Advanced Search (OLGA)

Gene: Cd48 (Cd48 molecule) Rattus norvegicus

Analyze

Symbol:

Cd48

Name:

Cd48 molecule

RGD ID:

620620

Description:

Predicted to enable receptor ligand activity. Involved in mast cell activation. Part of protein-containing complex. Orthologous to human CD48 (CD48 molecule); INTERACTS WITH (S)-duloxetine hydrochloride; 1-naphthyl isothiocyanate; 17beta-estradiol.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

BCM1 surface antigen; BLAST-1; CD48 antigen; MRC OX-45 surface antigen; signaling lymphocytic activation molecule 2; SLAM family member 2; SLAMF2

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	CD48 (CD48 molecule)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Cd48 (CD48 antigen)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Cd48 (CD48 molecule)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	CD48 (CD48 molecule)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	CD48 (CD48 molecule)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Cd48 (CD48 molecule)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	CD48 (CD48 molecule)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	CD48 (CD48 molecule)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Cd48 (CD48 molecule)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Cd48 (CD48 antigen)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	CD48 (CD48 molecule)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	si:ch211-209f23.6	Alliance	DIOPT (InParanoid\|OMA\|OrthoInspector)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	13	86,717,960 - 86,741,540 (+)	NCBI		GRCr8
GRCr8 Ensembl	13	86,717,961 - 86,742,942 (+)	Ensembl		GRCr8 Ensembl
mRatBN7.2	13	84,184,884 - 84,209,144 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	13	84,185,532 - 84,209,142 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	13	86,691,403 - 86,714,951 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	13	88,089,219 - 88,112,765 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	13	85,288,583 - 85,312,117 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	13	90,116,601 - 90,140,371 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	13	90,116,843 - 90,140,371 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	13	94,737,388 - 94,762,199 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	13	87,684,545 - 87,708,091 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	13	83,815,242 - 83,838,711 (+)	NCBI		Celera
RGSC_v3.1	13	87,873,428 - 87,896,975 (+)	NCBI
Cytogenetic Map	13	q24	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

autoimmune interstitial lung, joint, and kidney disease (ISO)

Experimental Liver Cirrhosis (ISO)

gastrointestinal stromal tumor (ISO)

parathyroid carcinoma (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-demecolcine (ISO)

(S)-duloxetine hydrochloride (EXP)

1,1-dichloroethene (ISO)

1,2-dimethylhydrazine (ISO)

1-naphthyl isothiocyanate (EXP)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (EXP)

17beta-estradiol 3-benzoate (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-diaminotoluene (ISO)

3-chloropropane-1,2-diol (EXP)

3-methylcholanthrene (ISO)

3H-1,2-dithiole-3-thione (EXP)

4,4'-diaminodiphenylmethane (EXP,ISO)

4,4'-sulfonyldiphenol (ISO)

6-propyl-2-thiouracil (EXP)

acetamide (EXP)

acrylamide (ISO)

Aflatoxin B2 alpha (ISO)

aldehydo-D-glucose (ISO)

all-trans-retinoic acid (ISO)

ammonium chloride (EXP)

antirheumatic drug (ISO)

benzo[a]pyrene (ISO)

benzo[b]fluoranthene (ISO)

benzoates (ISO)

beta-naphthoflavone (EXP,ISO)

bexarotene (EXP)

bisphenol A (EXP,ISO)

buta-1,3-diene (ISO)

cadmium dichloride (ISO)

carbamazepine (ISO)

carbon nanotube (ISO)

CGP 52608 (ISO)

chloroethene (ISO)

chloroprene (ISO)

choline (ISO)

chrysene (ISO)

cisplatin (ISO)

Cuprizon (EXP)

D-glucose (ISO)

diuron (EXP,ISO)

ethanol (EXP)

flutamide (EXP)

folic acid (ISO)

folpet (ISO)

fonofos (ISO)

fructose (ISO)

genistein (ISO)

gentamycin (EXP)

glafenine (EXP)

glucose (ISO)

glyphosate (ISO)

GSK-J4 (ISO)

hexachlorobenzene (EXP)

indometacin (EXP)

L-ascorbic acid (EXP)

L-methionine (ISO)

lead diacetate (EXP)

lidocaine (EXP)

lipopolysaccharide (ISO)

manganese atom (ISO)

manganese(0) (ISO)

manganese(II) chloride (ISO)

menadione (ISO)

methotrexate (ISO)

methyl methanesulfonate (ISO)

N-nitrosodiethylamine (EXP)

N-nitrosodimethylamine (EXP)

nickel atom (ISO)

nitrates (ISO)

ozone (ISO)

paracetamol (EXP,ISO)

parathion (ISO)

perfluorooctanoic acid (EXP)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

silicon dioxide (ISO)

sodium arsenite (ISO)

tamoxifen (EXP)

terbufos (ISO)

testosterone (EXP)

tetrachloromethane (ISO)

tetraphene (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

tungsten (ISO)

vinclozolin (EXP)

vincristine (ISO)

zaragozic acid A (EXP,ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

immune response (IBA)

leukocyte activation (IEA)

mast cell activation (IMP)

natural killer cell activation (ISO)

signal transduction (ISO)

T cell activation (ISO)

Cellular Component

external side of plasma membrane (ISO)

extracellular region (IEA)

membrane (IEA)

membrane raft (IEA,ISO)

plasma membrane (IEA)

protein-containing complex (IDA)

side of membrane (IEA)

Molecular Function

protein binding (IPI,ISO)

receptor ligand activity (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	The role of charged residues mediating low affinity protein-protein recognition at the cell surface by CD2.	Davis SJ, etal., Proc Natl Acad Sci U S A. 1998 May 12;95(10):5490-4.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
4.	The MRC OX-45 antigen of rat leukocytes and endothelium is in a subset of the immunoglobulin superfamily with CD2, LFA-3 and carcinoembryonic antigens.	Killeen N, etal., EMBO J 1988 Oct;7(10):3087-91.
5.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
6.	Mast cell activation by Mycobacterium tuberculosis: mediator release and role of CD48.	Munoz S, etal., J Immunol 2003 Jun 1;170(11):5590-6.
7.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
8.	GOA pipeline	RGD automated data pipeline
9.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
10.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
11.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Additional References at PubMed

PMID:1299282	PMID:1383383	PMID:11313396	PMID:15489334	PMID:15946251	PMID:16803907	PMID:18971422	PMID:19946888	PMID:20458337	PMID:20660734

Genomics

Comparative Map Data

Cd48
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	13	86,717,960 - 86,741,540 (+)	NCBI		GRCr8
GRCr8 Ensembl	13	86,717,961 - 86,742,942 (+)	Ensembl		GRCr8 Ensembl
mRatBN7.2	13	84,184,884 - 84,209,144 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	13	84,185,532 - 84,209,142 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	13	86,691,403 - 86,714,951 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	13	88,089,219 - 88,112,765 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	13	85,288,583 - 85,312,117 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	13	90,116,601 - 90,140,371 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	13	90,116,843 - 90,140,371 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	13	94,737,388 - 94,762,199 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	13	87,684,545 - 87,708,091 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	13	83,815,242 - 83,838,711 (+)	NCBI		Celera
RGSC_v3.1	13	87,873,428 - 87,896,975 (+)	NCBI
Cytogenetic Map	13	q24	NCBI

CD48
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	160,678,746 - 160,711,822 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	160,678,746 - 160,711,831 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	1	160,648,536 - 160,681,612 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	158,915,160 - 158,948,209 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	1	157,461,610 - 157,494,658	NCBI
Celera	1	133,717,253 - 133,750,314 (-)	NCBI		Celera
Cytogenetic Map	1	q23.3	NCBI
HuRef	1	132,004,718 - 132,037,845 (-)	NCBI		HuRef
CHM1_1	1	162,043,866 - 162,076,982 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	1	159,815,851 - 159,848,940 (-)	NCBI		T2T-CHM13v2.0

Cd48
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	1	171,508,989 - 171,532,825 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	1	171,509,577 - 171,532,826 (+)	Ensembl		GRCm39 Ensembl
GRCm38	1	171,681,245 - 171,705,258 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	1	171,682,009 - 171,705,258 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	1	173,612,186 - 173,635,388 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	1	173,518,730 - 173,541,932 (+)	NCBI		MGSCv36	mm8
Celera	1	174,538,236 - 174,561,362 (+)	NCBI		Celera
Cytogenetic Map	1	H3	NCBI
cM Map	1	79.54	NCBI

Cd48
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955468	12,396,032 - 12,410,086 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955468	12,398,671 - 12,411,241 (-)	NCBI	ChiLan1.0	ChiLan1.0

CD48
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	89,138,478 - 89,171,740 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	88,878,472 - 88,911,732 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	136,034,278 - 136,067,533 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	139,956,862 - 139,990,082 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	139,956,862 - 139,990,082 (-)	Ensembl	panpan1.1		panPan2

CD48
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	38	21,612,401 - 21,628,223 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	38	21,566,748 - 21,628,219 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	38	21,685,406 - 21,701,206 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	38	21,729,662 - 21,745,533 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	38	21,683,985 - 21,747,885 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	38	21,616,863 - 21,632,662 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	38	22,030,683 - 22,046,703 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	38	22,440,240 - 22,456,245 (+)	NCBI		UU_Cfam_GSD_1.0

Cd48
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	6,730,352 - 6,746,919 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936740	7,633 - 24,236 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936740	7,662 - 24,010 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CD48
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	4	89,828,923 - 89,844,484 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	4	89,828,923 - 89,844,471 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	4	97,721,052 - 97,736,602 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

CD48
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	3,235,817 - 3,253,107 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	20	3,235,988 - 3,251,655 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666038	2,280,054 - 2,296,236 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Cd48
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624794	564,375 - 605,315 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624794	564,425 - 605,080 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Cd48
313 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	434
Count of miRNA genes:	179
Interacting mature miRNAs:	203
Transcripts:	ENSRNOT00000006306
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
7207885	Glom27	Glomerulus QTL 27	3.9		kidney glomerulus integrity trait (VT:0010546)	kidney crescentic glomeruli count to kidney normal glomeruli count ratio (CMO:0002139)	13	21120177	109350286	Rat
738027	Lnnr6	Liver neoplastic nodule remodeling QTL 6	3.3		liver integrity trait (VT:0010547)	liver remodeling tumorous lesion number (CMO:0001461)	13	65613454	109350286	Rat
1298066	Bp159	Blood pressure QTL 159		0.004	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	48639634	93639634	Rat
738026	Lnnr5	Liver neoplastic nodule remodeling QTL 5	3.29		liver integrity trait (VT:0010547)	liver remodeling tumorous lesion number (CMO:0001461)	13	62424592	88113509	Rat
2293702	Bss34	Bone structure and strength QTL 34	4.61	0.0001	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	13	67635937	109350286	Rat
1576318	Schws5	Schwannoma susceptibility QTL 5		0.0351	nervous system integrity trait (VT:0010566)	post-insult time to trigeminal nerve neurilemmoma formation (CMO:0002019)	13	64497900	109350286	Rat
1354621	Rf47	Renal function QTL 47	3.7		kidney renin amount (VT:0010559)	kidney renin level (CMO:0002166)	13	11081740	103588154	Rat
1581554	Pur11	Proteinuria QTL 11			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	13	6002008	88706694	Rat
1354655	Bp241	Blood pressure QTL 241	3.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	38975045	103588154	Rat
8655951	Rf63	Renal function QTL 63	12.2		blood urea nitrogen amount (VT:0005265)	plasma urea nitrogen level (CMO:0000586)	13	71610804	109350286	Rat
4889606	Gluco63	Glucose level QTL 63	2.86	0.003	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	13	83286150	109350286	Rat
8655945	Rf61	Renal function QTL 61	3.6		blood creatinine amount (VT:0005328)	creatinine clearance (CMO:0000765)	13	71610804	89333251	Rat
71119	Thym2	Thymus enlargement QTL 2	3.8		thymus mass (VT:0004954)	thymus weight to body weight ratio (CMO:0000612)	13	48749814	87285480	Rat
12879444	Bp397	Blood pressure QTL 397			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	47601426	92601426	Rat
1331783	Bp221	Blood pressure QTL 221	3.72886		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	71610804	89333251	Rat
8655959	Pur32	Proteinuria QTL 32	8.4		urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	13	72984506	99745408	Rat
2293687	Bss26	Bone structure and strength QTL 26	4.6	0.0001	femur morphology trait (VT:0000559)	femur cross-sectional area (CMO:0001661)	13	67635937	109350286	Rat
1300166	Kidm6	Kidney mass QTL 6	3.93		kidney mass (VT:0002707)	single kidney wet weight to body weight ratio (CMO:0000622)	13	71610804	89333251	Rat
619615	Bp80	Blood pressure QTL 80		0.0354	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	7421791	87286911	Rat
12879475	Bp400	Blood pressure QTL 400			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	64375743	109350286	Rat
1581573	Uae36	Urinary albumin excretion QTL 36			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	13	6002008	88706694	Rat
1354666	Bp244	Blood pressure QTL 244	4.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	1	103588154	Rat
724564	Uae11	Urinary albumin excretion QTL 11	5.7		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	13	47354258	94285672	Rat
2293341	Glom15	Glomerulus QTL 15	9.1		kidney glomerulus integrity trait (VT:0010546)	kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269)	13	67635937	109350286	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_139103	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063272019	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC060542	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473985	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ224798	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ228817	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ230952	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ234539	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000013	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X13016	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000006306 ⟹ ENSRNOP00000006306

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	13	86,717,961 - 86,741,540 (+)	Ensembl
mRatBN7.2 Ensembl	13	84,185,559 - 84,209,142 (+)	Ensembl
Rnor_6.0 Ensembl	13	90,116,843 - 90,140,371 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000111655 ⟹ ENSRNOP00000084304

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	13	86,717,972 - 86,741,540 (+)	Ensembl
mRatBN7.2 Ensembl	13	84,185,532 - 84,208,478 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000113999 ⟹ ENSRNOP00000079741

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	13	84,185,532 - 84,204,845 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000121499 ⟹ ENSRNOP00000110888

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	13	86,718,262 - 86,742,942 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000156460 ⟹ ENSRNOP00000110512

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	13	86,717,962 - 86,742,942 (+)	Ensembl

RefSeq Acc Id:

NM_139103 ⟹ NP_620803

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	13	86,717,994 - 86,741,540 (+)	NCBI
mRatBN7.2	13	84,185,596 - 84,209,143 (+)	NCBI
Rnor_6.0	13	90,116,843 - 90,140,371 (+)	NCBI
Rnor_5.0	13	94,737,388 - 94,762,199 (+)	NCBI
RGSC_v3.4	13	87,684,545 - 87,708,091 (+)	RGD
Celera	13	83,815,242 - 83,838,711 (+)	RGD

Sequence:

show sequence

GTCTCCAGTGTCACAGGCAGCTTCTCAAAGTATTATGTACTTCAAAAAACGGAGATGGTTTCTG
ATCCTGGAATCGCTTTTGCTGTCTTTGGTAACTGGATTTCAAGATCAATCAGTACCAAATGTAA
ATGCCATAACCGGCAGCAACGTAACCCTGACAATCCTGAAGCACCCACTTGCATCGTATCAACG
TCTCACCTGGCTTCATACTACCAACCAGAAGATTTTAGAGTACTTCCCTAATGGTAAAAAAACT
GTCTTCGAGTCTGTATTTAAAGACAGGGTCGATCTTGACAAAACAAATGGTGCACTTCGTATCT
ATAATGTCTCGAAAGAGGACAGAGGTGACTACTACATGAGAATGTTGCACGAAACTGAGGACCA
GTGGAAGATAACCATGGAAGTATACGATCTTGTGTCCAAGCCTGCCATCAAAATCGAGAAGACT
AAAAATTTGACTGACTCCTGTCACCTGAGGCTATCATGTAAGGTAGAGGACCAAGGTGTTGACT
ATACTTGGTATGAGGACTCGGGGCCCTTTCCCCAAAGGAATCCAGGATATGTACTCGAAATCAC
CATCACTCCACACAACAAGTCTACATTTTACACCTGCCAAGTCAGCAATCCTGTAAGCAGCGAG
AACGACACACTGTACTTTATTCCACCTTGTACGCTGGCCAGATCTTCTGGAGTCCATTGGATTG
CAGCTTGGCTAGTGGTCACGTTATCCATCATTCCCAGCATCCTGCTAGCCTGACAAGATCTCTC
CTCAGTCAAGAAGGAAACATCAAAGCCGTATCTTGCCTTCATCCCCTGCACTGCTCCTAACCAT
TGACGCTGCTCTGGCTCCGTGGAGCAAAGGAAAGTGTGTTATTGTTATCTGTGCTGGTTTGAAT
GCATGCTCTATGGAGTAAGCACAGGACCTAGTACAGTGCTACATCACTGATCTTTACAAAGATT
CTAAGCTAATTTTTTAAAAACTGGGGGTAGCATCTAATTTTATATACCCTAGTTGTTTCCTAAC
ATTCATTGAAGATAAATGCATTCCTTTTACCAAAATATGTGGCTATCTTATACTAATGTTGTTT
ATATCACTCTTTTTTTATAAAGATAAATGCATTCCTTTACCAAAATATGTGACTATATCATGCT
AATGTTGTTTATATCACTCCTTTTTGTGAAGATAAATGCATTCCTTTTACCAAAATATGTGACT
ATGTCATGCTAATGTTGTTTATATCACTCTTTTTTATAAAGATAAATGCATTCCTTTTACCAAA
AACATGTGGCTATATTATACTAATGTTGTTTATATCACTCTTTTTTATAAAGATAAATGCATTC
CTTCTACCAAAATATGTGACTATATCATGCTAATGTTGTTTATATCACCTTTTTAAAAATAAAA
TCTTTTCACATACT

hide sequence

RefSeq Acc Id:

XM_063272019 ⟹ XP_063128089

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	13	86,717,960 - 86,739,099 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_620803	(Get FASTA)	NCBI Sequence Viewer
	XP_063128089	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH60542	(Get FASTA)	NCBI Sequence Viewer
	CAA31438	(Get FASTA)	NCBI Sequence Viewer
	EDL94663	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000006306
	ENSRNOP00000110512
GenBank Protein	P10252	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_620803 ⟸ NM_139103
- Peptide Label:	precursor
- UniProtKB:	P10252 (UniProtKB/Swiss-Prot), A6JG07 (UniProtKB/TrEMBL), A0A8I5ZNL0 (UniProtKB/TrEMBL)
- Sequence:	show sequence MYFKKRRWFLILESLLLSLVTGFQDQSVPNVNAITGSNVTLTILKHPLASYQRLTWLHTTNQKI LEYFPNGKKTVFESVFKDRVDLDKTNGALRIYNVSKEDRGDYYMRMLHETEDQWKITMEVYDLV SKPAIKIEKTKNLTDSCHLRLSCKVEDQGVDYTWYEDSGPFPQRNPGYVLEITITPHNKSTFYT CQVSNPVSSENDTLYFIPPCTLARSSGVHWIAAWLVVTLSIIPSILLA hide sequence

Ensembl Acc Id:

ENSRNOP00000006306 ⟸ ENSRNOT00000006306

Ensembl Acc Id:

ENSRNOP00000084304 ⟸ ENSRNOT00000111655

Ensembl Acc Id:

ENSRNOP00000079741 ⟸ ENSRNOT00000113999

RefSeq Acc Id:	XP_063128089 ⟸ XM_063272019
- Peptide Label:	isoform X1
- UniProtKB:	A0A8L2Q3B4 (UniProtKB/TrEMBL), A0A8I5ZNL0 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000110888 ⟸ ENSRNOT00000121499

Ensembl Acc Id:

ENSRNOP00000110512 ⟸ ENSRNOT00000156460

Protein Domains

Ig-like Ig-like C2-type Immunoglobulin

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P10252-F1-model_v2	AlphaFold	P10252	1-240	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13699014

Promoter ID:

EPDNEW_R9539

Type:

initiation region

Name:

Cd48_1

Description:

Cd48 molecule

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	13	90,116,849 - 90,116,909	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:620620	AgrOrtholog
BioCyc Gene	G2FUF-17345	BioCyc
Ensembl Genes	ENSRNOG00000004737	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000006306	ENTREZGENE
	ENSRNOT00000156460	ENTREZGENE
Gene3D-CATH	2.60.40.10	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:6921213	IMAGE-MGC_LOAD
InterPro	CD2/SLAM_rcpt	UniProtKB/Swiss-Prot
	Ig-like_dom	UniProtKB/Swiss-Prot
	Ig-like_dom_sf	UniProtKB/Swiss-Prot
	Ig-like_fold	UniProtKB/Swiss-Prot
	Ig_sub	UniProtKB/Swiss-Prot
	Ig_V-set	UniProtKB/Swiss-Prot
KEGG Report	rno:245962	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:72677	IMAGE-MGC_LOAD
NCBI Gene	245962	ENTREZGENE
PANTHER	CD48 ANTIGEN	UniProtKB/Swiss-Prot
	SIGNALING LYMPHOCYTIC ACTIVATION MOLECULE	UniProtKB/Swiss-Prot
Pfam	Ig_2	UniProtKB/Swiss-Prot
	V-set	UniProtKB/Swiss-Prot
PhenoGen	Cd48	PhenoGen
PROSITE	IG_LIKE	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000004737	RatGTEx
SMART	SM00409	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF48726	UniProtKB/Swiss-Prot
UniProt	A0A8I5ZNL0	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I5ZYW8_RAT	UniProtKB/TrEMBL
	A0A8L2Q3B4	ENTREZGENE, UniProtKB/TrEMBL
	A6JG07	ENTREZGENE, UniProtKB/TrEMBL
	CD48_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-09-29	Cd48	Cd48 molecule	Cd48	CD48 antigen	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-01-20	Cd48	CD48 antigen			Symbol and Name status set to approved	1299863	APPROVED
2002-08-07	Cd48	CD48 antigen			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD