Advanced Search (OLGA)

Gene: Homer2 (homer scaffold protein 2) Rattus norvegicus

Analyze

Symbol:

Homer2

Name:

homer scaffold protein 2

RGD ID:

620705

Description:

Enables G protein-coupled glutamate receptor binding activity; identical protein binding activity; and protein domain specific binding activity. Predicted to be involved in several processes, including G protein-coupled glutamate receptor signaling pathway; negative regulation of calcineurin-NFAT signaling cascade; and negative regulation of interleukin-2 production. Predicted to act upstream of or within behavioral response to cocaine; calcium-mediated signaling; and regulation of G protein-coupled receptor signaling pathway. Located in dendrite; neuronal cell body; and plasma membrane. Human ortholog(s) of this gene implicated in autosomal dominant nonsyndromic deafness 68. Orthologous to human HOMER2 (homer scaffold protein 2); PARTICIPATES IN glutamate signaling pathway; INTERACTS WITH 1,2,4-trimethylbenzene; 2,3,7,8-tetrachlorodibenzodioxine; aflatoxin B1.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

cupidin; homer homolog 2; homer homolog 2 (Drosophila); homer protein homolog 2; homer scaffolding protein 2; homer, neuronal immediate early gene, 2; homer-2; VASP/Ena-related gene up-regulated during seizure and LTP 2; Vesl-2

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	HOMER2 (homer scaffold protein 2)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, Panther, PhylomeDB
Mus musculus (house mouse):	Homer2 (homer scaffolding protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Homer2 (homer scaffold protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	HOMER2 (homer scaffold protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Homer2 (homer scaffold protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	HOMER2 (homer scaffold protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	HOMER2 (homer scaffold protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Homer2 (homer scaffold protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	TRAPPC1 (trafficking protein particle complex subunit 1)	HGNC	OMA
Alliance orthologs ³
Mus musculus (house mouse):	Homer2 (homer scaffolding protein 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	HOMER2 (homer scaffold protein 2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	homer2 (homer scaffold protein 2)	Alliance	DIOPT (Ensembl Compara\|OrthoFinder)
Drosophila melanogaster (fruit fly):	homer	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	homer2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	144,968,207 - 145,069,022 (-)	NCBI		GRCr8
mRatBN7.2	1	135,558,977 - 135,659,780 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	135,567,414 - 135,659,772 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	143,488,882 - 143,581,178 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	150,658,320 - 150,750,396 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	143,564,822 - 143,658,186 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	143,443,300 - 143,535,579 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	143,443,300 - 143,535,583 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	144,387,025 - 144,478,034 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	137,827,128 - 137,933,089 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	137,905,533 - 138,012,215 (-)	NCBI
Celera	1	127,618,673 - 127,711,006 (-)	NCBI		Celera
Cytogenetic Map	1	q31	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Imported Disease Annotations - ClinVar

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Homer2	Rat	amenorrhea		ISO	RGD:1354175	8554872	ClinVar Annotator: match by term: Primary amenorrhea	ClinVar	PMID:21681106
Homer2	Rat	autosomal dominant nonsyndromic deafness 68		ISO	RGD:1354175	8554872	ClinVar Annotator: match by term: Deafness, autosomal dominant 68 \| ClinVar Annotator: match by term: more ...	ClinVar	PMID:25741868\|PMID:25816005\|PMID:26467025\|PMID:28492532\|PMID:30047143\|PMID:30311386
Homer2	Rat	Bloom syndrome		ISO	RGD:1354175	8554872	ClinVar Annotator: match by term: Bloom syndrome	ClinVar	PMID:28492532
Homer2	Rat	colorectal cancer		ISO	RGD:1354175	8554872	ClinVar Annotator: match by term: Familial colorectal cancer	ClinVar	PMID:28492532
Homer2	Rat	genetic disease		ISO	RGD:1354175	8554872	ClinVar Annotator: match by term: Inborn genetic diseases	ClinVar	PMID:25741868\|PMID:28492532

Imported Disease Annotations - CTD

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Homer2	Rat	Cocaine-Related Disorders		ISO	RGD:1354175	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:15545022

Imported Disease Annotations - OMIM

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Homer2	Rat	autosomal dominant nonsyndromic deafness 68		ISO	RGD:1354175	7240710		OMIM

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Homer2	Rat	(1->4)-beta-D-glucan	multiple interactions	ISO	RGD:736904	6480464	[perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of HOMER2 mRNA	CTD	PMID:36331819
Homer2	Rat	1,2,4-trimethylbenzene	decreases expression	EXP		6480464	pseudocumene results in decreased expression of HOMER2 protein	CTD	PMID:17337753
Homer2	Rat	1,2-dichloroethane	decreases expression	ISO	RGD:736904	6480464	ethylene dichloride results in decreased expression of HOMER2 mRNA	CTD	PMID:28189721\|PMID:28960355
Homer2	Rat	1,2-dimethylhydrazine	affects expression	ISO	RGD:736904	6480464	1,2-Dimethylhydrazine affects the expression of HOMER2 mRNA	CTD	PMID:22206623
Homer2	Rat	17alpha-ethynylestradiol	increases expression	ISO	RGD:736904	6480464	Ethinyl Estradiol results in increased expression of HOMER2 mRNA	CTD	PMID:17942748
Homer2	Rat	17alpha-ethynylestradiol	multiple interactions	ISO	RGD:736904	6480464	[Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of HOMER2 mRNA	CTD	PMID:17942748
Homer2	Rat	17beta-estradiol	multiple interactions	ISO	RGD:1354175	6480464	[Estradiol binds to ESR2 protein] which results in increased expression of HOMER2 mRNA	CTD	PMID:20404318
Homer2	Rat	17beta-estradiol	decreases expression	ISO	RGD:736904	6480464	Estradiol results in decreased expression of HOMER2 mRNA	CTD	PMID:39298647
Homer2	Rat	17beta-hydroxy-5alpha-androstan-3-one	increases expression	ISO	RGD:1354175	6480464	Dihydrotestosterone results in increased expression of HOMER2 mRNA	CTD	PMID:29581250
Homer2	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	EXP		6480464	Tetrachlorodibenzodioxin results in decreased expression of HOMER2 mRNA	CTD	PMID:32109520
Homer2	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	RGD:736904	6480464	Tetrachlorodibenzodioxin affects the expression of HOMER2 mRNA	CTD	PMID:26377647\|PMID:28922406
Homer2	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	EXP		6480464	Tetrachlorodibenzodioxin affects the expression of HOMER2 mRNA	CTD	PMID:22298810
Homer2	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	ISO	RGD:736904	6480464	Tetrachlorodibenzodioxin results in increased expression of HOMER2 mRNA	CTD	PMID:16960034
Homer2	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	EXP		6480464	Tetrachlorodibenzodioxin results in increased expression of HOMER2 mRNA	CTD	PMID:16960034
Homer2	Rat	2,3,7,8-tetrachlorodibenzodioxine	multiple interactions	ISO	RGD:736904	6480464	[Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of HOMER2 mRNA	CTD	PMID:17942748
Homer2	Rat	2-hydroxypropanoic acid	decreases expression	ISO	RGD:1354175	6480464	Lactic Acid results in decreased expression of HOMER2 mRNA	CTD	PMID:30851411
Homer2	Rat	3,3',4,4'-tetrachlorobiphenyl	multiple interactions	ISO	RGD:736904	6480464	3,4,3',4'-tetrachlorobiphenyl inhibits the reaction [Dietary Fats results in increased expression of HOMER2 mRNA]	CTD	PMID:19467301
Homer2	Rat	4,4'-sulfonyldiphenol	affects expression	ISO	RGD:736904	6480464	bisphenol S affects the expression of HOMER2 mRNA	CTD	PMID:39298647
Homer2	Rat	4,4'-sulfonyldiphenol	affects methylation	ISO	RGD:736904	6480464	bisphenol S affects the methylation of HOMER2 gene	CTD	PMID:31683443
Homer2	Rat	aflatoxin B1	affects expression	ISO	RGD:1354175	6480464	Aflatoxin B1 affects the expression of HOMER2 protein	CTD	PMID:20106945
Homer2	Rat	aflatoxin B1	decreases expression	EXP		6480464	Aflatoxin B1 results in decreased expression of HOMER2 mRNA	CTD	PMID:33354967
Homer2	Rat	aflatoxin B1	affects methylation	ISO	RGD:1354175	6480464	Aflatoxin B1 affects the methylation of HOMER2 intron	CTD	PMID:30157460
Homer2	Rat	aflatoxin B1	increases methylation	ISO	RGD:1354175	6480464	Aflatoxin B1 results in increased methylation of HOMER2 gene	CTD	PMID:31555880
Homer2	Rat	aflatoxin B1	decreases expression	ISO	RGD:1354175	6480464	Aflatoxin B1 results in decreased expression of HOMER2 mRNA	CTD	PMID:22100608\|PMID:31555880
Homer2	Rat	aflatoxin B1	decreases expression	ISO	RGD:736904	6480464	Aflatoxin B1 results in decreased expression of HOMER2 mRNA	CTD	PMID:19770486
Homer2	Rat	Aflatoxin B2 alpha	decreases methylation	ISO	RGD:1354175	6480464	aflatoxin B2 results in decreased methylation of HOMER2 intron	CTD	PMID:30157460
Homer2	Rat	alachlor	increases expression	EXP		6480464	alachlor results in increased expression of HOMER2 mRNA	CTD	PMID:12419858
Homer2	Rat	arsane	multiple interactions	ISO	RGD:1354175	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ...	CTD	PMID:39836092
Homer2	Rat	arsenic atom	multiple interactions	ISO	RGD:1354175	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ...	CTD	PMID:39836092
Homer2	Rat	arsenite(3-)	increases methylation	ISO	RGD:1354175	6480464	arsenite results in increased methylation of HOMER2 promoter	CTD	PMID:23974009
Homer2	Rat	arsenous acid	decreases expression	ISO	RGD:1354175	6480464	Arsenic Trioxide results in decreased expression of HOMER2 mRNA	CTD	PMID:29633893
Homer2	Rat	atrazine	affects methylation	EXP		6480464	Atrazine affects the methylation of HOMER2 gene	CTD	PMID:35440735
Homer2	Rat	belinostat	decreases expression	ISO	RGD:1354175	6480464	belinostat results in decreased expression of HOMER2 mRNA	CTD	PMID:26272509
Homer2	Rat	benzo[a]pyrene	decreases expression	ISO	RGD:736904	6480464	Benzo(a)pyrene results in decreased expression of HOMER2 mRNA	CTD	PMID:21715664
Homer2	Rat	benzo[a]pyrene	affects methylation	ISO	RGD:1354175	6480464	Benzo(a)pyrene affects the methylation of HOMER2 intron	CTD	PMID:30157460
Homer2	Rat	benzo[a]pyrene	increases methylation	ISO	RGD:1354175	6480464	Benzo(a)pyrene results in increased methylation of HOMER2 gene	CTD	PMID:31555880
Homer2	Rat	benzo[a]pyrene	decreases expression	ISO	RGD:1354175	6480464	Benzo(a)pyrene results in decreased expression of HOMER2 mRNA	CTD	PMID:20106945\|PMID:31555880\|PMID:32234424
Homer2	Rat	bis(2-ethylhexyl) phthalate	increases expression	ISO	RGD:1354175	6480464	Diethylhexyl Phthalate results in increased expression of HOMER2 mRNA	CTD	PMID:28412506
Homer2	Rat	bis(2-ethylhexyl) phthalate	decreases expression	ISO	RGD:1354175	6480464	Diethylhexyl Phthalate results in decreased expression of HOMER2 mRNA	CTD	PMID:31163220
Homer2	Rat	bisphenol A	decreases expression	ISO	RGD:736904	6480464	bisphenol A results in decreased expression of HOMER2 mRNA	CTD	PMID:26063408\|PMID:32156529
Homer2	Rat	bisphenol A	increases methylation	EXP		6480464	bisphenol A results in increased methylation of HOMER2 gene	CTD	PMID:28505145
Homer2	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of HOMER2 mRNA	CTD	PMID:25181051
Homer2	Rat	bromobenzene	increases expression	EXP		6480464	bromobenzene results in increased expression of HOMER2 mRNA	CTD	PMID:12628495
Homer2	Rat	butanal	increases expression	ISO	RGD:1354175	6480464	butyraldehyde results in increased expression of HOMER2 mRNA	CTD	PMID:26079696
Homer2	Rat	cadmium dichloride	increases expression	EXP		6480464	Cadmium Chloride results in increased expression of HOMER2 mRNA	CTD	PMID:33453195
Homer2	Rat	calcitriol	increases expression	ISO	RGD:1354175	6480464	Calcitriol results in increased expression of HOMER2 mRNA	CTD	PMID:26485663
Homer2	Rat	cantharidin	decreases expression	ISO	RGD:736904	6480464	Cantharidin results in decreased expression of HOMER2 mRNA	CTD	PMID:36907384
Homer2	Rat	CGP 52608	multiple interactions	ISO	RGD:1354175	6480464	CGP 52608 promotes the reaction [RORA protein binds to HOMER2 gene]	CTD	PMID:28238834
Homer2	Rat	chlordecone	increases expression	ISO	RGD:736904	6480464	Chlordecone results in increased expression of HOMER2 mRNA	CTD	PMID:33711761
Homer2	Rat	cisplatin	decreases expression	ISO	RGD:1354175	6480464	Cisplatin results in decreased expression of HOMER2 mRNA	CTD	PMID:27392435
Homer2	Rat	cocaine	multiple interactions	ISO	RGD:736904	6480464	Cocaine affects the reaction [HOMER2 mutant form results in decreased secretion of Excitatory Amino Acid more ...	CTD	PMID:15545022\|PMID:18355967
Homer2	Rat	cocaine	affects expression	EXP		6480464	Cocaine affects the expression of HOMER2 mRNA	CTD	PMID:20187946
Homer2	Rat	cocaine	decreases response to substance	ISO	RGD:736904	6480464	HOMER2 protein results in decreased susceptibility to Cocaine; HOMER2 results in decreased susceptibility to Cocaine	CTD	PMID:14684444\|PMID:15294147\|PMID:15545022
Homer2	Rat	cocaine	decreases expression	ISO	RGD:736904	6480464	Cocaine results in decreased expression of HOMER2 mRNA	CTD	PMID:18355967
Homer2	Rat	copper(II) sulfate	increases expression	ISO	RGD:1354175	6480464	Copper Sulfate results in increased expression of HOMER2 mRNA	CTD	PMID:19549813
Homer2	Rat	cyclosporin A	decreases expression	ISO	RGD:1354175	6480464	Cyclosporine results in decreased expression of HOMER2 mRNA	CTD	PMID:20106945
Homer2	Rat	cyclosporin A	increases expression	ISO	RGD:1354175	6480464	Cyclosporine results in increased expression of HOMER2 mRNA	CTD	PMID:25562108\|PMID:27989131
Homer2	Rat	deguelin	decreases expression	ISO	RGD:1354175	6480464	deguelin results in decreased expression of HOMER2 mRNA	CTD	PMID:33512557
Homer2	Rat	diarsenic trioxide	decreases expression	ISO	RGD:1354175	6480464	Arsenic Trioxide results in decreased expression of HOMER2 mRNA	CTD	PMID:29633893
Homer2	Rat	dibenz[a,h]anthracene	increases expression	ISO	RGD:736904	6480464	1,2,5,6-dibenzanthracene results in increased expression of HOMER2 mRNA	CTD	PMID:26377693
Homer2	Rat	Dibutyl phosphate	affects expression	ISO	RGD:1354175	6480464	di-n-butylphosphoric acid affects the expression of HOMER2 mRNA	CTD	PMID:37042841
Homer2	Rat	diethylstilbestrol	increases expression	EXP		6480464	Diethylstilbestrol results in increased expression of HOMER2 mRNA	CTD	PMID:36653537
Homer2	Rat	doxorubicin	decreases expression	ISO	RGD:1354175	6480464	Doxorubicin results in decreased expression of HOMER2 mRNA	CTD	PMID:29803840
Homer2	Rat	epoxiconazole	decreases expression	ISO	RGD:736904	6480464	epoxiconazole results in decreased expression of HOMER2 mRNA	CTD	PMID:35436446
Homer2	Rat	ethanol	decreases expression	EXP		6480464	Ethanol results in decreased expression of HOMER2 mRNA	CTD	PMID:20655511
Homer2	Rat	ethanol	increases expression	ISO	RGD:736904	6480464	Ethanol results in increased expression of HOMER2 mRNA	CTD	PMID:30319688
Homer2	Rat	genistein	decreases expression	ISO	RGD:1354175	6480464	Genistein results in decreased expression of HOMER2 mRNA	CTD	PMID:15378649
Homer2	Rat	glyphosate	increases methylation	EXP		6480464	Glyphosate results in increased methylation of HOMER2 gene	CTD	PMID:31011160
Homer2	Rat	GW 4064	increases expression	ISO	RGD:736904	6480464	GW 4064 results in increased expression of HOMER2 mRNA	CTD	PMID:26655953
Homer2	Rat	Licochalcone B	increases expression	ISO	RGD:1354175	6480464	licochalcone B results in increased expression of HOMER2 mRNA	CTD	PMID:33647349
Homer2	Rat	maneb	multiple interactions	ISO	RGD:736904	6480464	[Maneb co-treated with Paraquat] results in increased expression of HOMER2 mRNA	CTD	PMID:36117858
Homer2	Rat	manganese atom	multiple interactions	ISO	RGD:1354175	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ...	CTD	PMID:39836092
Homer2	Rat	manganese(0)	multiple interactions	ISO	RGD:1354175	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ...	CTD	PMID:39836092
Homer2	Rat	manganese(II) chloride	multiple interactions	ISO	RGD:1354175	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ...	CTD	PMID:39836092
Homer2	Rat	N,N-diethyl-m-toluamide	multiple interactions	EXP		6480464	[Permethrin co-treated with DEET] results in decreased methylation of HOMER2 gene	CTD	PMID:33148267
Homer2	Rat	ozone	multiple interactions	ISO	RGD:736904	6480464	[Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased more ...	CTD	PMID:25658374\|PMID:27106289\|PMID:34911549
Homer2	Rat	ozone	increases expression	ISO	RGD:736904	6480464	Ozone results in increased expression of HOMER2 mRNA	CTD	PMID:25658374
Homer2	Rat	paracetamol	affects expression	ISO	RGD:736904	6480464	Acetaminophen affects the expression of HOMER2 mRNA	CTD	PMID:17562736
Homer2	Rat	paraquat	decreases expression	ISO	RGD:736904	6480464	Paraquat results in decreased expression of HOMER2 mRNA	CTD	PMID:21371552
Homer2	Rat	paraquat	multiple interactions	ISO	RGD:736904	6480464	[Maneb co-treated with Paraquat] results in increased expression of HOMER2 mRNA	CTD	PMID:36117858
Homer2	Rat	paraquat	increases expression	EXP		6480464	Paraquat results in increased expression of HOMER2 mRNA	CTD	PMID:32680482
Homer2	Rat	parathion	increases expression	ISO	RGD:736904	6480464	Parathion results in increased expression of HOMER2 mRNA	CTD	PMID:34813904
Homer2	Rat	pentanal	increases expression	ISO	RGD:1354175	6480464	pentanal results in increased expression of HOMER2 mRNA	CTD	PMID:26079696
Homer2	Rat	perfluorooctane-1-sulfonic acid	multiple interactions	ISO	RGD:736904	6480464	[perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of HOMER2 mRNA	CTD	PMID:36331819
Homer2	Rat	permethrin	multiple interactions	EXP		6480464	[Permethrin co-treated with DEET] results in decreased methylation of HOMER2 gene	CTD	PMID:33148267
Homer2	Rat	phenylmercury acetate	decreases expression	ISO	RGD:1354175	6480464	Phenylmercuric Acetate results in decreased expression of HOMER2 mRNA	CTD	PMID:26272509
Homer2	Rat	phosgene	affects expression	ISO	RGD:736904	6480464	Phosgene affects the expression of HOMER2 mRNA	CTD	PMID:16300373
Homer2	Rat	picoxystrobin	decreases expression	ISO	RGD:1354175	6480464	picoxystrobin results in decreased expression of HOMER2 mRNA	CTD	PMID:33512557
Homer2	Rat	pirinixic acid	multiple interactions	ISO	RGD:1354175	6480464	[pirinixic acid binds to and results in increased activity of PPARA protein] which results in more ...	CTD	PMID:19710929
Homer2	Rat	pirinixic acid	decreases expression	ISO	RGD:736904	6480464	pirinixic acid results in decreased expression of HOMER2 mRNA	CTD	PMID:20813756\|PMID:23811191
Homer2	Rat	pirinixic acid	increases expression	ISO	RGD:736904	6480464	pirinixic acid results in increased expression of HOMER2 mRNA	CTD	PMID:17426115
Homer2	Rat	pirinixic acid	multiple interactions	ISO	RGD:736904	6480464	[pirinixic acid co-treated with PPARA] results in decreased expression of HOMER2 mRNA	CTD	PMID:20813756
Homer2	Rat	progesterone	decreases expression	ISO	RGD:736904	6480464	Progesterone results in decreased expression of HOMER2 mRNA	CTD	PMID:22238285
Homer2	Rat	rac-lactic acid	decreases expression	ISO	RGD:1354175	6480464	Lactic Acid results in decreased expression of HOMER2 mRNA	CTD	PMID:30851411
Homer2	Rat	raloxifene	affects expression	ISO	RGD:1354175	6480464	Raloxifene Hydrochloride affects the expression of HOMER2 mRNA	CTD	PMID:14699072
Homer2	Rat	resveratrol	decreases expression	ISO	RGD:1354175	6480464	resveratrol results in decreased expression of HOMER2 mRNA	CTD	PMID:18586690
Homer2	Rat	rotenone	decreases expression	EXP		6480464	Rotenone results in decreased expression of HOMER2 mRNA	CTD	PMID:28374803
Homer2	Rat	sodium arsenite	increases expression	ISO	RGD:1354175	6480464	sodium arsenite results in increased expression of HOMER2 mRNA	CTD	PMID:34032870
Homer2	Rat	sodium arsenite	increases expression	ISO	RGD:736904	6480464	sodium arsenite results in increased expression of HOMER2 mRNA	CTD	PMID:37682722
Homer2	Rat	sodium arsenite	multiple interactions	ISO	RGD:1354175	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ...	CTD	PMID:39836092
Homer2	Rat	tamoxifen	affects expression	ISO	RGD:1354175	6480464	Tamoxifen affects the expression of HOMER2 mRNA	CTD	PMID:14699072
Homer2	Rat	tamoxifen	decreases expression	ISO	RGD:1354175	6480464	Tamoxifen results in decreased expression of HOMER2 mRNA	CTD	PMID:15590111
Homer2	Rat	tebuconazole	decreases expression	ISO	RGD:1354175	6480464	tebuconazole results in decreased expression of HOMER2 mRNA	CTD	PMID:30458266
Homer2	Rat	temozolomide	decreases expression	ISO	RGD:1354175	6480464	Temozolomide results in decreased expression of HOMER2 mRNA	CTD	PMID:31758290
Homer2	Rat	tetrachloromethane	decreases expression	ISO	RGD:736904	6480464	Carbon Tetrachloride results in decreased expression of HOMER2 mRNA	CTD	PMID:31919559
Homer2	Rat	triclosan	increases expression	ISO	RGD:1354175	6480464	Triclosan results in increased expression of HOMER2 mRNA	CTD	PMID:30510588
Homer2	Rat	triphenyl phosphate	affects expression	ISO	RGD:1354175	6480464	triphenyl phosphate affects the expression of HOMER2 mRNA	CTD	PMID:37042841
Homer2	Rat	undecane	decreases expression	EXP		6480464	undecane results in decreased expression of HOMER2 protein	CTD	PMID:17337753
Homer2	Rat	valproic acid	affects expression	ISO	RGD:736904	6480464	Valproic Acid affects the expression of HOMER2 mRNA	CTD	PMID:17963808
Homer2	Rat	valproic acid	decreases methylation	ISO	RGD:1354175	6480464	Valproic Acid results in decreased methylation of HOMER2 gene	CTD	PMID:29154799
Homer2	Rat	valproic acid	increases expression	ISO	RGD:1354175	6480464	Valproic Acid results in increased expression of HOMER2 mRNA	CTD	PMID:23179753\|PMID:29154799
Homer2	Rat	valproic acid	decreases expression	ISO	RGD:1354175	6480464	Valproic Acid results in decreased expression of HOMER2 mRNA	CTD	PMID:26272509\|PMID:28001369

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Homer2	Rat	behavioral response to cocaine	acts_upstream_of_or_within	ISO	RGD:736904	1624291	MGI:3526530 PMID:15294147	RGD	PMID:15294147
Homer2	Rat	behavioral response to cocaine	acts_upstream_of_or_within	IEA	UniProtKB:Q9QWW1\|ensembl:ENSMUSP00000146787	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Homer2	Rat	calcium-mediated signaling	acts_upstream_of_or_within	ISO	RGD:736904	1624291	MGI:3526530 PMID:12860966	RGD	PMID:12860966
Homer2	Rat	calcium-mediated signaling	acts_upstream_of_or_within	IEA	UniProtKB:Q9QWW1\|ensembl:ENSMUSP00000146787	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Homer2	Rat	G protein-coupled glutamate receptor signaling pathway	involved_in	IEA	InterPro:IPR044100	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Homer2	Rat	G protein-coupled glutamate receptor signaling pathway	involved_in	IBA	PANTHER:PTN000857479\|RGD:628725	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Homer2	Rat	negative regulation of calcineurin-NFAT signaling cascade	involved_in	ISS	UniProtKB:Q9NSB8	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Homer2	Rat	negative regulation of calcineurin-NFAT signaling cascade	involved_in	ISO	RGD:1354175	1624291	PMID:18218901	RGD	PMID:18218901
Homer2	Rat	negative regulation of calcineurin-NFAT signaling cascade	involved_in	IEA	UniProtKB:Q9NSB8\|ensembl:ENSP00000407634	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Homer2	Rat	negative regulation of interleukin-2 production	involved_in	ISO	RGD:1354175	1624291	PMID:18218901	RGD	PMID:18218901
Homer2	Rat	negative regulation of interleukin-2 production	involved_in	IEA	UniProtKB:Q9NSB8\|ensembl:ENSP00000407634	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Homer2	Rat	negative regulation of interleukin-2 production	involved_in	ISS	UniProtKB:Q9NSB8	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Homer2	Rat	regulation of G protein-coupled receptor signaling pathway	acts_upstream_of_or_within	ISO	RGD:736904	1624291	PMID:12860966	RGD	PMID:12860966
Homer2	Rat	regulation of G protein-coupled receptor signaling pathway	acts_upstream_of_or_within	IEA	UniProtKB:Q9QWW1\|ensembl:ENSMUSP00000146787	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Homer2	Rat	regulation of store-operated calcium entry	involved_in	IBA	MGI:1347345\|PANTHER:PTN000857479	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Homer2	Rat	sensory perception of sound	involved_in	IEA	UniProtKB:Q9NSB8\|ensembl:ENSP00000407634	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Homer2	Rat	sensory perception of sound	involved_in	ISO	RGD:1354175	1624291	PMID:25816005	RGD	PMID:25816005
Homer2	Rat	sensory perception of sound	involved_in	ISS	UniProtKB:Q9QWW1	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Homer2	Rat	sensory perception of sound	involved_in	ISO	RGD:736904	1624291	PMID:25816005	RGD	PMID:25816005
Homer2	Rat	sensory perception of sound	involved_in	IEA	UniProtKB-KW:KW-1009	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Homer2	Rat	sensory perception of sound	involved_in	IEA	UniProtKB:Q9QWW1\|ensembl:ENSMUSP00000146787	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Homer2	Rat	apical part of cell	located_in	IEA	UniProtKB:Q9QWW1\|ensembl:ENSMUSP00000146787	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Homer2	Rat	apical part of cell	located_in	ISO	RGD:736904	1624291	PMID:12860966	RGD	PMID:12860966
Homer2	Rat	cell projection	located_in	IEA	UniProtKB-KW:KW-0966	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Homer2	Rat	cytoplasm	located_in	ISO	RGD:1354175	1624291	PMID:25816005	RGD	PMID:25816005
Homer2	Rat	cytoplasm	located_in	IEA	UniProtKB:Q9NSB8\|ensembl:ENSP00000407634	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Homer2	Rat	cytoplasm	located_in	IEA	UniProtKB:Q9QWW1\|ensembl:ENSMUSP00000146787	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Homer2	Rat	cytoplasm	located_in	IEA	UniProtKB-KW:KW-0963	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Homer2	Rat	cytoplasm	located_in	ISO	RGD:736904	1624291	MGI:3526530 PMID:10493740	RGD	PMID:10493740
Homer2	Rat	cytoplasm	is_active_in	IBA	FB:FBgn0025777\|MGI:1347345\|MGI:1347354\|MGI:1347359\|PANTHER:PTN000857479\|UniProtKB:Q9NSB8	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Homer2	Rat	cytoplasm	located_in	IEA	UniProtKB-SubCell:SL-0086	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Homer2	Rat	cytosol	located_in	IEA	UniProtKB:Q9NSB8\|ensembl:ENSP00000407634	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Homer2	Rat	cytosol	located_in	ISO	RGD:1354175\|UniProtKB:Q9NSB8-1\|UniProtKB:Q9NSB8-2	1624291		RGD	GO_REF:0000052
Homer2	Rat	dendrite		IDA		2302220		RGD
Homer2	Rat	dendrite	is_active_in	IBA	PANTHER:PTN000099620\|RGD:620705\|RGD:628725	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Homer2	Rat	glutamatergic synapse	is_active_in	IEA	UniProtKB:Q9QWW1\|ensembl:ENSMUSP00000146787	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Homer2	Rat	glutamatergic synapse	is_active_in	ISO	RGD:736904	1624291	PMID:24530450	RGD	PMID:24530450
Homer2	Rat	membrane	located_in	IEA	UniProtKB-KW:KW-0472	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Homer2	Rat	neuronal cell body		IDA		2302220		RGD
Homer2	Rat	plasma membrane	located_in	IEA	UniProtKB-SubCell:SL-0039	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Homer2	Rat	plasma membrane	is_active_in	IBA	MGI:1347345\|PANTHER:PTN000857479\|RGD:620705	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Homer2	Rat	plasma membrane	located_in	IDA		25671399	PMID:17584991	UniProt
Homer2	Rat	plasma membrane	located_in	IEA	UniProtKB-KW:KW-1003	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Homer2	Rat	postsynaptic density	is_active_in	IEA	UniProtKB:Q9QWW1\|ensembl:ENSMUSP00000146787	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Homer2	Rat	postsynaptic density	is_active_in	ISO	RGD:736904	1624291	PMID:24530450	RGD	PMID:24530450
Homer2	Rat	postsynaptic density	is_active_in	IBA	MGI:1347345\|MGI:1347354\|MGI:1347359\|PANTHER:PTN000099620\|RGD:628725	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Homer2	Rat	postsynaptic density	located_in	IEA	UniProtKB-SubCell:SL-0297	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Homer2	Rat	stereocilium	located_in	IEA	UniProtKB-SubCell:SL-0302	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Homer2	Rat	stereocilium tip	located_in	ISS	UniProtKB:Q9QWW1	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Homer2	Rat	stereocilium tip	located_in	IEA	UniProtKB:Q9QWW1\|ensembl:ENSMUSP00000146787	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Homer2	Rat	stereocilium tip	located_in	ISO	RGD:736904	1624291	PMID:25816005	RGD	PMID:25816005
Homer2	Rat	synapse	located_in	IEA	UniProtKB-SubCell:SL-0258	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Homer2	Rat	synapse	located_in	IEA	UniProtKB-KW:KW-0770	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Homer2	Rat	actin binding	enables	IEA	UniProtKB:Q9QWW1\|ensembl:ENSMUSP00000146787	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Homer2	Rat	actin binding	enables	ISO	RGD:736904	1624291	PMID:10493740	RGD	PMID:10493740
Homer2	Rat	G protein-coupled glutamate receptor binding	enables	IEA	InterPro:IPR044100\|InterPro:IPR045027	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Homer2	Rat	G protein-coupled glutamate receptor binding	enables	IBA	PANTHER:PTN000857479\|RGD:620705\|RGD:628725	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Homer2	Rat	G protein-coupled glutamate receptor binding	enables	IPI	UniProtKB:P31424	8554618	PMID:15758184	UniProt
Homer2	Rat	glutamate receptor binding		IPI	RGD:2742\|RGD:2746	632975		RGD
Homer2	Rat	identical protein binding		IPI	RGD:620705	632975	homodimerization	RGD
Homer2	Rat	protein binding	enables	IPI	UniProtKB:Q6WQJ1	25671399	PMID:17584991	UniProt
Homer2	Rat	protein binding		IPI	RGD:1309471	2302220		RGD
Homer2	Rat	protein binding	enables	ISO	RGD:736904	1624291	PR:P97772 PMID:10493740, PMID:9808458	RGD	PMID:10493740\|PMID:9808458
Homer2	Rat	protein binding	enables	ISO	RGD:1354175,UniProtKB:Q9NSB8-2	1624291	UniProtKB:Q8WX93-2\|UniProtKB:Q9P2A4 PMID:32296183	RGD	PMID:32296183
Homer2	Rat	protein binding	enables	ISO	RGD:1354175	1624291	UniProtKB:O95644\|UniProtKB:Q13469\|UniProtKB:Q14934\|UniProtKB:Q9BRK4\|UniProtKB:Q9H4P4 PMID:18218901, PMID:25416956	RGD	PMID:18218901\|PMID:25416956
Homer2	Rat	protein domain specific binding		IMP		2302220	CC, UBX domains	RGD
Homer2	Rat	protein-containing complex binding		IPI	RGD:628725	632975	heterodimerization	RGD
Homer2	Rat	synaptic receptor adaptor activity	enables	IEA	UniProtKB:Q9QWW1\|ensembl:ENSMUSP00000146787	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Homer2	Rat	synaptic receptor adaptor activity	enables	ISO	RGD:736904	1624291	PMID:10493740	RGD	PMID:10493740

Molecular Pathway Annotations Click to see Annotation Detail View

Imported Annotations - KEGG (archival)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Homer2	Rat	glutamate signaling pathway		IEA		6907045		KEGG	rno:04724

Disease Annotations Click to see Annotation Detail View

amenorrhea (ISO)

autosomal dominant nonsyndromic deafness 68 (ISO)

Bloom syndrome (ISO)

Cocaine-Related Disorders (ISO)

colorectal cancer (ISO)

genetic disease (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

1,2,4-trimethylbenzene (EXP)

1,2-dichloroethane (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (ISO)

17beta-hydroxy-5alpha-androstan-3-one (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2-hydroxypropanoic acid (ISO)

3,3',4,4'-tetrachlorobiphenyl (ISO)

4,4'-sulfonyldiphenol (ISO)

aflatoxin B1 (EXP,ISO)

Aflatoxin B2 alpha (ISO)

alachlor (EXP)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

arsenous acid (ISO)

atrazine (EXP)

belinostat (ISO)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bromobenzene (EXP)

butanal (ISO)

cadmium dichloride (EXP)

calcitriol (ISO)

cantharidin (ISO)

CGP 52608 (ISO)

chlordecone (ISO)

cisplatin (ISO)

cocaine (EXP,ISO)

copper(II) sulfate (ISO)

cyclosporin A (ISO)

deguelin (ISO)

diarsenic trioxide (ISO)

dibenz[a,h]anthracene (ISO)

Dibutyl phosphate (ISO)

diethylstilbestrol (EXP)

doxorubicin (ISO)

epoxiconazole (ISO)

ethanol (EXP,ISO)

genistein (ISO)

glyphosate (EXP)

GW 4064 (ISO)

Licochalcone B (ISO)

maneb (ISO)

manganese atom (ISO)

manganese(0) (ISO)

manganese(II) chloride (ISO)

N,N-diethyl-m-toluamide (EXP)

ozone (ISO)

paracetamol (ISO)

paraquat (EXP,ISO)

parathion (ISO)

pentanal (ISO)

perfluorooctane-1-sulfonic acid (ISO)

permethrin (EXP)

phenylmercury acetate (ISO)

phosgene (ISO)

picoxystrobin (ISO)

pirinixic acid (ISO)

progesterone (ISO)

rac-lactic acid (ISO)

raloxifene (ISO)

resveratrol (ISO)

rotenone (EXP)

sodium arsenite (ISO)

tamoxifen (ISO)

tebuconazole (ISO)

temozolomide (ISO)

tetrachloromethane (ISO)

triclosan (ISO)

triphenyl phosphate (ISO)

undecane (EXP)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

behavioral response to cocaine (IEA,ISO)

calcium-mediated signaling (IEA,ISO)

G protein-coupled glutamate receptor signaling pathway (IBA,IEA)

negative regulation of calcineurin-NFAT signaling cascade (IEA,ISO,ISS)

negative regulation of interleukin-2 production (IEA,ISO,ISS)

regulation of G protein-coupled receptor signaling pathway (IEA,ISO)

regulation of store-operated calcium entry (IBA)

sensory perception of sound (IEA,ISO,ISS)

Cellular Component

apical part of cell (IEA,ISO)

cell projection (IEA)

cytoplasm (IBA,IEA,ISO)

cytosol (IEA,ISO)

dendrite (IBA,IDA)

glutamatergic synapse (IEA,ISO)

membrane (IEA)

neuronal cell body (IDA)

plasma membrane (IBA,IDA,IEA)

postsynaptic density (IBA,IEA,ISO)

stereocilium (IEA)

stereocilium tip (IEA,ISO,ISS)

synapse (IEA)

Molecular Function

actin binding (IEA,ISO)

G protein-coupled glutamate receptor binding (IBA,IEA,IPI)

glutamate receptor binding (IPI)

identical protein binding (IPI)

protein binding (IPI,ISO)

protein domain specific binding (IMP)

protein-containing complex binding (IPI)

synaptic receptor adaptor activity (IEA,ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

glutamate signaling pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Combined genealogical, mapping, and expression approaches to identify spontaneously hypertensive rat hypertension candidate genes.	Hinojos CA, etal., Hypertension 2005 Apr;45(4):698-704. Epub 2005 Feb 14.
3.	A novel protein specifically interacting with Homer2 regulates ubiquitin-proteasome systems.	Ishibashi T, etal., J Biochem. 2005 May;137(5):617-23.
4.	A key role for diacylglycerol lipase-alpha in metabotropic glutamate receptor-dependent endocannabinoid mobilization.	Jung KM, etal., Mol Pharmacol. 2007 Sep;72(3):612-21. doi: 10.1124/mol.107.037796. Epub 2007 Jun 21.
5.	Novel members of the Vesl/Homer family of PDZ proteins that bind metabotropic glutamate receptors.	Kato A, etal., J Biol Chem 1998 Sep 11;273(37):23969-75.
6.	The scaffold protein Homer1b/c links metabotropic glutamate receptor 5 to extracellular signal-regulated protein kinase cascades in neurons.	Mao L, etal., J Neurosci. 2005 Mar 9;25(10):2741-52.
7.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
8.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
9.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
10.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
11.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
12.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:9808458	PMID:9808459	PMID:10493740	PMID:12860966	PMID:14528310	PMID:15294147	PMID:18218901	PMID:19709672	PMID:23076792	PMID:24530450	PMID:25816005	PMID:26254965

Genomics

Comparative Map Data

Homer2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	144,968,207 - 145,069,022 (-)	NCBI		GRCr8
mRatBN7.2	1	135,558,977 - 135,659,780 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	135,567,414 - 135,659,772 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	143,488,882 - 143,581,178 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	150,658,320 - 150,750,396 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	143,564,822 - 143,658,186 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	143,443,300 - 143,535,579 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	143,443,300 - 143,535,583 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	144,387,025 - 144,478,034 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	137,827,128 - 137,933,089 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	137,905,533 - 138,012,215 (-)	NCBI
Celera	1	127,618,673 - 127,711,006 (-)	NCBI		Celera
Cytogenetic Map	1	q31	NCBI

HOMER2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	15	82,834,661 - 82,986,157 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	15	82,836,946 - 82,986,153 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	15	83,517,735 - 83,621,472 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	15	81,314,789 - 81,412,477 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	15	81,314,788 - 81,412,477	NCBI
Celera	15	60,965,171 - 61,062,906 (+)	NCBI		Celera
Cytogenetic Map	15	q25.2	NCBI
HuRef	15	59,787,302 - 59,884,988 (-)	NCBI		HuRef
CHM1_1	15	83,259,957 - 83,363,087 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	15	80,701,241 - 80,850,554 (-)	NCBI		T2T-CHM13v2.0

Homer2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	7	81,250,229 - 81,356,673 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	7	81,250,229 - 81,357,275 (-)	Ensembl		GRCm39 Ensembl
GRCm38	7	81,600,481 - 81,706,925 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	7	81,600,481 - 81,707,527 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	7	88,745,367 - 88,851,811 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	7	81,483,228 - 81,580,639 (-)	NCBI		MGSCv36	mm8
Celera	7	79,009,788 - 79,104,812 (-)	NCBI		Celera
Cytogenetic Map	7	D3	NCBI
cM Map	7	45.71	NCBI

Homer2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955416	13,741,161 - 13,818,060 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955416	13,671,115 - 13,828,413 (+)	NCBI	ChiLan1.0	ChiLan1.0

HOMER2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	16	72,906,093 - 73,051,976 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	15	77,066,987 - 77,212,497 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	15	62,617,905 - 62,762,903 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	15	80,731,863 - 80,876,442 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	15	80,737,570 - 80,784,729 (-)	Ensembl	panpan1.1		panPan2

Homer2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	128,699,719 - 128,836,080 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936483	17,507,533 - 17,539,105 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936483	17,500,962 - 17,634,804 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

HOMER2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	7	52,001,579 - 52,096,828 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	7	52,001,253 - 52,104,426 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	7	57,489,011 - 57,584,450 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

HOMER2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	29	2,667,718 - 2,810,238 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	29	2,706,134 - 2,803,372 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666059	44,281,540 - 44,425,488 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Homer2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624768	18,635,283 - 18,721,984 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624768	18,626,353 - 18,751,279 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Homer2
742 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	309
Count of miRNA genes:	186
Interacting mature miRNAs:	214
Transcripts:	ENSRNOT00000026158
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
61442	Strs1	Sensitivity to stroke QTL 1	7.4		cerebrum integrity trait (VT:0010549)	post-insult time to onset of cerebrovascular lesion (CMO:0002343)	1	121767634	166767634	Rat
1578780	Cm52	Cardiac mass QTL 52	3.3	0.0001	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	1	81591954	219808434	Rat
1578654	Bss10	Bone structure and strength QTL 10	4		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	1	49393172	159356837	Rat
1598866	Bp287	Blood pressure QTL 287	5.1		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	121006655	166006655	Rat
1578770	Stresp23	Stress response QTL 23			kidney sympathetic nerve activity (VT:0004050)	stimulated renal sympathetic nerve activity to basal renal sympathetic nerve activity ratio (CMO:0001786)	1	123350408	182418476	Rat
9590300	Scort16	Serum corticosterone level QTL 16	4.39	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	1	103111621	148111621	Rat
2298545	Neuinf8	Neuroinflammation QTL 8	4.6		nervous system integrity trait (VT:0010566)	spinal cord beta-2 microglobulin mRNA level (CMO:0002125)	1	57336763	151090257	Rat
7794788	Mcs32	Mammary carcinoma susceptibility QTL 32	2.61		mammary gland integrity trait (VT:0010552)	mammary tumor incidence/prevalence measurement (CMO:0000946)	1	115540693	238914717	Rat
631199	Cm23	Cardiac mass QTL 23	4.6	0.0004	heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	1	115585465	172949803	Rat
2313402	Anxrr24	Anxiety related response QTL 24			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	1	48963584	144267916	Rat
1598850	Bp297	Blood pressure QTL 297	2.1		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	121006655	166006655	Rat
631570	Bp94	Blood pressure QTL 94		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	123479780	142990467	Rat
152025235	Bw194	Body weight QTL 194	4.86		body mass (VT:0001259)		1	123556856	242907031	Rat
152025232	Bw192	Body weight QTL 192	3.93		body mass (VT:0001259)		1	117917486	196963478	Rat
724521	Uae1	Urinary albumin excretion QTL 1	3.8	0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	90508614	173018436	Rat
1358902	Bw47	Body weight QTL 47	1.67		body mass (VT:0001259)	body weight (CMO:0000012)	1	90508614	180359386	Rat
61346	Rf2	Renal disease susceptibility QTL 2	3.7		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	1	99267916	144267916	Rat
8655649	Arrd1	Age-related retinal degeneration QTL 1	4.89		retinal layer morphology trait (VT:0003727)	percentage of study population developing retinopathy during a period of time (CMO:0002453)	1	100357752	183970443	Rat
1300153	Bp171	Blood pressure QTL 171	3.37		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	90664883	143200202	Rat
2317833	Alcrsp19	Alcohol response QTL 19	12.4	0.001	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	1	100979852	145979852	Rat
731168	Bp154	Blood pressure QTL 154	3.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	94642644	214537671	Rat
631202	Gluco13	Glucose level QTL 13		0.0001	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	131763437	159756369	Rat
631205	Bp196	Blood pressure QTL 196	4	0.0001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	118944897	199050459	Rat
1300158	Bp173	Blood pressure QTL 173	3.48		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	1	115540693	185145286	Rat
1641897	Alcrsp1	Alcohol response QTL 1			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	1	100979852	145979852	Rat
1331749	Hrtrt11	Heart rate QTL 11	2.973		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	1	94494440	198211706	Rat
1331751	Bp199	Blood pressure QTL 199	3.60022		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	94494440	181830018	Rat
2293142	Bp314	Blood pressure QTL 314			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	92184926	137184926	Rat
9685799	Bp375	Blood pressure QTL 375			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	125611501	170611501	Rat
2293140	Bp313	Blood pressure QTL 313			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	121833674	166833674	Rat
9685802	Bp376	Blood pressure QTL 376			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	126540680	171540680	Rat
724529	Cm16	Cardiac mass QTL 16	2.7		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	1	87580395	150700247	Rat
61370	Mcs3	Mammary carcinoma susceptibility QTL 3	2.15		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	1	102268556	147268556	Rat
1641895	Bp298	Blood pressure QTL 298			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	123350408	182418476	Rat
70209	Niddm23	Non-insulin dependent diabetes mellitus QTL 23	2.82		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	94494440	198324465	Rat
631496	Bp97	Blood pressure QTL 97	3.08		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	106047847	151047847	Rat
634314	Niddm44	Non-insulin dependent diabetes mellitus QTL 44			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	49393289	199050459	Rat
2303591	Gluco41	Glucose level QTL 41	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	102168504	147168504	Rat
1331793	Bp200	Blood pressure QTL 200	3.71601		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	94494440	172949803	Rat
2313060	Bss71	Bone structure and strength QTL 71	2.6	0.0001	long bone metaphysis morphology trait (VT:0000133)	tibia midshaft total cross-sectional area (CMO:0001715)	1	118944747	163944747	Rat
6893347	Bw98	Body weight QTL 98	0.2	0.53	body mass (VT:0001259)	body weight (CMO:0000012)	1	133680936	178680936	Rat
1354591	Cm36	Cardiac mass QTL 36	4.1		heart left ventricle mass (VT:0007031)	calculated heart weight (CMO:0000073)	1	102813953	201278233	Rat
7421630	Bp362	Blood pressure QTL 362		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	118608292	241799120	Rat
70225	Bp58	Blood pressure QTL 58	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32356093	162846471	Rat
10059597	Bp377	Blood pressure QTL 377	3.42	0.025	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32737458	199368955	Rat
61399	Tcat1	Tongue tumor resistance QTL 1	3.3		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 5 mm (CMO:0001879)	1	99267916	144267916	Rat
6893361	Bw104	Body weight QTL 104	0.59	0.27	body mass (VT:0001259)	body weight (CMO:0000012)	1	133680936	178680936	Rat
724567	Tcas6	Tongue tumor susceptibility QTL 6	6.85		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	1	92948896	144267916	Rat
738006	Anxrr14	Anxiety related response QTL 14	4	0.00035	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	1	130636910	175636910	Rat
1558645	Bw55	Body weight QTL 55	3.2	0.004	body mass (VT:0001259)	body weight (CMO:0000012)	1	133680936	178680936	Rat
1354615	Cm32	Cardiac mass QTL 32	5.2		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	1	102813953	201278233	Rat
634348	Bp138	Blood pressure QTL 138			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	125611501	168883176	Rat
8694370	Bw154	Body weight QTL 154	8.91	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	1	103111621	148111621	Rat
738028	Anxrr12	Anxiety related response QTL 12	4.9	0.00001	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	1	130636910	175636910	Rat
1354623	Rf46	Renal function QTL 46	3.8		blood creatinine amount (VT:0005328)	plasma creatinine level (CMO:0000537)	1	102813953	151162766	Rat
631654	Bp107	Blood pressure QTL 107			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	125611501	170611501	Rat
631544	Bp84	Blood pressure QTL 84	5.6		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	123350408	181759564	Rat
152025212	Bw190	Body weight QTL 190	5.7		body mass (VT:0001259)		1	123556856	196963478	Rat
631549	Bp89	Blood pressure QTL 89	5.7		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	123350581	201284552	Rat
1358189	Cstrr1	Cold stress response QTL 1		0.0001	catecholamine amount (VT:0010543)	urine norepinephrine level (CMO:0001629)	1	123350408	182418476	Rat
1354606	Bp246	Blood pressure QTL 246	3.6		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	1	102813953	218753816	Rat

Markers in Region

D1Mco51

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	135,589,540 - 135,589,751 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	143,465,134 - 143,465,344	NCBI	Rnor6.0
Rnor_5.0	1	144,408,859 - 144,409,069	UniSTS	Rnor5.0
RGSC_v3.4	1	137,848,962 - 137,849,172	UniSTS	RGSC3.4
Celera	1	127,640,507 - 127,640,717	UniSTS
Cytogenetic Map	1	q31	UniSTS

RH140724

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	135,563,325 - 135,563,498 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	143,438,923 - 143,439,095	NCBI	Rnor6.0
Rnor_5.0	1	144,382,648 - 144,382,820	UniSTS	Rnor5.0
RGSC_v3.4	1	137,875,004 - 137,875,176	UniSTS	RGSC3.4
RGSC_v3.4	1	137,822,751 - 137,822,923	UniSTS	RGSC3.4
Celera	1	127,614,308 - 127,614,480	UniSTS
RH 3.4 Map	1	1087.3	UniSTS
Cytogenetic Map	1	q31	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_053309	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039109538	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039109542	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063287628	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AB007689	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AB007690	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AC097241	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473980	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000087785 ⟹ ENSRNOP00000070858

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	135,567,414 - 135,659,772 (-)	Ensembl
Rnor_6.0 Ensembl	1	143,443,300 - 143,535,583 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000094383 ⟹ ENSRNOP00000088957

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	135,567,414 - 135,601,000 (-)	Ensembl

RefSeq Acc Id:

NM_053309 ⟹ NP_445761

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	144,976,642 - 145,068,997 (-)	NCBI
mRatBN7.2	1	135,567,414 - 135,659,772 (-)	NCBI
Rnor_6.0	1	143,443,300 - 143,535,579 (-)	NCBI
Rnor_5.0	1	144,387,025 - 144,478,034 (-)	NCBI
RGSC_v3.4	1	137,827,128 - 137,933,089 (-)	RGD
Celera	1	127,618,673 - 127,711,006 (-)	RGD

Sequence:

show sequence

GGCACGAGCGGGAGGGACCGGCGGCTCCGCCCGAGCGCGGCCGCCCAGCCCCGGGCCGCCCAGC
CGCCCAGCCCCCGCCCTCCCGCCGGCCCGCGCCTGGCGGCGGCCCCGACACCGACAGAGCAGCC
GCGCTGCCGGCGGAATGGAGCGGCGCCGGGGCTGAGCCGGGCGCACTCGGGCCGCCGCATGTGC
CGCGCGGGGAGCAGCTGCCGAGCGGGCGGAGAGCGAACGCCAGGGGCCCCGTCGGAGCGGCCAC
AGGAGCAGCGCCGGAGATGGGAGAGCAGCCCATCTTCACCACGCGAGCGCACGTCTTCCAGATT
GACCCCAGCACCAAGAAGAACTGGGTGCCGGCAAGCAAGCAGGCCGTCACTGTTTCCTACTTCT
ACGATGTCACCAGGAACAGCTATCGGATCATCAGTGTGGATGGAGCCAAGGTAATCATAAACAG
CACCATCACCCCGAACATGACGTTCACCAAAACTTCACAGAAGTTCGGGCAGTGGGCTGACAGC
AGGGCCAACACCGTGTTCGGTCTGGGATTCTCCTCAGAGCAGCAGCTCACAAAGTTTGCAGAGA
AATTCCAGGAGGTAAGAGAAGCTGCCAGGTTAGCCAGAGACAAGTCCCAGGAGAAAATCGAGAC
GTCAAGTAATCATTCCCAAGAATCTGGGTGTGAAACCCCGTCTTCCACTCAGGCATCCAGCGTC
AATGGGACAGATGACGAGAAAGCCTCCCATGCGAGTCCGGCCGACACACACCTCAAGTCTGAGA
ATGACAAGCTGAAGATCGCTTTGACACAGAGTGCTGCCAATGTGAAGAAGTGGGAGATCGAGCT
GCAGACCCTGCGGGAGAGCAATGCCCGGCTGACCACCGCGCTGCAGGAGTCGGCGGCCAGTGTA
GAACAGTGGAAGCGGCAATTCTCCATCTGCAGAGATGAGAATGACAGGCTCCGCAGCAAGATTG
AGGAGCTGGAAGAACAGTGCGGTGAGATCAACAGGGAGAAGGAAAAGAACACCCAGCTGAAGAG
GAGGATTGAGGAGCTGGAGTCAGAGGTCCGAGAAAAGGAAATGGAGTTGAAGGATCTCCGCAAA
CAAAGTGAAATCATACCTCAGCTCATGTCCGAGTGTGAATATGTCTCTGAGAAGTTAGAGGCTG
CAGAAAGAGACAATCAAAACTTGGAAGACAAAGTGCGGTCTCTAAAGACAGACATCGAGGAGAG
TAAATACCGGCAGCGCCACCTGAAGGGGGAGCTCAAGAGCTTCCTTGAGGTGCTGGACGGAAAG
ATCGATGACCTCCACGACTTCCGCCGAGGGCTCTCCAAGCTAGGCACGGATAACTAGGGTGGGG
CGGAGCCTAGATGGAGAGTGGAAAGCGTGTGTGAGAGATGAAGTGGGCATAGGGCATTCTCCGT
TTGCTTCTGTAATGCGGGTGCGTTCTGTCTGTCTCCAGGCCAGTCGTGCCGTCCACTCGCTCCT
CCAGAATAGAAAATCTCTTGCTTCTCTGGCTTTGTGAGGTCGTGGACACCTGGAAGCTTCTGAC
TCAGGAATCCAGAACGGTCTACCTTAGCCGTTTACGCAGTCAGGGCAGGGACATTCAGATCTTC
CCTTAAGGGCTGTTGCAACCCTATGAACTGGGGATGGGGGAAGTATTTTCTAATCCAAGTATCA
TTAACCTTTACAACAGGCCTTTGGGCGCCTTCCGCTGCGTGGCACTCAGTGTGTGAGACTCTAG
ATTCCAGACCGGGAGCACGTGGAGGGAACATCTTTTCCCAGGATGCATTCTGTTCCTTTAGCAG
AGGTAGCTAACCTTTCGAAGTTATGACAGATTTCACACTCAAAAACTGCACAATTGATCTACCC
AAAAAGAAATAATTATTTAAAAAAAAAAACCTAACATATTTTAAGTAAATACACTGTTTTGGGT
TGGAGCGCATTCATAGTTACCCTCAGCTGCATGTGGCCTTTGGACTGTAGGCCACACAAACCTC
GTGCCGAATT

hide sequence

RefSeq Acc Id:

XM_039109538 ⟹ XP_038965466

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	144,968,207 - 145,069,022 (-)	NCBI
mRatBN7.2	1	135,558,977 - 135,659,772 (-)	NCBI

RefSeq Acc Id:

XM_039109542 ⟹ XP_038965470

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	144,968,207 - 145,053,748 (-)	NCBI
mRatBN7.2	1	135,558,977 - 135,644,428 (-)	NCBI

RefSeq Acc Id:

XM_063287628 ⟹ XP_063143698

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	144,968,207 - 145,033,967 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_445761	(Get FASTA)	NCBI Sequence Viewer
	XP_038965466	(Get FASTA)	NCBI Sequence Viewer
	XP_038965470	(Get FASTA)	NCBI Sequence Viewer
	XP_063143698	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	BAA32478	(Get FASTA)	NCBI Sequence Viewer
	BAA32479	(Get FASTA)	NCBI Sequence Viewer
	EDM08697	(Get FASTA)	NCBI Sequence Viewer
	EDM08698	(Get FASTA)	NCBI Sequence Viewer
	EDM08699	(Get FASTA)	NCBI Sequence Viewer
	EDM08700	(Get FASTA)	NCBI Sequence Viewer
	EDM08701	(Get FASTA)	NCBI Sequence Viewer
	EDM08702	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000070858
	ENSRNOP00000070858.1
GenBank Protein	O88801	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_445761 ⟸ NM_053309

- UniProtKB:

O88802 (UniProtKB/Swiss-Prot), O88801 (UniProtKB/Swiss-Prot), A6JCH3 (UniProtKB/TrEMBL), A0A8I6GHM8 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MGEQPIFTTRAHVFQIDPSTKKNWVPASKQAVTVSYFYDVTRNSYRIISVDGAKVIINSTITPN
MTFTKTSQKFGQWADSRANTVFGLGFSSEQQLTKFAEKFQEVREAARLARDKSQEKIETSSNHS
QESGCETPSSTQASSVNGTDDEKASHASPADTHLKSENDKLKIALTQSAANVKKWEIELQTLRE
SNARLTTALQESAASVEQWKRQFSICRDENDRLRSKIEELEEQCGEINREKEKNTQLKRRIEEL
ESEVREKEMELKDLRKQSEIIPQLMSECEYVSEKLEAAERDNQNLEDKVRSLKTDIEESKYRQR
HLKGELKSFLEVLDGKIDDLHDFRRGLSKLGTDN

hide sequence

Ensembl Acc Id:

ENSRNOP00000070858 ⟸ ENSRNOT00000087785

RefSeq Acc Id:	XP_038965466 ⟸ XM_039109538
- Peptide Label:	isoform X1
- UniProtKB:	A6JCH2 (UniProtKB/TrEMBL), A0A8I6GHM8 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038965470 ⟸ XM_039109542
- Peptide Label:	isoform X2
- UniProtKB:	A0A8I6GHM8 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000088957 ⟸ ENSRNOT00000094383

RefSeq Acc Id:	XP_063143698 ⟸ XM_063287628
- Peptide Label:	isoform X2
- UniProtKB:	A0A8I6GHM8 (UniProtKB/TrEMBL)

Protein Domains

WH1

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-O88801-F1-model_v2	AlphaFold	O88801	1-354	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:620705	AgrOrtholog
BioCyc Gene	G2FUF-58693	BioCyc
Ensembl Genes	ENSRNOG00000061450	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000087785	ENTREZGENE
	ENSRNOT00000087785.2	UniProtKB/Swiss-Prot
Gene3D-CATH	1.20.5.1700	UniProtKB/Swiss-Prot
	2.30.29.30	UniProtKB/Swiss-Prot
InterPro	Homer	UniProtKB/Swiss-Prot
	Homer_EVH1	UniProtKB/Swiss-Prot
	PH-like_dom_sf	UniProtKB/Swiss-Prot
	WH1/EVH1_dom	UniProtKB/Swiss-Prot
KEGG Report	rno:29547	UniProtKB/Swiss-Prot
NCBI Gene	29547	ENTREZGENE
PANTHER	PTHR10918	UniProtKB/Swiss-Prot
Pfam	WH1	UniProtKB/Swiss-Prot
PhenoGen	Homer2	PhenoGen
PROSITE	WH1	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000061450	RatGTEx
SMART	WH1	UniProtKB/Swiss-Prot
Superfamily-SCOP	PH domain-like	UniProtKB/Swiss-Prot
UniProt	A0A8I6GHM8	ENTREZGENE, UniProtKB/TrEMBL
	A6JCH0_RAT	UniProtKB/TrEMBL
	A6JCH1_RAT	UniProtKB/TrEMBL
	A6JCH2	ENTREZGENE, UniProtKB/TrEMBL
	A6JCH3	ENTREZGENE, UniProtKB/TrEMBL
	A6JCH4_RAT	UniProtKB/TrEMBL
	A6JCH5_RAT	UniProtKB/TrEMBL
	HOME2_RAT	UniProtKB/Swiss-Prot, ENTREZGENE
	O88802	ENTREZGENE
UniProt Secondary	O88802	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2018-03-16	Homer2	homer scaffold protein 2	Homer2	homer scaffolding protein 2	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2015-02-25	Homer2	homer scaffolding protein 2	Homer2	homer homolog 2 (Drosophila)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-09-10	Homer2	homer homolog 2 (Drosophila)		homer, neuronal immediate early gene, 2	Name updated	1299863	APPROVED
2002-08-07	Homer2	homer, neuronal immediate early gene, 2			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_domains	contains N-terminal EVH1- and PDZ-like domains, C-terminal MCC (mutated in colorectal cancer)-like domain and leucine zipper	632975
gene_expression	expression is increased 1.5 fold in SHR compared with WKY rats	1357414
gene_product	member of the Vesl/Homer family of PDZ proteins	632975

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)