Plk2 (polo-like kinase 2) - Rat Genome Database

Name: Plk2
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Plk2 (polo-like kinase 2) Rattus norvegicus

Analyze

Symbol:

Plk2

Name:

polo-like kinase 2

RGD ID:

620760

Description:

Enables clathrin heavy chain binding activity; enzyme binding activity; and protein serine/threonine kinase activity. Involved in several processes, including Rap protein signal transduction; modulation of chemical synaptic transmission; and negative regulation of protein localization to cell surface. Located in dendrite. Orthologous to human PLK2 (polo like kinase 2); INTERACTS WITH (+)-schisandrin B; 1,2-dimethylhydrazine; 1,3-dinitrobenzene.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

PLK-2; polo-like kinase 1; polo-like kinase 2 (Drosophila); serine/threonine-protein kinase PLK2; serine/threonine-protein kinase SNK; serum-inducible kinase; Snk

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	PLK2 (polo like kinase 2)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Plk2 (polo like kinase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Plk2 (polo like kinase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	PLK2 (polo like kinase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	PLK2 (polo like kinase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Plk2 (polo like kinase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	PLK2 (polo like kinase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	PLK2 (polo like kinase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Plk2 (polo like kinase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Plk2 (polo like kinase 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	PLK2 (polo like kinase 2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	plk2b (polo-like kinase 2b (Drosophila))	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder\|PANTHER)
Danio rerio (zebrafish):	plk2a (polo-like kinase 2a (Drosophila))	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	CDC5	Alliance	DIOPT (InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	plk2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	2	41,969,176 - 41,974,945 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	41,969,176 - 41,974,947 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	49,090,164 - 49,095,930 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	47,148,897 - 47,154,663 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	42,001,899 - 42,007,665 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	41,911,143 - 41,916,901 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	41,911,131 - 41,916,901 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	60,970,300 - 60,976,058 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	41,800,745 - 41,806,503 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	2	41,721,113 - 41,726,872 (+)	NCBI
Celera	2	37,785,007 - 37,790,765 (+)	NCBI		Celera
Cytogenetic Map	2	q14	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Animal Mammary Neoplasms (ISO)

carcinoma (ISO)

esophageal atresia (ISO)

Experimental Mammary Neoplasms (IEP,ISO)

genetic disease (ISO)

hereditary breast ovarian cancer syndrome (ISO)

juvenile rheumatoid arthritis (ISO)

Neurodevelopmental Disorders (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

(-)-epigallocatechin 3-gallate (ISO)

(S)-nicotine (ISO)

1,1-dichloroethene (ISO)

1,2-dimethylhydrazine (EXP)

1,3-dinitrobenzene (EXP)

17alpha-ethynylestradiol (EXP,ISO)

17beta-estradiol (EXP,ISO)

17beta-hydroxy-5alpha-androstan-3-one (ISO)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dinitrotoluene (EXP)

2-acetamidofluorene (ISO)

2-butoxyethanol (ISO)

3,3',5,5'-tetrabromobisphenol A (ISO)

3,4-dichloroaniline (ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4-(N-nitrosomethylamino)-1-(3-pyridyl)butan-1-one (EXP)

4-hydroxynon-2-enal (ISO)

4-hydroxyphenyl retinamide (ISO)

5-aza-2'-deoxycytidine (ISO)

5-fluorouracil (ISO)

6-O-methylguanine (ISO)

7,12-dimethyltetraphene (EXP,IEP,ISO)

acetamide (EXP)

acrylamide (EXP,ISO)

aflatoxin B1 (EXP,ISO)

all-trans-retinoic acid (ISO)

ammonium chloride (EXP)

antirheumatic drug (ISO)

aristolochic acid A (ISO)

Aroclor 1254 (ISO)

azoxystrobin (EXP)

benzene (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

benzo[b]fluoranthene (ISO)

Benzo[k]fluoranthene (ISO)

bis(2-chloroethyl) sulfide (EXP)

bisphenol A (EXP,ISO)

butan-1-ol (ISO)

butanal (ISO)

cadmium dichloride (ISO)

calciol (ISO)

cannabidiol (ISO)

carbamazepine (ISO)

carbon nanotube (ISO)

carbonyl sulfide (EXP)

chloroprene (ISO)

chlorpyrifos (EXP,ISO)

chromium(6+) (ISO)

chrysene (ISO)

ciguatoxin CTX1B (ISO)

cisplatin (EXP,ISO)

clobetasol (ISO)

clofibrate (ISO)

cobalt dichloride (ISO)

copper atom (EXP)

copper(0) (EXP)

copper(II) sulfate (ISO)

corticosterone (EXP)

coumarin (ISO)

CU-O LINKAGE (ISO)

Cuprizon (EXP)

curcumin (ISO)

cyclosporin A (ISO)

cylindrospermopsin (ISO)

dexamethasone (ISO)

diazinon (EXP)

dibenz[a,h]anthracene (ISO)

dibutyl phthalate (EXP,ISO)

dicrotophos (ISO)

dieldrin (EXP)

dinophysistoxin 1 (ISO)

dioxygen (ISO)

disodium selenite (ISO)

diuron (ISO)

dorsomorphin (ISO)

doxorubicin (ISO)

Echimidine (ISO)

endosulfan (EXP)

ethanol (ISO)

etoposide (ISO)

ferric oxide (ISO)

ferroheme b (ISO)

fluoranthene (ISO)

fonofos (ISO)

formaldehyde (ISO)

genistein (ISO)

gentamycin (EXP)

glafenine (EXP)

glyphosate (EXP)

heme b (ISO)

hydrogen cyanide (ISO)

hydrogen peroxide (EXP,ISO)

imidacloprid (EXP)

indometacin (ISO)

irinotecan (ISO)

iron(III) nitrilotriacetate (EXP)

isobutanol (ISO)

L-ascorbic acid (EXP)

Lasiocarpine (ISO)

leflunomide (ISO)

Licochalcone B (ISO)

lipopolysaccharide (ISO)

mercury dibromide (ISO)

mercury dichloride (EXP)

metformin (EXP)

methapyrilene (EXP)

methotrexate (EXP)

methoxyacetic acid (ISO)

methylmercury chloride (ISO)

monocrotaline (ISO)

N-ethyl-N-nitrosourea (ISO)

N-methyl-4-phenylpyridinium (EXP)

N-nitrosodiethylamine (ISO)

N-Nitrosopyrrolidine (ISO)

naphthalenes (EXP)

nickel dichloride (EXP)

nickel sulfate (ISO)

nicotine (ISO)

ochratoxin A (EXP)

oxaliplatin (EXP)

ozone (EXP,ISO)

p-chloromercuribenzoic acid (ISO)

paracetamol (EXP,ISO)

parathion (ISO)

perfluorooctane-1-sulfonic acid (EXP,ISO)

phenobarbital (ISO)

phenylmercury acetate (ISO)

PhIP (EXP,IEP)

pirinixic acid (ISO)

potassium chromate (ISO)

potassium cyanide (ISO)

pregnenolone 16alpha-carbonitrile (ISO)

progesterone (EXP,ISO)

propanal (ISO)

propiconazole (ISO)

quercetin (ISO)

quinolin-8-ol (ISO)

riddelliine (ISO)

SB 431542 (ISO)

silicon dioxide (ISO)

silver atom (ISO)

silver(0) (ISO)

simvastatin (ISO)

sodium arsenite (ISO)

Soman (EXP)

sorafenib (ISO)

succimer (ISO)

tamoxifen (ISO)

temozolomide (ISO)

terbufos (ISO)

tetrachloromethane (EXP,ISO)

tetraphene (ISO)

thiabendazole (EXP)

thimerosal (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

topotecan (EXP)

torcetrapib (ISO)

trichloroethene (EXP)

trichostatin A (ISO)

Triptolide (ISO)

triptonide (ISO)

tris(2-butoxyethyl) phosphate (ISO)

troglitazone (ISO)

trovafloxacin (ISO)

urethane (ISO)

valproic acid (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

G1/S transition of mitotic cell cycle (IBA,IEA,ISO,ISS)

long-term synaptic depression (IDA)

long-term synaptic potentiation (IDA)

memory (IEA,ISO,ISS)

mitotic cell cycle (ISO)

mitotic spindle organization (IBA,IEA,ISO,ISS)

negative regulation of angiogenesis (IEA,ISO)

negative regulation of apoptotic process (ISO,ISS)

negative regulation of apoptotic process in bone marrow cell (IEA,ISO)

negative regulation of cellular senescence (IEA,ISO)

negative regulation of dendritic spine development (IMP)

negative regulation of excitatory postsynaptic potential (IMP)

negative regulation of protein binding (IMP)

negative regulation of protein localization to cell surface (IMP)

phosphorylation (IEA)

positive regulation of autophagy (IEA,ISO)

positive regulation of canonical NF-kappaB signal transduction (ISO)

positive regulation of cell migration involved in sprouting angiogenesis (IEA,ISO)

positive regulation of proteasomal ubiquitin-dependent protein catabolic process (IMP)

positive regulation of protein binding (IDA)

positive regulation of protein catabolic process (IEA,ISO)

positive regulation of receptor internalization (IMP)

Rap protein signal transduction (IDA)

Ras protein signal transduction (IDA)

regulation of centriole replication (IEA,ISO,ISS)

regulation of synaptic plasticity (IBA,IDA,IEA,IMP,ISO,TAS)

Cellular Component

centriole (IBA,IEA,ISO,ISS)

centrosome (IBA,IEA,ISO,ISS)

chromatin (IEA,ISO)

cytoplasm (IBA,IEA,ISO)

dendrite (IDA)

kinetochore (IBA)

nucleus (IBA)

spindle pole (IBA)

Molecular Function

ATP binding (IEA)

ATP-dependent protein binding (IEA,ISO)

ATPase binding (IPI)

clathrin heavy chain binding (IPI)

GTPase binding (IPI)

protein binding (IPI,ISO)

protein kinase binding (IPI)

protein serine kinase activity (IEA)

protein serine/threonine kinase activity (IBA,IDA,IEA,ISO)

protein-containing complex binding (IPI)

References

References - curated

#	Reference Title	Reference Citation
1.	Regulation of postsynaptic RapGAP SPAR by Polo-like kinase 2 and the SCFbeta-TRCP ubiquitin ligase in hippocampal neurons.	Ang XL, etal., J Biol Chem. 2008 Oct 24;283(43):29424-32. doi: 10.1074/jbc.M802475200. Epub 2008 Aug 22.
2.	Plk2 attachment to NSF induces homeostatic removal of GluA2 during chronic overexcitation.	Evers DM, etal., Nat Neurosci. 2010 Oct;13(10):1199-207. doi: 10.1038/nn.2624. Epub 2010 Aug 29.
3.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
5.	The polo-like protein kinases Fnk and Snk associate with a Ca(2+)- and integrin-binding protein and are regulated dynamically with synaptic plasticity.	Kauselmann G, etal., EMBO J 1999 Oct 15;18(20):5528-39.
6.	Requirement for Plk2 in orchestrated ras and rap signaling, homeostatic structural plasticity, and memory.	Lee KJ, etal., Neuron. 2011 Mar 10;69(5):957-73. doi: 10.1016/j.neuron.2011.02.004.
7.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
8.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
9.	Targeted protein degradation and synapse remodeling by an inducible protein kinase.	Pak DT and Sheng M, Science 2003 Nov 21;302(5649):1368-73. Epub 2003 Oct 23.
10.	GOA pipeline	RGD automated data pipeline
11.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
12.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
13.	Critical role of CDK5 and Polo-like kinase 2 in homeostatic synaptic plasticity during elevated activity.	Seeburg DP, etal., Neuron. 2008 May 22;58(4):571-83. doi: 10.1016/j.neuron.2008.03.021.
14.	cDNA microarray profiling of rat mammary gland carcinomas induced by 2-amino-1-methyl-6-phenylimidazo[4,5-b]pyridine and 7,12-dimethylbenzanthracene.	Shan L, etal., Carcinogenesis. 2002 Oct;23(10):1561-8.
15.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Additional References at PubMed

PMID:12761501	PMID:12897130	PMID:12972611	PMID:15242618	PMID:15489334	PMID:16203730	PMID:18579731	PMID:19001868	PMID:20146300	PMID:20352051	PMID:20531387	PMID:21691298
PMID:22854038	PMID:22870256	PMID:23466428	PMID:23479645	PMID:23850969	PMID:23983262	PMID:26934179	PMID:27579920	PMID:27908889	PMID:29066438	PMID:31134620	PMID:34047419

Genomics

Comparative Map Data

Plk2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	2	41,969,176 - 41,974,945 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	41,969,176 - 41,974,947 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	49,090,164 - 49,095,930 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	47,148,897 - 47,154,663 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	42,001,899 - 42,007,665 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	41,911,143 - 41,916,901 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	41,911,131 - 41,916,901 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	60,970,300 - 60,976,058 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	41,800,745 - 41,806,503 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	2	41,721,113 - 41,726,872 (+)	NCBI
Celera	2	37,785,007 - 37,790,765 (+)	NCBI		Celera
Cytogenetic Map	2	q14	NCBI

PLK2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	5	58,453,982 - 58,460,086 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	5	58,453,982 - 58,460,139 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	5	57,749,809 - 57,755,913 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	5	57,785,566 - 57,791,670 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	5	57,785,569 - 57,791,844	NCBI
Celera	5	54,688,300 - 54,694,404 (-)	NCBI		Celera
Cytogenetic Map	5	q11.2	NCBI
HuRef	5	54,706,921 - 54,713,078 (-)	NCBI		HuRef
CHM1_1	5	57,749,420 - 57,755,577 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	5	59,272,431 - 59,278,533 (-)	NCBI		T2T-CHM13v2.0

Plk2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	13	110,531,578 - 110,537,378 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	13	110,531,580 - 110,537,378 (+)	Ensembl		GRCm39 Ensembl
GRCm38	13	110,395,044 - 110,400,844 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	13	110,395,046 - 110,400,844 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	13	111,185,252 - 111,191,052 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	13	111,515,940 - 111,521,722 (+)	NCBI		MGSCv36	mm8
Celera	13	114,729,888 - 114,735,651 (+)	NCBI		Celera
Cytogenetic Map	13	D2.1	NCBI
cM Map	13	61.97	NCBI

Plk2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955446	9,671,090 - 9,677,188 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955446	9,671,090 - 9,676,956 (+)	NCBI	ChiLan1.0	ChiLan1.0

PLK2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	5	53,607,973 - 53,614,939 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	5	55,543,828 - 55,550,116 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	5	57,178,503 - 57,184,793 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	5	57,177,836 - 57,184,793 (+)	Ensembl	panpan1.1		panPan2

PLK2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	2	45,359,865 - 45,365,496 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	2	45,360,374 - 45,367,441 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	2	42,431,127 - 42,436,818 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	2	45,844,932 - 45,850,642 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	2	45,844,939 - 45,850,697 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	2	42,914,745 - 42,920,462 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	2	43,720,594 - 43,726,300 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	2	44,541,169 - 44,546,873 (-)	NCBI		UU_Cfam_GSD_1.0

Plk2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024407213	200,743,971 - 200,750,098 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936480	9,680,449 - 9,686,595 (+)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936480	9,680,461 - 9,686,593 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

PLK2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	16	37,299,119 - 37,305,114 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	16	37,299,116 - 37,305,114 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	16	40,067,358 - 40,073,357 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

PLK2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	4	54,629,868 - 54,636,134 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	4	54,629,194 - 54,636,032 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666049	3,546,484 - 3,552,760 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Plk2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624759	811,316 - 817,474 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624759	811,320 - 817,401 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Plk2
18 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	475
Count of miRNA genes:	252
Interacting mature miRNAs:	298
Transcripts:	ENSRNOT00000016768
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
61355	Bp36	Blood pressure QTL 36	2.9		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	2	5873687	102844969	Rat
1600379	Mcs18	Mammary carcinoma susceptibility QTL 18	2.6		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	2	7887772	42804738	Rat
738012	Anxrr3	Anxiety related response QTL 3	3.8		exploratory behavior trait (VT:0010471)	percentage of entries into a discrete space in an experimental apparatus (CMO:0000961)	2	9023519	54023519	Rat
10755430	Coatc6	Coat color QTL 6		0.02576	coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	2	11591100	56591100	Rat
1578664	Bmd9	Bone mineral QTL density 9	5		femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	2	11852062	49003364	Rat
731184	Mamtr4	Mammary tumor resistance QTL 4		0.0003	mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	2	16491740	61491740	Rat
1357990	Ael1	Aortic elastin QTL 1	3.1	0.00091	aorta elastin amount (VT:0003905)	aortic elastin	2	19076825	64076825	Rat
731167	Glom4	Glomerulus QTL 4	2.4	0.0082	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002)	2	20304672	65304672	Rat
2300168	Bmd47	Bone mineral density QTL 47	6.6	0.0001	femur mineral mass (VT:0010011)	bone mineral density (CMO:0001226)	2	20662448	65662448	Rat
10402051	Gdil2	Gastrointestinal dilation QTL 2			enteric ganglion morphology trait (VT:0001045)	length of intestine affected by colonic aganglionosis to total length of colon ratio (CMO:0001836)	2	24903853	74786777	Rat
1302794	Stl27	Serum triglyceride level QTL 27	4.4	0.0001	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	2	25413423	143657569	Rat
1358894	Kidm24	Kidney mass QTL 24	4.03		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	25413423	157142209	Rat
1358899	Kidm23	Kidney mass QTL 23	3.88		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	25413423	157142209	Rat
1358901	Cm38	Cardiac mass QTL 38	2		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	157142209	Rat
1358904	Cm39	Cardiac mass QTL 39	2.26		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	157142209	Rat
1358910	Kidm27	Kidney mass QTL 27	5.77		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	25413423	157142209	Rat
1358911	Kidm28	Kidney mass QTL 28	5.42		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	25413423	157142209	Rat
1358913	Cm41	Cardiac mass QTL 41	2.73		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	203928301	Rat
1358917	Cm42	Cardiac mass QTL 42	2.82		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	203928301	Rat
1358887	Bw50	Body weight QTL 50	2.39		body mass (VT:0001259)	body weight (CMO:0000012)	2	25413652	157142078	Rat
1358908	Bw49	Body weight QTL 49	3.36		body mass (VT:0001259)	body weight (CMO:0000012)	2	25413652	157142078	Rat
1354617	Bp240	Blood pressure QTL 240	4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	26917817	81754745	Rat
1354617	Bp240	Blood pressure QTL 240	4		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	26917817	81754745	Rat
1354617	Bp240	Blood pressure QTL 240	4		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	26917817	81754745	Rat
1354603	Bp243	Blood pressure QTL 243	3.9		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	26917817	127469484	Rat
2290453	Scl55	Serum cholesterol level QTL 55	2.83		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	2	26917817	136917119	Rat
1331764	Bp205	Blood pressure QTL 205	3.476		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	26999571	43154682	Rat
1643006	Pain1	Pain QTL 1	3.63	0.005	mechanical nociception trait (VT:0002734)	self mutilation severity score (CMO:0002145)	2	26999571	48268661	Rat
9590095	Sffal3	Serum free fatty acids level QTL 3	6.78	0.001	blood free fatty acid amount (VT:0001553)	plasma free fatty acids level (CMO:0000546)	2	27157160	72157160	Rat
1300160	Hrtrt3	Heart rate QTL 3	3.62		heart pumping trait (VT:2000009)	absolute change in heart rate (CMO:0000534)	2	29971593	51729300	Rat
10755434	Coatc7	Coat color QTL 7		0.04794	coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	2	30648065	75648065	Rat
731179	Mamtr3	Mammary tumor resistance QTL 3		0.0001	mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	2	32373770	43665178	Rat
10755436	Coatc8	Coat color QTL 8		0.02431	coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	2	35023117	80023117	Rat
61371	Edpm1	Estrogen-dependent pituitary mass QTL 1	4	0.05	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	2	35134841	88029593	Rat
70174	BpQTLCluster2	Blood pressure QTL cluster 2	4.24		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	40067944	102785628	Rat
70174	BpQTLCluster2	Blood pressure QTL cluster 2	4.24		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	40067944	102785628	Rat
70174	BpQTLCluster2	Blood pressure QTL cluster 2	4.24		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	40067944	102785628	Rat
70174	BpQTLCluster2	Blood pressure QTL cluster 2	4.24		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	2	40067944	102785628	Rat
70174	BpQTLCluster2	Blood pressure QTL cluster 2	4.24		arterial blood pressure trait (VT:2000000)	absolute change in mean arterial blood pressure (CMO:0000533)	2	40067944	102785628	Rat
12879863	Bp402	Blood pressure QTL 402		0.003	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	41125789	56532139	Rat

Markers in Region

IB1671

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	41,974,662 - 41,974,824 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	41,916,622 - 41,916,783	NCBI	Rnor6.0
Rnor_5.0	2	60,975,779 - 60,975,940	UniSTS	Rnor5.0
RGSC_v3.4	2	41,806,224 - 41,806,385	UniSTS	RGSC3.4
Celera	2	37,790,486 - 37,790,647	UniSTS
Cytogenetic Map	2	q14	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium		43	42	33	13	33	4	4	74	22	41	11	4
Low	3		15	8	6	8	4	7		13			4
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_031821	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF136583	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC070878	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473955	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000065	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000016768 ⟹ ENSRNOP00000016768

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	41,969,176 - 41,974,947 (+)	Ensembl
Rnor_6.0 Ensembl	2	41,911,131 - 41,916,901 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000111192 ⟹ ENSRNOP00000092527

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	41,969,176 - 41,974,947 (+)	Ensembl

RefSeq Acc Id:

NM_031821 ⟹ NP_114009

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	2	41,969,176 - 41,974,945 (+)	NCBI
Rnor_6.0	2	41,911,143 - 41,916,901 (+)	NCBI
Rnor_5.0	2	60,970,300 - 60,976,058 (+)	NCBI
RGSC_v3.4	2	41,800,745 - 41,806,503 (+)	RGD
Celera	2	37,785,007 - 37,790,765 (+)	RGD

Sequence:

show sequence

CCACGCGTCCGGGAGCCGGACGTCGGACTAGAGAGTAGGGAGAGCGATTGGGGCTCGAGGGACA
GGGCTAGACCGGACGCGTGTCCGCGCCTCGGAGGTGGCAGTAGGTAGTGTCGGGTAGCGAGGCA
ACGATGGAGCTCCTGCGGACTATCACCTACCAGCCGGCCGCCGGCACCAAGATGTGCGAGCAGG
CGCTGGGCAAAGCTTGCGGCGGGGACTCAAAGAAGAAGCGACCGCAGCAGCCTTCTGAAGACGG
GCAGTCCCAAGCCCAGGTGACCCCGGCGGCCCCACACCACCATCATCACCATTCTCACTCCGGA
CCCGAGATCTCGCGGATTATAGTCGACCCCACGACGGGGAAGCGCTACTGCCGGGGCAAAGTGC
TGGGCAAGGGTGGATTTGCAAAGTGTTACGAAATGACAGATCTGACAAACAACAAAGTCTACGC
TGCAAAAATTATCCCTCACAGCAGAGTAGCTAAACCTCATCAAAGGGAAAAGATCGACAAAGAA
ATTGAGCTTCACAGAATCCTGCACCATAAGCATGTAGTGCAGTTTTACCACTACTTTGAAGACA
AAGAAAACATTTACATCCTCTTGGAGTACTGCAGTAGAAGGTCCATGGCTCATATCTTGAAAGC
AAGAAAGGTGTTGACAGAGCCAGAAGTCCGATACTACCTCAGGCAGATTGTGTCGGGACTCAAG
TATCTTCACGAACAAGAAATCTTGCATAGGGATCTCAAGCTAGGGAACTTTTTTATTAATGAGG
CCATGGAGCTGAAGGTTGGAGACTTCGGCTTGGCTGCCAGACTGGAACCTTTGGAACACAGAAG
GAGAACAATATGTGGAACCCCAAATTATCTCTCCCCTGAAGTCCTCAACAAACAAGGACATGGC
TGTGAATCAGACATCTGGGCCTTAGGCTGTGTAATGTATACAATGCTGCTAGGAAGACCTCCAT
TCGAAACAACAAATCTGAAAGAAACGTACAGGTGCATAAGAGAAGCAAGATATACAATGCCGTC
TTCATTACTGGCCCCCGCCAAGCACTTGATAGCCAGCATGCTGTCCAAAAACCCAGAGGACCGC
CCCAGTTTGGATGACATCATTCGGCATGACTTCTTTCTGCAGGGCTTCACTCCAGACAGACTCT
CTTCTAGCTGTTGCCACACAGTTCCAGACTTCCACTTGTCAAGCCCAGCTAAGAATTTCTTTAA
GAAAGCTGCTGCCGCTCTTTTTGGTGGCAAAAAGGACAAAGCAAGATATAATGACACACACAAT
AAAGTGTCTAAGGAAGATGAAGACATCTACAAGCTTCGGCATGATTTGAAGAAAACATCGATAA
CCCAGCAACCCAGCAAACACAGAACAGATGAGGAGCTCCAGCCTCCTCCAACTACCTTTGCCAA
ATCTGGGACATCCGCAGTGGAAAACAAACAGCAGATTGGAGATGCAATCCGGATGATAGTTAGA
GGGACGCTGGGCAGCTGCAGCAGCAGCAGTGAATGCCTTGAGGATAGCACCATGGGAAGTGTTG
CAGACACAGTGGCAAGAGTCCTTCGAGGGTGTCTAGAAAACATGCCTGAAGCTGACTGTATTCC
CAAAGAGCAGTTGAGCACGTCCTTTCAGTGGGTCACCAAATGGGTCGACTACTCCAACAAATAC
GGCTTTGGATACCAGCTCTCAGACCACACTGTTGGAGTCCTTTTCAACAACGGCGCTCACATGA
GCCTCCTTCCAGACAAAAAGACAGTTCACTATTATGCGGAACTTGGCCAATGCTCTGTTTTCCC
AGCAACAGATGCCCCCGAACAATTTATTAGTCAAGTGACGGTGCTGAAATACTTTTCCCACTAC
ATGGAGGAGAACCTCATGGATGGTGGCGATCTCCCTAGTGTTACTGACATTCGAAGACCTCGGC
TCTACCTCCTTCAGTGGTTAAAGTCTGATAAAGCCTTAATGATGCTCTTCAATGACGGCACATT
TCAGGTGAATTTCTACCACGATCATACAAAGATAATTATCTGTAACCAAAATGAAGAATACCTT
CTCACATACATCAACGAAGACAGGATATCTACAACTTTCAGACTGACGACCCTGTTGATGTCTG
GCTGTTCGCTAGAATTGAAACATCGAATGGAATACGCCCTGAACATGCTCTTGCAGAGATGTAA
CTGAAAAACCTCTTTTAGAGCGGACCTCGTGGGGGCTCTTTTCCACTGTGAGATCAACAGGGAA
GCCAGTGGAGGGATAACGGAGCATGTTAGAGAAATCGGACAGGTGCTGGTACGAATACGAGTCG
TCTGTGGCCTGCTGGACTGCTGGAACCAGACCAGCCTAAGGTGGACAGTTGACTTTGGGCAATC
TTAAGTGTGGAGCCAAGTACAGTTTTCCTTGAGATACCTGTCTTTACAAAGTTTATCGGACAAT
TTTGCAGACAGACGCTTTGACTCTGAAGTTCTCTCTGTGGAGAGTGTTTTCAGTTGGAAGACTT
GGAACTGTGAATAAACTTCCTGAAGGGGAGGGAGAAGGGAGGAAGCTCCCTCGCTGTTGAAAGG
CTACAATCAGAGCAGCTTTTGTTTGGCTGCTTAACTGTGAACTATGGCCATACATATTTTTTTT
TTTGGTTATTTTTGAATACACTTGTGGCTGGAAAAGTGCATTCCTTGTTAATAAACTTTTTATT
TATTACAGCCCCAAGAGCAGTATTTATTATCAAGATGTCTTTTTTTTTTATGTTGACCATTTTG
AACTCTTGGCAATAAAGAGTATGAAATAG

hide sequence

Protein Sequences


Protein RefSeqs	NP_114009	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAF08366	(Get FASTA)	NCBI Sequence Viewer
	AAH70878	(Get FASTA)	NCBI Sequence Viewer
	EDM10332	(Get FASTA)	NCBI Sequence Viewer
	Q9R012	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_114009 ⟸ NM_031821

- UniProtKB:

Q9R012 (UniProtKB/Swiss-Prot), A6I5M4 (UniProtKB/TrEMBL), A0A8I6ADU0 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MELLRTITYQPAAGTKMCEQALGKACGGDSKKKRPQQPSEDGQSQAQVTPAAPHHHHHHSHSGP
EISRIIVDPTTGKRYCRGKVLGKGGFAKCYEMTDLTNNKVYAAKIIPHSRVAKPHQREKIDKEI
ELHRILHHKHVVQFYHYFEDKENIYILLEYCSRRSMAHILKARKVLTEPEVRYYLRQIVSGLKY
LHEQEILHRDLKLGNFFINEAMELKVGDFGLAARLEPLEHRRRTICGTPNYLSPEVLNKQGHGC
ESDIWALGCVMYTMLLGRPPFETTNLKETYRCIREARYTMPSSLLAPAKHLIASMLSKNPEDRP
SLDDIIRHDFFLQGFTPDRLSSSCCHTVPDFHLSSPAKNFFKKAAAALFGGKKDKARYNDTHNK
VSKEDEDIYKLRHDLKKTSITQQPSKHRTDEELQPPPTTFAKSGTSAVENKQQIGDAIRMIVRG
TLGSCSSSSECLEDSTMGSVADTVARVLRGCLENMPEADCIPKEQLSTSFQWVTKWVDYSNKYG
FGYQLSDHTVGVLFNNGAHMSLLPDKKTVHYYAELGQCSVFPATDAPEQFISQVTVLKYFSHYM
EENLMDGGDLPSVTDIRRPRLYLLQWLKSDKALMMLFNDGTFQVNFYHDHTKIIICNQNEEYLL
TYINEDRISTTFRLTTLLMSGCSLELKHRMEYALNMLLQRCN

hide sequence

RefSeq Acc Id:

ENSRNOP00000016768 ⟸ ENSRNOT00000016768

RefSeq Acc Id:

ENSRNOP00000092527 ⟸ ENSRNOT00000111192

Protein Domains

POLO box Protein kinase

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q9R012-F1-model_v2	AlphaFold	Q9R012	1-682	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:620760	AgrOrtholog
BioCyc Gene	G2FUF-54435	BioCyc
Ensembl Genes	ENSRNOG00000011951	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000016768	ENTREZGENE, UniProtKB/Swiss-Prot
	ENSRNOP00000092527.1	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000016768	ENTREZGENE, UniProtKB/Swiss-Prot
	ENSRNOT00000111192.1	UniProtKB/TrEMBL
Gene3D-CATH	3.30.1120.30	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Transferase(Phosphotransferase) domain 1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7096750	IMAGE-MGC_LOAD
InterPro	Kinase-like_dom_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PLK2_STKc	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	POLO_box_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	POLO_box_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	POLO_box_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	POLO_box_dom_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Prot_kinase_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Protein_kinase_ATP_BS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Ser/Thr_kinase_AS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:83722	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:91616	IMAGE-MGC_LOAD
NCBI Gene	83722	ENTREZGENE
PANTHER	SERINE/THREONINE-PROTEIN KINASE PLK	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SERINE/THREONINE-PROTEIN KINASE PLK2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Pkinase	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	POLO_box	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Plk2	PhenoGen
PROSITE	POLO_BOX	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PROTEIN_KINASE_ATP	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PROTEIN_KINASE_DOM	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PROTEIN_KINASE_ST	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
SMART	S_TKc	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	Polo-box domain	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SSF56112	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A8I6ADU0	ENTREZGENE, UniProtKB/TrEMBL
	A6I5M4	ENTREZGENE, UniProtKB/TrEMBL
	PLK2_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2011-08-02	Plk2	polo-like kinase 2	Plk2	polo-like kinase 2 (Drosophila)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-09-10	Plk2	polo-like kinase 2 (Drosophila)	Snk	serum-inducible kinase	Symbol and Name updated	1299863	APPROVED
2002-08-07	Snk	serum-inducible kinase			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_expression	expression is induced by neuronal activity	61555
gene_product	member of the polo family of cell cycle associated kinases	61555

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD