATTTCTAACATTTTTAAATGTATTTCAAATTCTTTGATCTGATATTCA
CTAGAATCAACATCTTTTTGATAGACACTCAGTGACCCACTTTACTGGAAATAGAATTGGTCCT
TCCTTGTGCTGTGTATGGCAGTGAAAGGTCAGACTCAAAAATTGTGGGTCTGAATTTTTTAAGG
AATCGTGAAAATTGAAACAAGTCCTGGGTAAATCTCAGTTTTTCAGGTGCATTCCTAAGTCAGG
AACGGGGTCACAGCTCAAAGTTGCCATTCATAATAAAAAGGGTTTGGAGAGTATTTTGCAAAGA
ATGTTTCATTAATACACCTACATCCTATCTTTGGAAGTCAGTGACCCAATTGCATTTAAAACTC
TGGAGAAGTTCTGTGTTTATCTTAACCTATGGCAGACTGCAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039104135 ⟹ XP_038960063

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	78,721,486 - 78,824,199 (-)	NCBI
mRatBN7.2	3	58,314,521 - 58,416,668 (-)	NCBI

RefSeq Acc Id:

XM_039104136 ⟹ XP_038960064

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	78,721,486 - 78,824,198 (-)	NCBI
mRatBN7.2	3	58,314,521 - 58,416,666 (-)	NCBI

RefSeq Acc Id:

XM_039104137 ⟹ XP_038960065

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	78,721,486 - 78,785,282 (-)	NCBI
mRatBN7.2	3	58,314,521 - 58,377,742 (-)	NCBI

RefSeq Acc Id:

XM_039104138 ⟹ XP_038960066

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	78,721,486 - 78,750,762 (-)	NCBI
mRatBN7.2	3	58,314,521 - 58,343,381 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001416652	(Get FASTA)	NCBI Sequence Viewer
	NP_001416653	(Get FASTA)	NCBI Sequence Viewer
	NP_001416654	(Get FASTA)	NCBI Sequence Viewer
	NP_001416655	(Get FASTA)	NCBI Sequence Viewer
	NP_476540	(Get FASTA)	NCBI Sequence Viewer
	XP_038960063	(Get FASTA)	NCBI Sequence Viewer
	XP_038960064	(Get FASTA)	NCBI Sequence Viewer
	XP_038960065	(Get FASTA)	NCBI Sequence Viewer
	XP_038960066	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH72475	(Get FASTA)	NCBI Sequence Viewer
	CAC22282	(Get FASTA)	NCBI Sequence Viewer
	EDL79146	(Get FASTA)	NCBI Sequence Viewer
	EDL79147	(Get FASTA)	NCBI Sequence Viewer
	EDL79148	(Get FASTA)	NCBI Sequence Viewer
	EDL79149	(Get FASTA)	NCBI Sequence Viewer
	EDL79150	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000024922.6
	ENSRNOP00000082687.1
	ENSRNOP00055032282
	ENSRNOP00060020870
	ENSRNOP00065023097
GenBank Protein	Q6IN36	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_476540 ⟸ NM_057192

- UniProtKB:

Q8VDA4 (UniProtKB/Swiss-Prot), Q6IN36 (UniProtKB/Swiss-Prot), R9PXW1 (UniProtKB/TrEMBL), A6HM96 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MPVPPPPAPPPPPTFALANTEKPSLNKTEQAGRNALLSDISKGKKLKKTVTNDRSAPILDKPKG
AGGGYGGGSGGGGGGGSSGGGGNFGGGGPPGLGGLFQAGMPKLRSTANRDNDSGGSRPPILPPG
GRATSAKPFSPPSGPGRFPAPSPGHRSGPPEPPRNRMPPPRPDVGSKPDSLPPPVPNTPRPIPS
SLHNRGSPAGLGAPRPPFPGNRGAAFGAGSVRQNLSSSSSPFPRPPLPPTPSRALDDKPPPPPP
PVGNRPSMHREAVPPPPSQNSKPPVPSTPRPGAGSQAPPPPPPSRPGPPPLPPTSSDEIPRLPQ
RNLSLTSPTPPLPSPGRSGPLPPPPTERPPPPVRDPPGRSGPLPPPPPINRNGSTARALPATPQ
LPSRSGMDSPRSGPRPPLPPDRPGAGAPPPPPPSTSVRNGFQDSSCEDEWESRFYFHPISDLPP
PEPYVPTTKTYPSKVARSESRSGSNRRERGAPPLPPIPR

hide sequence

Ensembl Acc Id:

ENSRNOP00000024922 ⟸ ENSRNOT00000024922

RefSeq Acc Id:	XP_038960063 ⟸ XM_039104135
- Peptide Label:	isoform X1

RefSeq Acc Id:	XP_038960064 ⟸ XM_039104136
- Peptide Label:	isoform X1

RefSeq Acc Id:	XP_038960065 ⟸ XM_039104137
- Peptide Label:	isoform X1

RefSeq Acc Id:	XP_038960066 ⟸ XM_039104138
- Peptide Label:	isoform X1

Ensembl Acc Id:

ENSRNOP00000082687 ⟸ ENSRNOT00000109439

Protein Domains

WH2

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q6IN36-F1-model_v2	AlphaFold	Q6IN36	1-487	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:620887	AgrOrtholog
BioCyc Gene	G2FUF-49369	BioCyc
Ensembl Genes	ENSRNOG00000018406	Ensembl, UniProtKB/TrEMBL
	ENSRNOG00055023131	UniProtKB/Swiss-Prot
	ENSRNOG00060015184	UniProtKB/Swiss-Prot
	ENSRNOG00065017440	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000024922.7	UniProtKB/TrEMBL
	ENSRNOT00000109439.1	UniProtKB/TrEMBL
	ENSRNOT00055039758	UniProtKB/Swiss-Prot
	ENSRNOT00060026063	UniProtKB/Swiss-Prot
	ENSRNOT00065029144	UniProtKB/Swiss-Prot
Gene3D-CATH	2.30.29.30	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7100751	IMAGE-MGC_LOAD
InterPro	PH-like_dom_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	WH2_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:117538	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGC_CLONE	MGC:91527	IMAGE-MGC_LOAD
NCBI Gene	117538	ENTREZGENE
Pfam	WH2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Wipf1	PhenoGen
PROSITE	WH2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000018406	RatGTEx
	ENSRNOG00055023131	RatGTEx
	ENSRNOG00060015184	RatGTEx
	ENSRNOG00065017440	RatGTEx
SMART	WH2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A8I6G7Q9_RAT	UniProtKB/TrEMBL
	A6HM96	ENTREZGENE, UniProtKB/TrEMBL
	Q6IN36	ENTREZGENE
	Q8VDA4	ENTREZGENE
	R9PXW1	ENTREZGENE, UniProtKB/TrEMBL
	WIPF1_RAT	UniProtKB/Swiss-Prot
UniProt Secondary	Q8VDA4	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2021-03-09	Wipf1	WAS/WASL interacting protein family, member 1	LOC108350583	translation initiation factor IF-2-like	Data merged from RGD:11498189	737654	PROVISIONAL
2016-08-02	LOC108350583	translation initiation factor IF-2-like			Symbol and Name status set to provisional	70820	PROVISIONAL
2008-02-25	Wipf1	WAS/WASL interacting protein family, member 1	Waspip	Wiskott-Aldrich syndrome protein interacting protein	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-02-26	Waspip	Wiskott-Aldrich syndrome protein interacting protein			Symbol and Name status set to approved	625702	APPROVED
2002-08-07	Waspip	Wiskott-Aldrich syndrome protein interacting protein			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM