Hist1h4b (histone cluster 1 H4 family member B)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Hist1h4b (histone cluster 1 H4 family member B) Rattus norvegicus

Analyze

Symbol:

Hist1h4b (Ensembl: LOC100912564)

Name:

histone cluster 1 H4 family member B (Ensembl:histone H4-like)

RGD ID:

620814

Description:

Predicted to enable DNA binding activity and protein domain specific binding activity. Predicted to be a structural constituent of chromatin. Predicted to be involved in DNA replication-dependent chromatin assembly; negative regulation of megakaryocyte differentiation; and nucleosome assembly. Predicted to be located in nuclear chromosome. Predicted to be part of CENP-A containing nucleosome. Orthologous to several human genes including H4C9 (H4 clustered histone 9); PARTICIPATES IN systemic lupus erythematosus pathway; INTERACTS WITH 1-[(4-chlorophenyl)-phenylmethyl]-4-methylpiperazine; 2,3,7,8-tetrachlorodibenzodioxine; 4-amino-2,6-dinitrotoluene.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

germinal histone H4; germinal histone H4 gene; H1ft; H4c16; H4c2; H4f16; Hist1h4m; Hist4; Hist4h4; histone cluster 1, H4b; histone H4

RGD Orthologs

Human

Mouse

Green Monkey

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	H4C9 (H4 clustered histone 9)	HGNC	Ensembl, NCBI, OrthoDB
Mus musculus (house mouse):	H4c8 (H4 clustered histone 8)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	LOC103221971 (histone H4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	H4C16 (H4 histone 16)	HGNC	Inparanoid, Panther
Homo sapiens (human):	H4C11 (H4 clustered histone 11)	HGNC	HomoloGene
Homo sapiens (human):	H4C7 (H4 clustered histone 7)	HGNC	Panther
Alliance orthologs ³
Homo sapiens (human):	H4C8 (H4 clustered histone 8)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Mus musculus (house mouse):	H4c8 (H4 clustered histone 8)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Mus musculus (house mouse):	H4c1 (H4 clustered histone 1)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Homo sapiens (human):	H4C11 (H4 clustered histone 11)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Mus musculus (house mouse):	H4c18 (H4 clustered histone 18)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Homo sapiens (human):	H4C5 (H4 clustered histone 5)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Mus musculus (house mouse):	H4c14 (H4 clustered histone 14)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Homo sapiens (human):	H4C13 (H4 clustered histone 13)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Mus musculus (house mouse):	H4c12 (H4 clustered histone 12)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Mus musculus (house mouse):	H4c9 (H4 clustered histone 9)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Mus musculus (house mouse):	H4c11 (H4 clustered histone 11)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Homo sapiens (human):	H4C9 (H4 clustered histone 9)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Homo sapiens (human):	H4C14 (H4 clustered histone 14)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Homo sapiens (human):	H4C16 (H4 histone 16)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Homo sapiens (human):	H4C4 (H4 clustered histone 4)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Homo sapiens (human):	H4C12 (H4 clustered histone 12)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Homo sapiens (human):	H4C3 (H4 clustered histone 3)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Homo sapiens (human):	H4C6 (H4 clustered histone 6)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Homo sapiens (human):	H4C15 (H4 clustered histone 15)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Mus musculus (house mouse):	H4c6 (H4 clustered histone 6)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Mus musculus (house mouse):	H4c4 (H4 clustered histone 4)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Mus musculus (house mouse):	H4c3 (H4 clustered histone 3)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Mus musculus (house mouse):	H4c16 (H4 histone 16)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Mus musculus (house mouse):	H4c2 (H4 clustered histone 2)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Mus musculus (house mouse):	H4c17 (H4 clustered histone 17)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Danio rerio (zebrafish):	si:dkey-108k21.28	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|SonicParanoid)
Danio rerio (zebrafish):	si:ch73-36p18.4	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|SonicParanoid)
Danio rerio (zebrafish):	si:ch211-113a14.6	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|SonicParanoid)
Danio rerio (zebrafish):	si:dkey-23a13.7	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|SonicParanoid)
Danio rerio (zebrafish):	hist1h4l (histone 1, H4, like)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|SonicParanoid)
Danio rerio (zebrafish):	si:dkey-108k21.12	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|SonicParanoid)
Danio rerio (zebrafish):	si:dkey-108k21.18	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|SonicParanoid)
Danio rerio (zebrafish):	zgc:165555	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|SonicParanoid)
Danio rerio (zebrafish):	si:ch211-113a14.17	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|SonicParanoid)
Danio rerio (zebrafish):	zgc:163040	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	HHF1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	His4:CG31611	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoInspector\|SonicParanoid)
Drosophila melanogaster (fruit fly):	His4:CG33869	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoInspector\|SonicParanoid)
Drosophila melanogaster (fruit fly):	His4:CG33871	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoInspector\|SonicParanoid)
Drosophila melanogaster (fruit fly):	His4:CG33873	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoInspector\|SonicParanoid)
Drosophila melanogaster (fruit fly):	His4:CG33875	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoInspector\|SonicParanoid)
Drosophila melanogaster (fruit fly):	His4:CG33877	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoInspector\|SonicParanoid)
Drosophila melanogaster (fruit fly):	His4:CG33879	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoInspector\|SonicParanoid)
Drosophila melanogaster (fruit fly):	His4:CG33881	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoInspector\|SonicParanoid)
Drosophila melanogaster (fruit fly):	His4:CG33883	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoInspector\|SonicParanoid)
Drosophila melanogaster (fruit fly):	His4:CG33885	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoInspector\|SonicParanoid)
Drosophila melanogaster (fruit fly):	His4:CG33887	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoInspector\|SonicParanoid)
Drosophila melanogaster (fruit fly):	His4:CG33889	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoInspector\|SonicParanoid)
Drosophila melanogaster (fruit fly):	His4:CG33891	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoInspector\|SonicParanoid)
Drosophila melanogaster (fruit fly):	His4:CG33893	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoInspector\|SonicParanoid)
Drosophila melanogaster (fruit fly):	His4:CG33895	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoInspector\|SonicParanoid)
Drosophila melanogaster (fruit fly):	His4:CG33897	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoInspector\|SonicParanoid)
Drosophila melanogaster (fruit fly):	His4:CG33899	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoInspector\|SonicParanoid)
Drosophila melanogaster (fruit fly):	His4:CG33901	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoInspector\|SonicParanoid)
Drosophila melanogaster (fruit fly):	His4:CG33903	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoInspector\|SonicParanoid)
Drosophila melanogaster (fruit fly):	His4:CG33905	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoInspector\|SonicParanoid)
Drosophila melanogaster (fruit fly):	His4:CG33907	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoInspector\|SonicParanoid)
Drosophila melanogaster (fruit fly):	His4:CG33909	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoInspector\|SonicParanoid)
Drosophila melanogaster (fruit fly):	His4r	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoInspector\|SonicParanoid)
Caenorhabditis elegans (roundworm):	his-1	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	his-10	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	his-14	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	his-18	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	his-26	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	his-28	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	his-31	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	his-37	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	his-46	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	his-5	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	his-50	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	his-56	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	his-60	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	his-64	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	his-67	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	HHF2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	his-38	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	17	42,480,467 - 42,484,912 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	17	42,480,313 - 42,485,370 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	17	44,530,209 - 44,534,658 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	17	49,289,303 - 49,293,753 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	17	43,780,258 - 43,784,712 (+)	NCBI	Rnor_WKY
Rnor_6.0	17	44,522,144 - 44,526,587 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	17	44,522,140 - 44,526,583 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	17	58,943,971 - 58,948,414 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	17	50,113,499 - 50,117,942 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	17	50,116,339 - 50,120,783 (+)	NCBI
Celera	17	53,976,729 - 53,981,173 (-)	NCBI		Celera
Cytogenetic Map	17	p11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Tessadori-van Haaften Neurodevelopmental Syndrome 4 (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-epigallocatechin 3-gallate (ISO)

1,2-dimethylhydrazine (ISO)

1-[(4-chlorophenyl)-phenylmethyl]-4-methylpiperazine (EXP)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,3',4,4',5-Pentachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-diaminotoluene (ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4-amino-2,6-dinitrotoluene (EXP)

4-hydroxyphenyl retinamide (ISO)

acetamide (EXP)

acrolein (ISO)

aflatoxin B1 (EXP)

all-trans-retinoic acid (ISO)

alpha-pinene (ISO)

ammonium chloride (EXP)

arsenite(3-) (ISO)

benzo[a]pyrene (ISO)

benzo[b]fluoranthene (ISO)

Benzo[k]fluoranthene (ISO)

berberine (ISO)

bilirubin IXalpha (ISO)

bisphenol A (ISO)

Brodifacoum (EXP)

caffeine (ISO)

cannabidiol (ISO)

carbon nanotube (ISO)

choline (ISO)

chromium(6+) (ISO)

chrysene (ISO)

ciguatoxin CTX1B (ISO)

cisplatin (ISO)

copper(II) sulfate (ISO)

Cuprizon (EXP)

cyclosporin A (ISO)

dexamethasone (ISO)

dibutyl phthalate (EXP)

dioxygen (ISO)

diuron (EXP)

flutamide (EXP)

folic acid (ISO)

indinavir (ISO)

indometacin (ISO)

L-methionine (ISO)

lamivudine (ISO)

Licochalcone B (ISO)

methamphetamine (EXP)

methidathion (ISO)

N-methyl-4-phenylpyridinium (EXP)

N-Nitrosopyrrolidine (ISO)

nefazodone (EXP)

nimesulide (EXP)

ochratoxin A (EXP)

oxaliplatin (EXP)

ozone (ISO)

paracetamol (ISO)

PCB138 (ISO)

picene (ISO)

propanal (ISO)

propiconazole (ISO)

saquinavir (ISO)

SCH 23390 (EXP)

silicon dioxide (ISO)

silver atom (ISO)

silver(0) (ISO)

tetraphene (ISO)

thalidomide (ISO)

tolcapone (EXP)

topotecan (EXP)

Triptolide (ISO)

troglitazone (ISO)

trovafloxacin (ISO)

tungsten (ISO)

valdecoxib (EXP)

valproic acid (ISO)

vancomycin (ISO)

versicolorin A (ISO)

vinclozolin (EXP)

zidovudine (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cell differentiation (IEA)

chromatin organization (ISO)

DNA replication-dependent chromatin assembly (ISO)

negative regulation of megakaryocyte differentiation (ISO)

nucleosome assembly (IBA,ISO)

ossification (IEA)

Cellular Component

CENP-A containing nucleosome (ISO)

extracellular region (IEA)

nuclear chromosome (ISO)

nucleoplasm (TAS)

nucleosome (ISO)

nucleus (ISO)

protein-containing complex (ISO)

Molecular Function

DNA binding (IBA,TAS)

protein binding (ISO)

protein domain specific binding (ISO)

protein heterodimerization activity (IEA)

structural constituent of chromatin (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

systemic lupus erythematosus pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	A rat histone H4 gene closely associated with the testis-specific H1t gene.	Grimes S, etal., Exp Cell Res 1987 Dec;173(2):534-45.
3.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
4.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
6.	Protein-DNA interactions within the rat histone H4t promoter.	Wolfe SA and Grimes SR, J Biol Chem 1991 Apr 5;266(10):6637-43.

Additional References at PubMed

PMID:1582415	PMID:2920170	PMID:5171427	PMID:7932740	PMID:10318873	PMID:11319220	PMID:12477932	PMID:14585971	PMID:14718166	PMID:15489334	PMID:15607978	PMID:16042990
PMID:16621524	PMID:16939626	PMID:18474616	PMID:20498094	PMID:21357467	PMID:21636898	PMID:22368283	PMID:23979707	PMID:24699735	PMID:25615412	PMID:25931508	PMID:29476059
PMID:32357304

Genomics

Comparative Map Data

Hist1h4b
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	17	42,480,467 - 42,484,912 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	17	42,480,313 - 42,485,370 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	17	44,530,209 - 44,534,658 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	17	49,289,303 - 49,293,753 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	17	43,780,258 - 43,784,712 (+)	NCBI	Rnor_WKY
Rnor_6.0	17	44,522,144 - 44,526,587 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	17	44,522,140 - 44,526,583 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	17	58,943,971 - 58,948,414 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	17	50,113,499 - 50,117,942 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	17	50,116,339 - 50,120,783 (+)	NCBI
Celera	17	53,976,729 - 53,981,173 (-)	NCBI		Celera
Cytogenetic Map	17	p11	NCBI

H4C9
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	6	27,139,282 - 27,139,678 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	6	27,139,282 - 27,139,678 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	6	27,107,061 - 27,107,457 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	6	27,215,067 - 27,215,436 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	6	27,215,066 - 27,215,436	NCBI
Celera	6	28,713,087 - 28,713,456 (+)	NCBI		Celera
Cytogenetic Map	6	p22.1	NCBI
HuRef	6	26,915,149 - 26,915,518 (+)	NCBI		HuRef
CHM1_1	6	27,109,410 - 27,109,779 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	6	27,008,097 - 27,008,493 (+)	NCBI		T2T-CHM13v2.0

H4c8
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	13	23,715,214 - 23,715,648 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	13	23,715,220 - 23,715,689 (+)	Ensembl		GRCm39 Ensembl
GRCm38	13	23,531,044 - 23,531,478 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	13	23,531,050 - 23,531,519 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	13	23,622,919 - 23,623,388 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	13	23,538,515 - 23,538,984 (+)	NCBI		MGSCv36	mm8
Celera	13	23,762,985 - 23,763,454 (+)	NCBI		Celera
Cytogenetic Map	13	A3.1	NCBI

LOC103221971
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	17	45,370,125 - 45,370,754 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	11	14,670,283 - 14,670,591 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666044	26,834,357 - 26,834,758 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Variants

Variants in Hist1h4b
11 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	234
Count of miRNA genes:	146
Interacting mature miRNAs:	162
Transcripts:	ENSRNOT00000043151
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2317054	Aia12	Adjuvant induced arthritis QTL 12	4.24		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	17	38281509	83281509	Rat
2317060	Aia26	Adjuvant induced arthritis QTL 26	3.22		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	17	38281509	83281509	Rat
2324621	Coatc5	Coat color QTL 5			coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	17	31368391	73951021	Rat
4889955	Bss93	Bone structure and strength QTL 93	4.4		tibia size trait (VT:0100001)	tibia cortical bone volume to tibia total bone volume ratio (CMO:0001727)	17	27027949	60463643	Rat
7394837	Memor18	Memory QTL 18			exploratory behavior trait (VT:0010471)	measurement of voluntary locomotion into, out of or within a discrete space in an experimental apparatus (CMO:0000957)	17	18640182	63640182	Rat
8552928	Pigfal9	Plasma insulin-like growth factor 1 level QTL 9	9		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	17	28409147	73409147	Rat
9590107	Sffal7	Serum free fatty acids level QTL 7	4.81	0.001	blood free fatty acid amount (VT:0001553)	plasma free fatty acids level (CMO:0000546)	17	28409147	73409147	Rat
631497	Bp98	Blood pressure QTL 98	3.66		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	17	41354651	60463643	Rat
7488966	Bp370	Blood pressure QTL 370		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	23653184	57246843	Rat
1300148	Bp192	Blood pressure QTL 192	3.47		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	17	34550843	73951021	Rat
10054088	Scort28	Serum corticosterone level QTL 28	2.04	0.0102	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	17	4528038	49528038	Rat
1354581	Bp247	Blood pressure QTL 247	4.5		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	17	1	69599340	Rat
1354619	Bp242	Blood pressure QTL 242	6.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	17	24599340	69599340	Rat
1354628	Stl13	Serum triglyceride level QTL 13	3.8		blood triglyceride amount (VT:0002644)	blood triglyceride level (CMO:0000118)	17	21293039	60781592	Rat
1354630	Cm34	Cardiac mass QTL 34	8.7		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	17	4299130	69599340	Rat
1354635	Bp245	Blood pressure QTL 245	6		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	17	42073160	69599340	Rat
1354635	Bp245	Blood pressure QTL 245	6		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	42073160	69599340	Rat
1354638	Insul1	Insulin level QTL 1	4.8		blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	17	4299130	69599340	Rat
1354640	Scl32	Serum cholesterol level QTL 32	5.4		blood HDL cholesterol amount (VT:0000184)	blood high density lipoprotein cholesterol level (CMO:0000052)	17	15781592	60781592	Rat
1354651	Lmblg2	Limb length QTL 2	6		tibia length (VT:0004357)	tibia length (CMO:0000450)	17	4299130	69599340	Rat
1354658	Spl8	Serum phospholipid level QTL 8	3.8		blood VLDL phospholipid amount (VT:0010507)	blood very low density lipoprotein phospholipid level (CMO:0001571)	17	1	60781592	Rat
1354659	Scl68	Serum cholesterol level QTL 68	3.9		blood VLDL cholesterol amount (VT:0005144)	blood very low density lipoprotein cholesterol level (CMO:0000648)	17	15781592	60781592	Rat
1354662	Rf49	Renal function QTL 49	2.9		blood creatinine amount (VT:0005328)	plasma creatinine level (CMO:0000537)	17	1	69599340	Rat
1354663	Bvd5	Brain ventricular dilatation QTL 5	3.51	0.001	brain ventricle morphology trait (VT:0000822)	hydrocephalus severity score (CMO:0001881)	17	31990784	81292925	Rat
1358295	Aocep1	Aortic cell protein QTL 1	6.1	0.00000071	thoracic aorta cellular protein amount (VT:0010598)	aortic cell percentage	17	40990005	85990005	Rat
1559055	Bp278	Blood pressure QTL 278		0.04	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	23653184	68653184	Rat
1581512	Cm55	Cardiac mass QTL 55	2.8	0.05	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	17	27027949	56836890	Rat
1598871	Memor5	Memory QTL 5	5.3		exploratory behavior trait (VT:0010471)	total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443)	17	40540041	80387013	Rat
61394	Bp8	Blood pressure QTL 8	2.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	17	23080567	59555013	Rat
70157	Niddm32	Non-insulin dependent diabetes mellitus QTL 32	4.34		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	17	22454924	50909196	Rat
724528	Uae4	Urinary albumin excretion QTL 4	4.9	0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	17	35837085	69599340	Rat
2302377	Scl61	Serum cholesterol level QTL 61	4.36		blood HDL cholesterol amount (VT:0000184)	serum high density lipoprotein cholesterol level (CMO:0000361)	17	27389946	53481766	Rat
2303627	Vencon8	Ventilatory control QTL 8		0.001	respiration trait (VT:0001943)	tidal volume (CMO:0000222)	17	4528038	49528038	Rat
724549	Niddm56	Non-insulin dependent diabetes mellitus QTL 56		0.03	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	17	31990784	76990784	Rat
12903978	Cm118	Cardiac mass QTL 118		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	17	23653184	68653184	Rat
2301412	Kidm40	Kidney mass QTL 40		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	17	37479847	82479847	Rat
12903980	Cm120	Cardiac mass QTL 120		0.002	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	17	23653184	68653184	Rat
12903982	Kidm70	Kidney mass QTL 70		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	17	23653184	70974005	Rat
1331765	Hrtrt15	Heart rate QTL 15	4.094		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	17	15330613	55836425	Rat
1354596	Bw32	Body weight QTL 32	4.5		body mass (VT:0001259)	body weight (CMO:0000012)	17	4299130	60781592	Rat
10450503	Bp386	Blood pressure QTL 386		0.28	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	31368391	62109574	Rat
2303561	Bw91	Body weight QTL 91	2		body mass (VT:0001259)	body weight (CMO:0000012)	17	8868462	53868462	Rat
12903979	Cm119	Cardiac mass QTL 119		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	17	23653184	68653184	Rat
2313854	Bp343	Blood pressure QTL 343	3.9		life span trait (VT:0005372)	age at time of death (CMO:0001193)	17	31990784	50909196	Rat
12903981	Am17	Aortic mass QTL 17		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	17	23653184	68653184	Rat

Markers in Region

RH129544

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	17	42,484,566 - 42,484,785 (+)	MAPPER	mRatBN7.2
Rnor_6.0	17	44,526,242 - 44,526,460	NCBI	Rnor6.0
Rnor_5.0	17	58,944,098 - 58,944,316	UniSTS	Rnor5.0
RGSC_v3.4	17	50,117,597 - 50,117,815	UniSTS	RGSC3.4
Celera	17	53,976,856 - 53,977,074	UniSTS
Cytogenetic Map	17	q11	UniSTS

RH129874

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	17	42,484,582 - 42,484,785 (+)	MAPPER	mRatBN7.2
Rnor_6.0	17	44,526,258 - 44,526,460	NCBI	Rnor6.0
Rnor_5.0	17	58,944,098 - 58,944,300	UniSTS	Rnor5.0
RGSC_v3.4	17	50,117,613 - 50,117,815	UniSTS	RGSC3.4
Celera	17	53,976,856 - 53,977,058	UniSTS
Cytogenetic Map	17	q11	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	30	53	38	19	38	1	1	35	35	30	11	1
Low		13	4	3		3	7	10	39		11		7
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_022686	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AY936209	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC100619	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474072	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000292	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M27433	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M28409	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X13554	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

NM_022686 ⟹ NP_073177

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	17	42,480,467 - 42,484,912 (+)	NCBI
Rnor_6.0	17	44,522,144 - 44,526,587 (+)	NCBI
Rnor_5.0	17	58,943,971 - 58,948,414 (-)	NCBI
RGSC_v3.4	17	50,113,499 - 50,117,942 (+)	RGD
Celera	17	53,976,729 - 53,981,173 (-)	RGD

Sequence:

show sequence

GAGCAGCCTACATAATAATATGTCTGGCCGAGGCAAAGGCGGGAAAGGCTTGGGCAAAGGCGGC
GCTAAGCGCCACCGCAAAGTCCTGCGCGACAACATCCAGGGCATCACCAAGCCCGCCATTCGCC
GCCTGGCCCGGCGCGGAGGAGTGAAGCGCATCTCCGGCCTCATCTACGAGGAGACCCGCGGTGT
GCTGAAGGTGTTCCTGGAGAACGTGATCCGCGACGCCGTCACCTACACGGAGCACGCCAAGCGC
AAGACCGTCACCGCCATGGACGTGGTCTACGCACTCAAACGCCAGGGCCGTACCCTCTATGGCT
TCGGCGGCTAAGAAACAAAGTGAAATTACATGAAAGGAGAGAAACGACAATCAAAGGCTTTGCT
TCCACCCAACTTTTCTATTAAAACAGTGTATCTTCAGAATTTCAGAGAAGAATAAAACAAACTT
TGTAAAGTCAAAAATGATATAGTTTTGAAAACCGGCTTACTAACCTATTGTTAATAACATTGGC
ACTTTATTGAGAGTTTGGGAGTTAGAAAGCTTACTCCAAGACTAATAAAATAAACCTGAAGGTA
GAATCCATCATCACTCTAAACACAAGAAAAGAAAGAGAAAAAAGTCCTGTTTATAAGGGGCTCG
ATGGGTGGTGCAGGTTTATAATCCAGAATTTCAAATAGCTGAGGCAGGAGCCCAGAGTTTGTTA
CACAACGAATCCCAGCTACATAACAAGAAAGAGCCTGTCTCAAAAACAAACAAAACCCTGGATA
GTAGAAACCTAGAATACCTACTGAAGAAACATGCAAATATTGTTTCTTTTTAGTGTCTCATGAA
ATTGAAATGGGTAGTATACTGCACCGGTGGTTTTTCCCACCAGCTACCTGATTTCTGCCTAAGG
GTTATAAAGTCTGCTGTGGTTAAAAGTGAAGGGCCAGAAGAGAGAAAATTGTACTTGTTGGGAA
ACACTAGAAAGCTCTCTTTACACCATCCCGCCTTTACTTGTGATAAATGCCTTCTCCAATTACC
TCCACCTTTGCTCTTTGCTTTGAAAACCGTTTTCTTTACATCCTTCTAGATTGCTCCCAGCATT
TAAAAACAAAAAAATACATAGTAATTATTACCTCATAGATTTGTGTAAAGATTAAAAATGGGTT
CAGATACTACAGGCATGTCTATATAAGTGCTTGATAATCACTCAAGAAGTGTTTAAAATCATTT
TATATTTTTTAAGAATATTAATGTAAAAAAAAGAATATTAATGTAACAAGCAATGTTCTAATAA
AGACTTGGATGGATAG

hide sequence

Protein Sequences


Protein RefSeqs	NP_073177	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA41306	(Get FASTA)	NCBI Sequence Viewer
	AAA60735	(Get FASTA)	NCBI Sequence Viewer
	AAI00620	(Get FASTA)	NCBI Sequence Viewer
	AAX28930	(Get FASTA)	NCBI Sequence Viewer
	CAA31906	(Get FASTA)	NCBI Sequence Viewer
	EDL84585	(Get FASTA)	NCBI Sequence Viewer
	P62804	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:	NP_073177 ⟸ NM_022686
- UniProtKB:	Q7M0E8 (UniProtKB/Swiss-Prot), P62804 (UniProtKB/Swiss-Prot)
- Sequence:	show sequence MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLE NVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG hide sequence

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P62804-F1-model_v2	AlphaFold	P62804	1-103	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:620814	AgrOrtholog
BioCyc Gene	G2FUF-9296	BioCyc
Ensembl Genes	ENSRNOG00000032224	UniProtKB/Swiss-Prot
	ENSRNOG00000054017	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
	ENSRNOG00000063552	UniProtKB/Swiss-Prot
	ENSRNOG00000064025	UniProtKB/Swiss-Prot
	ENSRNOG00000065263	UniProtKB/Swiss-Prot
	ENSRNOG00000066473	UniProtKB/Swiss-Prot
	ENSRNOG00000067648	UniProtKB/Swiss-Prot
	ENSRNOG00000070513	UniProtKB/Swiss-Prot
	ENSRNOG00000070706	UniProtKB/Swiss-Prot
Ensembl Protein	ENSRNOP00000039602.3	UniProtKB/Swiss-Prot
	ENSRNOP00000071163	ENTREZGENE
	ENSRNOP00000071163.1	UniProtKB/Swiss-Prot
	ENSRNOP00000074659.1	UniProtKB/Swiss-Prot
	ENSRNOP00000079614.1	UniProtKB/Swiss-Prot
	ENSRNOP00000080829.1	UniProtKB/Swiss-Prot
	ENSRNOP00000080971.1	UniProtKB/Swiss-Prot
	ENSRNOP00000087751.1	UniProtKB/Swiss-Prot
	ENSRNOP00000087795.1	UniProtKB/Swiss-Prot
	ENSRNOP00000091037.1	UniProtKB/Swiss-Prot
	ENSRNOP00000091116.1	UniProtKB/Swiss-Prot
	ENSRNOP00000091524.1	UniProtKB/Swiss-Prot
	ENSRNOP00000093704.1	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000040210.5	UniProtKB/Swiss-Prot
	ENSRNOT00000080490	ENTREZGENE
	ENSRNOT00000080490.2	UniProtKB/Swiss-Prot
	ENSRNOT00000088408.2	UniProtKB/Swiss-Prot
	ENSRNOT00000105806.1	UniProtKB/Swiss-Prot
	ENSRNOT00000106060.1	UniProtKB/Swiss-Prot
	ENSRNOT00000107328.1	UniProtKB/Swiss-Prot
	ENSRNOT00000112120.1	UniProtKB/Swiss-Prot
	ENSRNOT00000112947.1	UniProtKB/Swiss-Prot
	ENSRNOT00000114507.1	UniProtKB/Swiss-Prot
	ENSRNOT00000115294.1	UniProtKB/Swiss-Prot
	ENSRNOT00000117583.1	UniProtKB/Swiss-Prot
	ENSRNOT00000120238.1	UniProtKB/Swiss-Prot
Gene3D-CATH	1.10.20.10	UniProtKB/Swiss-Prot
InterPro	CENP-T/H4_C	UniProtKB/Swiss-Prot
	Histone-fold	UniProtKB/Swiss-Prot
	Histone_H4	UniProtKB/Swiss-Prot
	Histone_H4_CS	UniProtKB/Swiss-Prot
	TAF_TATA-bd	UniProtKB/Swiss-Prot
KEGG Report	rno:291152	UniProtKB/Swiss-Prot
	rno:295277	UniProtKB/Swiss-Prot
	rno:364723	UniProtKB/Swiss-Prot
	rno:64627	UniProtKB/Swiss-Prot
NCBI Gene	64627	ENTREZGENE
PANTHER	HISTONE H4	UniProtKB/Swiss-Prot
	HISTONE H4	UniProtKB/Swiss-Prot
Pfam	CENP-T_C	UniProtKB/Swiss-Prot
PhenoGen	Hist1h4b	PhenoGen
PRINTS	HISTONEH4	UniProtKB/Swiss-Prot
PROSITE	HISTONE_H4	UniProtKB/Swiss-Prot
SMART	SM00417	UniProtKB/Swiss-Prot
	TAF	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF47113	UniProtKB/Swiss-Prot
UniProt	H4_RAT	UniProtKB/Swiss-Prot, ENTREZGENE
	Q7M0E8	ENTREZGENE
UniProt Secondary	P02304	UniProtKB/Swiss-Prot
	P02305	UniProtKB/Swiss-Prot
	Q5BM23	UniProtKB/Swiss-Prot
	Q7M0E8	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2017-05-23	Hist1h4b	histone cluster 1 H4 family member B	Hist1h4b	histone cluster 1, H4b	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-11-07	Hist1h4b	histone cluster 1, H4b		germinal histone H4 gene	Name updated	1299863	APPROVED
2005-02-24	Hist1h4b	germinal histone H4 gene	H1ft	germinal histone H4 gene	Data Merged	737654	APPROVED
2004-09-10	Hist1h4b	germinal histone H4 gene	Hist4		Symbol and Name updated	1299863	APPROVED
2003-02-27	H1ft	germinal histone H4 gene			Symbol and Name status set to provisional	70820	PROVISIONAL
2002-08-07	Hist4	germinal histone H4 gene			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_regulation	expression is down-regulated in postmeiotic early spermatids	632841

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)