Advanced Search (OLGA)

Gene: Homer2 (homer scaffold protein 2) Rattus norvegicus

Analyze

Symbol:

Homer2

Name:

homer scaffold protein 2

RGD ID:

620705

Description:

Enables G protein-coupled glutamate receptor binding activity; identical protein binding activity; and protein domain specific binding activity. Predicted to be involved in several processes, including G protein-coupled glutamate receptor signaling pathway; negative regulation of calcineurin-NFAT signaling cascade; and negative regulation of interleukin-2 production. Predicted to act upstream of or within behavioral response to cocaine; calcium-mediated signaling; and regulation of G protein-coupled receptor signaling pathway. Located in dendrite; neuronal cell body; and plasma membrane. Human ortholog(s) of this gene implicated in autosomal dominant nonsyndromic deafness 68. Orthologous to human HOMER2 (homer scaffold protein 2); PARTICIPATES IN glutamate signaling pathway; INTERACTS WITH 1,2,4-trimethylbenzene; 2,3,7,8-tetrachlorodibenzodioxine; aflatoxin B1.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

cupidin; homer homolog 2; homer homolog 2 (Drosophila); homer protein homolog 2; homer scaffolding protein 2; homer, neuronal immediate early gene, 2; homer-2; VASP/Ena-related gene up-regulated during seizure and LTP 2; Vesl-2

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	HOMER2 (homer scaffold protein 2)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, Panther, PhylomeDB
Mus musculus (house mouse):	Homer2 (homer scaffolding protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Homer2 (homer scaffold protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	HOMER2 (homer scaffold protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Homer2 (homer scaffold protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	HOMER2 (homer scaffold protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	HOMER2 (homer scaffold protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Homer2 (homer scaffold protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Homer2 (homer scaffold protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	TRAPPC1 (trafficking protein particle complex subunit 1)	HGNC	OMA
Alliance orthologs ³
Mus musculus (house mouse):	Homer2 (homer scaffolding protein 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	HOMER2 (homer scaffold protein 2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	homer2 (homer scaffold protein 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	homer2 (homer scaffold protein 2)	Alliance	DIOPT (Ensembl Compara\|OrthoFinder)
Drosophila melanogaster (fruit fly):	homer	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|SonicParanoid)
Drosophila melanogaster (fruit fly):	homer	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	homer2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	homer2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	144,968,207 - 145,069,022 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	1	144,976,436 - 145,068,997 (-)	Ensembl				GRCr8
mRatBN7.2	1	135,558,977 - 135,659,780 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	135,567,414 - 135,659,772 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	1	143,488,882 - 143,581,178 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	150,658,320 - 150,750,396 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	143,564,822 - 143,658,186 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	143,443,300 - 143,535,579 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	143,443,300 - 143,535,583 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	1	144,387,025 - 144,478,034 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	1	137,827,128 - 137,933,089 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	1	127,618,673 - 127,711,006 (-)	NCBI		Celera
RGSC_v3.1	1	137,905,533 - 138,012,215 (-)	NCBI
Cytogenetic Map	1	q31	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

autosomal dominant nonsyndromic deafness 68 (ISO)

cocaine abuse (IEP)

cocaine dependence (IMP)

Cocaine-Related Disorders (ISO)

genetic disease (ISO)

muscular atrophy (IEP)

temporal lobe epilepsy (IEP)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

1,2,4-trimethylbenzene (EXP)

1,2-dichloroethane (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (ISO)

17beta-hydroxy-5alpha-androstan-3-one (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2-hydroxypropanoic acid (ISO)

3,3',4,4'-tetrachlorobiphenyl (ISO)

4,4'-sulfonyldiphenol (ISO)

aflatoxin B1 (EXP,ISO)

Aflatoxin B2 alpha (ISO)

alachlor (EXP)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

arsenous acid (ISO)

atrazine (EXP)

belinostat (ISO)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bromobenzene (EXP)

butanal (ISO)

cadmium atom (ISO)

cadmium dichloride (EXP,ISO)

calcitriol (ISO)

cantharidin (ISO)

CGP 52608 (ISO)

chlordecone (ISO)

cisplatin (ISO)

cocaine (EXP,ISO)

copper(II) sulfate (ISO)

cyclosporin A (ISO)

deguelin (ISO)

diarsenic trioxide (ISO)

dibenz[a,h]anthracene (ISO)

Dibutyl phosphate (ISO)

diethylstilbestrol (EXP)

doxorubicin (ISO)

epoxiconazole (ISO)

ethanol (EXP,ISO)

genistein (ISO)

glyphosate (EXP)

GW 4064 (ISO)

Licochalcone B (ISO)

maneb (ISO)

manganese atom (ISO)

manganese(0) (ISO)

manganese(II) chloride (ISO)

N,N-diethyl-m-toluamide (EXP)

ozone (ISO)

paracetamol (ISO)

paraquat (EXP,ISO)

parathion (ISO)

pentanal (ISO)

perfluorooctane-1-sulfonic acid (ISO)

permethrin (EXP)

phenylmercury acetate (ISO)

phosgene (ISO)

picoxystrobin (ISO)

pirinixic acid (ISO)

progesterone (ISO)

rac-lactic acid (ISO)

raloxifene (ISO)

resveratrol (ISO)

rotenone (EXP)

sodium arsenite (ISO)

tamoxifen (ISO)

tebuconazole (ISO)

temozolomide (ISO)

tetrachloromethane (ISO)

triclosan (ISO)

triphenyl phosphate (ISO)

undecane (EXP)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

behavioral response to cocaine (IEA,ISO)

calcium-mediated signaling (IEA,ISO)

cellular response to L-glutamate (IEP)

G protein-coupled glutamate receptor signaling pathway (IBA,IEA)

negative regulation of calcineurin-NFAT signaling cascade (IEA,ISO,ISS)

negative regulation of interleukin-2 production (IEA,ISO,ISS)

regulation of G protein-coupled receptor signaling pathway (IEA,ISO)

regulation of glutamate secretion (IMP)

regulation of store-operated calcium entry (IBA)

regulation of synaptic transmission, glutamatergic (IBA)

response to cocaine (IDA)

response to ethanol (IEP)

sensory perception of sound (IBA,IEA,ISO,ISS)

Cellular Component

apical part of cell (IEA,ISO)

cytoplasm (IBA,IEA,ISO)

cytosol (IEA,ISO)

dendrite (IBA,IDA)

glutamatergic synapse (IEA,ISO)

neuronal cell body (IDA)

plasma membrane (IBA,IDA,IEA)

postsynaptic density (IBA,IEA,ISO)

stereocilium (IEA)

stereocilium tip (IEA,ISO,ISS)

synapse (IEA)

Molecular Function

actin binding (IEA,ISO)

G protein-coupled glutamate receptor binding (IBA,IEA,IPI)

glutamate receptor binding (IPI)

identical protein binding (IPI)

protein binding (IPI,ISO)

protein domain specific binding (IMP)

protein-containing complex binding (IPI)

synaptic receptor adaptor activity (IEA,ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

glutamate signaling pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Homer 2 antagonizes protein degradation in slow-twitch skeletal muscles.	Bortoloso E, etal., Am J Physiol Cell Physiol. 2013 Jan 1;304(1):C68-77. doi: 10.1152/ajpcell.00108.2012. Epub 2012 Oct 17.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Cocaine-elicited imbalances in ventromedial prefrontal cortex Homer1 versus Homer2 expression: implications for relapse.	Gould AT, etal., Addict Biol. 2015 Jan;20(1):148-57. doi: 10.1111/adb.12088. Epub 2013 Sep 30.
4.	Homer2 within the nucleus accumbens core bidirectionally regulates alcohol intake by both P and Wistar rats.	Haider A, etal., Alcohol. 2015 Sep;49(6):533-42. doi: 10.1016/j.alcohol.2015.03.009. Epub 2015 Jul 21.
5.	Combined genealogical, mapping, and expression approaches to identify spontaneously hypertensive rat hypertension candidate genes.	Hinojos CA, etal., Hypertension 2005 Apr;45(4):698-704. Epub 2005 Feb 14.
6.	A novel protein specifically interacting with Homer2 regulates ubiquitin-proteasome systems.	Ishibashi T, etal., J Biochem. 2005 May;137(5):617-23.
7.	A key role for diacylglycerol lipase-alpha in metabotropic glutamate receptor-dependent endocannabinoid mobilization.	Jung KM, etal., Mol Pharmacol. 2007 Sep;72(3):612-21. doi: 10.1124/mol.107.037796. Epub 2007 Jun 21.
8.	Novel members of the Vesl/Homer family of PDZ proteins that bind metabotropic glutamate receptors.	Kato A, etal., J Biol Chem 1998 Sep 11;273(37):23969-75.
9.	Comparative proteomics and correlated signaling network of rat hippocampus in the pilocarpine model of temporal lobe epilepsy.	Liu XY, etal., Proteomics. 2008 Feb;8(3):582-603. doi: 10.1002/pmic.200700514.
10.	The scaffold protein Homer1b/c links metabotropic glutamate receptor 5 to extracellular signal-regulated protein kinase cascades in neurons.	Mao L, etal., J Neurosci. 2005 Mar 9;25(10):2741-52.
11.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
12.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
13.	Differential effects of chronic ethanol consumption and withdrawal on homer/glutamate receptor expression in subregions of the accumbens and amygdala of P rats.	Obara I, etal., Alcohol Clin Exp Res. 2009 Nov;33(11):1924-34. Epub 2009 Aug 10.
14.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
15.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
16.	Prolonged-access to cocaine induces distinct Homer2 DNA methylation, hydroxymethylation, and transcriptional profiles in the dorsomedial prefrontal cortex of Male Sprague-Dawley rats.	Ploense KL, etal., Neuropharmacology. 2018 Dec;143:299-305. doi: 10.1016/j.neuropharm.2018.09.029. Epub 2018 Sep 27.
17.	Contributions of prolonged contingent and non-contingent cocaine exposure to escalation of cocaine intake and glutamatergic gene expression.	Ploense KL, etal., Psychopharmacology (Berl). 2018 May;235(5):1347-1359. doi: 10.1007/s00213-017-4798-z. Epub 2017 Dec 12.
18.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
19.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
20.	Glutamate-induced declustering of post-synaptic adaptor protein Cupidin (Homer 2/vesl-2) in cultured cerebellar granule cells.	Shiraishi Y, etal., J Neurochem. 2003 Oct;87(2):364-76. doi: 10.1046/j.1471-4159.2003.02003.x.

Additional References at PubMed

PMID:9808458	PMID:9808459	PMID:10493740	PMID:12860966	PMID:14528310	PMID:15294147	PMID:18218901	PMID:19709672	PMID:24530450	PMID:25816005

Genomics

Comparative Map Data

Homer2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	144,968,207 - 145,069,022 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	1	144,976,436 - 145,068,997 (-)	Ensembl				GRCr8
mRatBN7.2	1	135,558,977 - 135,659,780 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	135,567,414 - 135,659,772 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	1	143,488,882 - 143,581,178 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	150,658,320 - 150,750,396 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	143,564,822 - 143,658,186 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	143,443,300 - 143,535,579 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	143,443,300 - 143,535,583 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	1	144,387,025 - 144,478,034 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	1	137,827,128 - 137,933,089 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	1	127,618,673 - 127,711,006 (-)	NCBI		Celera
RGSC_v3.1	1	137,905,533 - 138,012,215 (-)	NCBI
Cytogenetic Map	1	q31	NCBI

HOMER2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	15	82,834,661 - 82,986,157 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	15	82,834,664 - 82,986,153 (-)	Ensembl			hg38	GRCh38
GRCh37	15	83,517,735 - 83,621,472 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	15	81,314,789 - 81,412,477 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	15	81,314,788 - 81,412,477	NCBI
Celera	15	60,965,171 - 61,062,906 (+)	NCBI		Celera
Cytogenetic Map	15	q25.2	NCBI
HuRef	15	59,787,302 - 59,884,988 (-)	NCBI		HuRef
CHM1_1	15	83,259,957 - 83,363,087 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	15	80,701,241 - 80,850,554 (-)	NCBI		T2T-CHM13v2.0

Homer2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	7	81,250,229 - 81,356,673 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	7	81,250,229 - 81,357,275 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	7	81,600,481 - 81,706,925 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	7	81,600,481 - 81,707,527 (-)	Ensembl			mm10	GRCm38
MGSCv37	7	88,745,367 - 88,851,811 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	7	81,483,228 - 81,580,639 (-)	NCBI		MGSCv36	mm8
Celera	7	79,009,788 - 79,104,812 (-)	NCBI		Celera
Cytogenetic Map	7	D3	NCBI
cM Map	7	45.71	NCBI

Homer2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955416	13,741,161 - 13,818,060 (+)	Ensembl
ChiLan1.0	NW_004955416	13,671,115 - 13,828,413 (+)	NCBI	ChiLan1.0	ChiLan1.0

HOMER2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	16	72,906,093 - 73,051,976 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	15	77,066,987 - 77,212,497 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	15	62,617,905 - 62,762,903 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	15	80,731,863 - 80,876,442 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	15	80,737,570 - 80,784,729 (-)	Ensembl			panPan2	panpan1.1

Homer2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	128,699,719 - 128,836,080 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936483	17,507,533 - 17,539,105 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936483	17,500,962 - 17,634,804 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

HOMER2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	7	52,001,579 - 52,096,828 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	7	52,001,253 - 52,104,426 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	7	57,489,011 - 57,584,450 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

HOMER2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	29	2,667,718 - 2,810,238 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	29	2,706,134 - 2,803,372 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666059	44,281,540 - 44,425,488 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Homer2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624768	18,635,283 - 18,721,984 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624768	18,626,353 - 18,751,279 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Homer2
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	2	118,558,297 - 118,650,671 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Homer2
725 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	309
Count of miRNA genes:	186
Interacting mature miRNAs:	214
Transcripts:	ENSRNOT00000026158
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
61442	Strs1	Sensitivity to stroke QTL 1	7.4		cerebrum integrity trait (VT:0010549)	post-insult time to onset of cerebrovascular lesion (CMO:0002343)	1	131179947	176179947	Rat
1578780	Cm52	Cardiac mass QTL 52	3.3	0.0001	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	1	137611478	182611478	Rat
1578654	Bss10	Bone structure and strength QTL 10	4		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	1	51940904	168768703	Rat
1554320	Bmd1	Bone mineral density QTL 1	12.2	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	1	101228864	146228864	Rat
1598866	Bp287	Blood pressure QTL 287	5.1		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	130419227	175419227	Rat
1578770	Stresp23	Stress response QTL 23			kidney sympathetic nerve activity (VT:0004050)	stimulated renal sympathetic nerve activity to basal renal sympathetic nerve activity ratio (CMO:0001786)	1	132760429	191848948	Rat
631684	Bp117	Blood pressure QTL 117	8.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	120082258	165082258	Rat
9590300	Scort16	Serum corticosterone level QTL 16	4.39	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	1	112521556	157521556	Rat
2298545	Neuinf8	Neuroinflammation QTL 8	4.6		nervous system integrity trait (VT:0010566)	spinal cord beta-2 microglobulin mRNA level (CMO:0002125)	1	66009857	160501508	Rat
631199	Cm23	Cardiac mass QTL 23	4.6	0.0004	heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	1	142582336	182383862	Rat
2313402	Anxrr24	Anxiety related response QTL 24			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	1	51511344	153680016	Rat
1598850	Bp297	Blood pressure QTL 297	2.1		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	130419227	175419227	Rat
631570	Bp94	Blood pressure QTL 94		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	132889797	152403053	Rat
152025235	Bw194	Body weight QTL 194	4.86		body mass (VT:0001259)		1	132966869	252856240	Rat
61341	Bp26	Blood pressure QTL 26			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	139442053	223964440	Rat
152025232	Bw192	Body weight QTL 192	3.93		body mass (VT:0001259)		1	127329268	206393015	Rat
724521	Uae1	Urinary albumin excretion QTL 1	3.8	0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	99645382	182701046	Rat
1358902	Bw47	Body weight QTL 47	1.67		body mass (VT:0001259)	body weight (CMO:0000012)	1	99645382	221502378	Rat
61346	Rf2	Renal disease susceptibility QTL 2	3.7		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	1	142582180	153680016	Rat
8655649	Arrd1	Age-related retinal degeneration QTL 1	4.89		retinal layer morphology trait (VT:0003727)	percentage of study population developing retinopathy during a period of time (CMO:0002453)	1	109493780	193400781	Rat
2317833	Alcrsp19	Alcohol response QTL 19	12.4	0.001	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	1	110389869	155389869	Rat
1300153	Bp171	Blood pressure QTL 171	3.37		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	124975316	152612788	Rat
731168	Bp154	Blood pressure QTL 154	3.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	103779152	223964440	Rat
631202	Gluco13	Glucose level QTL 13		0.0001	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	141173126	169168317	Rat
631205	Bp196	Blood pressure QTL 196	4	0.0001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	98879955	208479939	Rat
631206	Niddm40	Non-insulin dependent diabetes mellitus QTL 40			blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	1	140833106	185833106	Rat
1641897	Alcrsp1	Alcohol response QTL 1			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	1	110389869	155389869	Rat
1331751	Bp199	Blood pressure QTL 199	3.60022		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	116099376	191260518	Rat
2293142	Bp314	Blood pressure QTL 314			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	101594089	146594089	Rat
2293140	Bp313	Blood pressure QTL 313			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	131243790	176243790	Rat
724529	Cm16	Cardiac mass QTL 16	2.7		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	1	96717367	160111531	Rat
737974	Bp161	Blood pressure QTL 161		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	129182274	174182274	Rat
1641895	Bp298	Blood pressure QTL 298			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	132760429	191848948	Rat
631496	Bp97	Blood pressure QTL 97	3.08		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	115183611	176289080	Rat
634314	Niddm44	Non-insulin dependent diabetes mellitus QTL 44			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	51941022	208479811	Rat
1331793	Bp200	Blood pressure QTL 200	3.71601		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	102780511	182384005	Rat
6893347	Bw98	Body weight QTL 98	0.2	0.53	body mass (VT:0001259)	body weight (CMO:0000012)	1	143092939	188092939	Rat
1354591	Cm36	Cardiac mass QTL 36	4.1		heart left ventricle mass (VT:0007031)	calculated heart weight (CMO:0000073)	1	111949780	210707719	Rat
7421630	Bp362	Blood pressure QTL 362		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	128019551	173019551	Rat
70225	Bp58	Blood pressure QTL 58	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	34184556	172281316	Rat
10059597	Bp377	Blood pressure QTL 377	3.42	0.025	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	34565911	208798288	Rat
631519	Pia11	Pristane induced arthritis QTL 11	5.3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	1	93903998	191260518	Rat
61399	Tcat1	Tongue tumor resistance QTL 1	3.3		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 5 mm (CMO:0001879)	1	108680016	153680016	Rat
6893361	Bw104	Body weight QTL 104	0.59	0.27	body mass (VT:0001259)	body weight (CMO:0000012)	1	143092939	188092939	Rat
724562	Rends1	Renal damage susceptibility QTL 1		0.05	kidney glomerulus integrity trait (VT:0010546)	index of glomerular damage (CMO:0001135)	1	139442053	223964440	Rat
724567	Tcas6	Tongue tumor susceptibility QTL 6	6.85		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	1	102359314	153680016	Rat
738006	Anxrr14	Anxiety related response QTL 14	4	0.00035	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	1	140048073	185048073	Rat
1558645	Bw55	Body weight QTL 55	3.2	0.004	body mass (VT:0001259)	body weight (CMO:0000012)	1	143092939	188092939	Rat
1354615	Cm32	Cardiac mass QTL 32	5.2		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	1	111949780	210707719	Rat
634348	Bp138	Blood pressure QTL 138			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	135021436	178317588	Rat
8694370	Bw154	Body weight QTL 154	8.91	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	1	112521556	157521556	Rat
738028	Anxrr12	Anxiety related response QTL 12	4.9	0.00001	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	1	140048073	185048073	Rat
1354623	Rf46	Renal function QTL 46	3.8		blood creatinine amount (VT:0005328)	plasma creatinine level (CMO:0000537)	1	111949780	160574007	Rat
631654	Bp107	Blood pressure QTL 107			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	135021436	180021436	Rat
631544	Bp84	Blood pressure QTL 84	5.6		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	132760429	191190115	Rat
152025212	Bw190	Body weight QTL 190	5.7		body mass (VT:0001259)		1	132966869	206393015	Rat
631549	Bp89	Blood pressure QTL 89	5.7		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	132760429	152404087	Rat
631548	Bp88	Blood pressure QTL 88	5	0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	140915717	185915717	Rat
61433	Cia2	Collagen induced arthritis QTL 2	5		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	1	100345976	145345976	Rat
1358189	Cstrr1	Cold stress response QTL 1		0.0001	catecholamine amount (VT:0010543)	urine norepinephrine level (CMO:0001629)	1	132760429	191848948	Rat
1354606	Bp246	Blood pressure QTL 246	3.6		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	1	111949780	228180370	Rat

Markers in Region

D1Mco51

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	135,589,540 - 135,589,751 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	143,465,134 - 143,465,344	NCBI	Rnor6.0
Rnor_5.0	1	144,408,859 - 144,409,069	UniSTS	Rnor5.0
RGSC_v3.4	1	137,848,962 - 137,849,172	UniSTS	RGSC3.4
Celera	1	127,640,507 - 127,640,717	UniSTS
Cytogenetic Map	1	q31	UniSTS

RH140724

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	135,563,325 - 135,563,498 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	143,438,923 - 143,439,095	NCBI	Rnor6.0
Rnor_5.0	1	144,382,648 - 144,382,820	UniSTS	Rnor5.0
RGSC_v3.4	1	137,875,004 - 137,875,176	UniSTS	RGSC3.4
RGSC_v3.4	1	137,822,751 - 137,822,923	UniSTS	RGSC3.4
Celera	1	127,614,308 - 127,614,480	UniSTS
RH 3.4 Map	1	1087.3	UniSTS
Cytogenetic Map	1	q31	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	165	91	90	59	33	59	6	297	133	11	144	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_053309	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039109538	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039109542	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063287628	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AB007689	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AB007690	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AC097241	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473980	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000087785 ⟹ ENSRNOP00000070858

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	1	144,976,642 - 145,068,997 (-)	Ensembl
mRatBN7.2 Ensembl	1	135,567,414 - 135,659,772 (-)	Ensembl
Rnor_6.0 Ensembl	1	143,443,300 - 143,535,583 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000094383 ⟹ ENSRNOP00000088957

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	1	144,976,642 - 145,010,226 (-)	Ensembl
mRatBN7.2 Ensembl	1	135,567,414 - 135,601,000 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000156492 ⟹ ENSRNOP00000103274

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	1	144,976,436 - 145,068,818 (-)	Ensembl

RefSeq Acc Id:

NM_053309 ⟹ NP_445761

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	144,976,642 - 145,068,997 (-)	NCBI
mRatBN7.2	1	135,567,414 - 135,659,772 (-)	NCBI
Rnor_6.0	1	143,443,300 - 143,535,579 (-)	NCBI
Rnor_5.0	1	144,387,025 - 144,478,034 (-)	NCBI
RGSC_v3.4	1	137,827,128 - 137,933,089 (-)	RGD
Celera	1	127,618,673 - 127,711,006 (-)	RGD

Sequence:

show sequence

GGCACGAGCGGGAGGGACCGGCGGCTCCGCCCGAGCGCGGCCGCCCAGCCCCGGGCCGCCCAGC
CGCCCAGCCCCCGCCCTCCCGCCGGCCCGCGCCTGGCGGCGGCCCCGACACCGACAGAGCAGCC
GCGCTGCCGGCGGAATGGAGCGGCGCCGGGGCTGAGCCGGGCGCACTCGGGCCGCCGCATGTGC
CGCGCGGGGAGCAGCTGCCGAGCGGGCGGAGAGCGAACGCCAGGGGCCCCGTCGGAGCGGCCAC
AGGAGCAGCGCCGGAGATGGGAGAGCAGCCCATCTTCACCACGCGAGCGCACGTCTTCCAGATT
GACCCCAGCACCAAGAAGAACTGGGTGCCGGCAAGCAAGCAGGCCGTCACTGTTTCCTACTTCT
ACGATGTCACCAGGAACAGCTATCGGATCATCAGTGTGGATGGAGCCAAGGTAATCATAAACAG
CACCATCACCCCGAACATGACGTTCACCAAAACTTCACAGAAGTTCGGGCAGTGGGCTGACAGC
AGGGCCAACACCGTGTTCGGTCTGGGATTCTCCTCAGAGCAGCAGCTCACAAAGTTTGCAGAGA
AATTCCAGGAGGTAAGAGAAGCTGCCAGGTTAGCCAGAGACAAGTCCCAGGAGAAAATCGAGAC
GTCAAGTAATCATTCCCAAGAATCTGGGTGTGAAACCCCGTCTTCCACTCAGGCATCCAGCGTC
AATGGGACAGATGACGAGAAAGCCTCCCATGCGAGTCCGGCCGACACACACCTCAAGTCTGAGA
ATGACAAGCTGAAGATCGCTTTGACACAGAGTGCTGCCAATGTGAAGAAGTGGGAGATCGAGCT
GCAGACCCTGCGGGAGAGCAATGCCCGGCTGACCACCGCGCTGCAGGAGTCGGCGGCCAGTGTA
GAACAGTGGAAGCGGCAATTCTCCATCTGCAGAGATGAGAATGACAGGCTCCGCAGCAAGATTG
AGGAGCTGGAAGAACAGTGCGGTGAGATCAACAGGGAGAAGGAAAAGAACACCCAGCTGAAGAG
GAGGATTGAGGAGCTGGAGTCAGAGGTCCGAGAAAAGGAAATGGAGTTGAAGGATCTCCGCAAA
CAAAGTGAAATCATACCTCAGCTCATGTCCGAGTGTGAATATGTCTCTGAGAAGTTAGAGGCTG
CAGAAAGAGACAATCAAAACTTGGAAGACAAAGTGCGGTCTCTAAAGACAGACATCGAGGAGAG
TAAATACCGGCAGCGCCACCTGAAGGGGGAGCTCAAGAGCTTCCTTGAGGTGCTGGACGGAAAG
ATCGATGACCTCCACGACTTCCGCCGAGGGCTCTCCAAGCTAGGCACGGATAACTAGGGTGGGG
CGGAGCCTAGATGGAGAGTGGAAAGCGTGTGTGAGAGATGAAGTGGGCATAGGGCATTCTCCGT
TTGCTTCTGTAATGCGGGTGCGTTCTGTCTGTCTCCAGGCCAGTCGTGCCGTCCACTCGCTCCT
CCAGAATAGAAAATCTCTTGCTTCTCTGGCTTTGTGAGGTCGTGGACACCTGGAAGCTTCTGAC
TCAGGAATCCAGAACGGTCTACCTTAGCCGTTTACGCAGTCAGGGCAGGGACATTCAGATCTTC
CCTTAAGGGCTGTTGCAACCCTATGAACTGGGGATGGGGGAAGTATTTTCTAATCCAAGTATCA
TTAACCTTTACAACAGGCCTTTGGGCGCCTTCCGCTGCGTGGCACTCAGTGTGTGAGACTCTAG
ATTCCAGACCGGGAGCACGTGGAGGGAACATCTTTTCCCAGGATGCATTCTGTTCCTTTAGCAG
AGGTAGCTAACCTTTCGAAGTTATGACAGATTTCACACTCAAAAACTGCACAATTGATCTACCC
AAAAAGAAATAATTATTTAAAAAAAAAAACCTAACATATTTTAAGTAAATACACTGTTTTGGGT
TGGAGCGCATTCATAGTTACCCTCAGCTGCATGTGGCCTTTGGACTGTAGGCCACACAAACCTC
GTGCCGAATT

hide sequence

RefSeq Acc Id:

XM_039109538 ⟹ XP_038965466

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	144,968,207 - 145,069,022 (-)	NCBI
mRatBN7.2	1	135,558,977 - 135,659,772 (-)	NCBI

RefSeq Acc Id:

XM_039109542 ⟹ XP_038965470

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	144,968,207 - 145,053,748 (-)	NCBI
mRatBN7.2	1	135,558,977 - 135,644,428 (-)	NCBI

RefSeq Acc Id:

XM_063287628 ⟹ XP_063143698

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	144,968,207 - 145,033,967 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_445761	(Get FASTA)	NCBI Sequence Viewer
	XP_038965466	(Get FASTA)	NCBI Sequence Viewer
	XP_038965470	(Get FASTA)	NCBI Sequence Viewer
	XP_063143698	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	BAA32478	(Get FASTA)	NCBI Sequence Viewer
	BAA32479	(Get FASTA)	NCBI Sequence Viewer
	EDM08697	(Get FASTA)	NCBI Sequence Viewer
	EDM08698	(Get FASTA)	NCBI Sequence Viewer
	EDM08699	(Get FASTA)	NCBI Sequence Viewer
	EDM08700	(Get FASTA)	NCBI Sequence Viewer
	EDM08701	(Get FASTA)	NCBI Sequence Viewer
	EDM08702	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000070858
	ENSRNOP00000070858.1
GenBank Protein	O88801	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_445761 ⟸ NM_053309

- UniProtKB:

O88802 (UniProtKB/Swiss-Prot), O88801 (UniProtKB/Swiss-Prot), A6JCH3 (UniProtKB/TrEMBL), A0A8I6GHM8 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MGEQPIFTTRAHVFQIDPSTKKNWVPASKQAVTVSYFYDVTRNSYRIISVDGAKVIINSTITPN
MTFTKTSQKFGQWADSRANTVFGLGFSSEQQLTKFAEKFQEVREAARLARDKSQEKIETSSNHS
QESGCETPSSTQASSVNGTDDEKASHASPADTHLKSENDKLKIALTQSAANVKKWEIELQTLRE
SNARLTTALQESAASVEQWKRQFSICRDENDRLRSKIEELEEQCGEINREKEKNTQLKRRIEEL
ESEVREKEMELKDLRKQSEIIPQLMSECEYVSEKLEAAERDNQNLEDKVRSLKTDIEESKYRQR
HLKGELKSFLEVLDGKIDDLHDFRRGLSKLGTDN

hide sequence

Ensembl Acc Id:

ENSRNOP00000070858 ⟸ ENSRNOT00000087785

RefSeq Acc Id:	XP_038965466 ⟸ XM_039109538
- Peptide Label:	isoform X1
- UniProtKB:	A6JCH2 (UniProtKB/TrEMBL), A0A8I6GHM8 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038965470 ⟸ XM_039109542
- Peptide Label:	isoform X2
- UniProtKB:	A0A8I6GHM8 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000088957 ⟸ ENSRNOT00000094383

RefSeq Acc Id:	XP_063143698 ⟸ XM_063287628
- Peptide Label:	isoform X2
- UniProtKB:	A0A8I6GHM8 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000103274 ⟸ ENSRNOT00000156492

Protein Domains

WH1

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-O88801-F1-model_v2	AlphaFold	O88801	1-354	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:620705	AgrOrtholog
BioCyc Gene	G2FUF-58693	BioCyc
Ensembl Genes	ENSRNOG00000061450	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000087785	ENTREZGENE
	ENSRNOT00000087785.2	UniProtKB/Swiss-Prot
Gene3D-CATH	1.20.5.1700	UniProtKB/Swiss-Prot
	2.30.29.30	UniProtKB/Swiss-Prot
InterPro	Homer	UniProtKB/Swiss-Prot
	Homer_EVH1	UniProtKB/Swiss-Prot
	PH-like_dom_sf	UniProtKB/Swiss-Prot
	WH1/EVH1_dom	UniProtKB/Swiss-Prot
KEGG Report	rno:29547	UniProtKB/Swiss-Prot
NCBI Gene	29547	ENTREZGENE
PANTHER	PTHR10918	UniProtKB/Swiss-Prot
Pfam	WH1	UniProtKB/Swiss-Prot
PhenoGen	Homer2	PhenoGen
PROSITE	WH1	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000061450	RatGTEx
SMART	WH1	UniProtKB/Swiss-Prot
Superfamily-SCOP	PH domain-like	UniProtKB/Swiss-Prot
UniProt	A0A8I6GHM8	ENTREZGENE, UniProtKB/TrEMBL
	A0ABK0LIU0_RAT	UniProtKB/TrEMBL
	A6JCH0_RAT	UniProtKB/TrEMBL
	A6JCH1_RAT	UniProtKB/TrEMBL
	A6JCH2	ENTREZGENE, UniProtKB/TrEMBL
	A6JCH3	ENTREZGENE, UniProtKB/TrEMBL
	A6JCH4_RAT	UniProtKB/TrEMBL
	A6JCH5_RAT	UniProtKB/TrEMBL
	HOME2_RAT	UniProtKB/Swiss-Prot, ENTREZGENE
	O88802	ENTREZGENE
UniProt Secondary	O88802	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2018-03-16	Homer2	homer scaffold protein 2	Homer2	homer scaffolding protein 2	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2015-02-25	Homer2	homer scaffolding protein 2	Homer2	homer homolog 2 (Drosophila)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-09-10	Homer2	homer homolog 2 (Drosophila)		homer, neuronal immediate early gene, 2	Name updated	1299863	APPROVED
2002-08-07	Homer2	homer, neuronal immediate early gene, 2			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_domains	contains N-terminal EVH1- and PDZ-like domains, C-terminal MCC (mutated in colorectal cancer)-like domain and leucine zipper	632975
gene_expression	expression is increased 1.5 fold in SHR compared with WKY rats	1357414
gene_product	member of the Vesl/Homer family of PDZ proteins	632975

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)