Zp2 (zona pellucida glycoprotein 2)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Zp2 (zona pellucida glycoprotein 2) Rattus norvegicus

Analyze

Symbol:

Zp2

Name:

zona pellucida glycoprotein 2

RGD ID:

620605

Description:

Predicted to enable acrosin binding activity and identical protein binding activity. Predicted to be a structural constituent of egg coat. Predicted to be involved in binding activity of sperm to zona pellucida; humoral immune response mediated by circulating immunoglobulin; and prevention of polyspermy. Predicted to be located in several cellular components, including endoplasmic reticulum; inclusion body; and multivesicular body. Predicted to be active in collagen-containing extracellular matrix and egg coat. Orthologous to human ZP2 (zona pellucida glycoprotein 2); INTERACTS WITH 1,2-dimethylhydrazine; bis(2-ethylhexyl) phthalate; bisphenol A.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

zona pellucida 2 glycoprotein; zona pellucida glycoprotein 2 (sperm receptor); zona pellucida glycoprotein ZP2; zona pellucida protein A; zona pellucida sperm-binding protein 2; Zp-2

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	ZP2 (zona pellucida glycoprotein 2)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, Panther
Mus musculus (house mouse):	Zp2 (zona pellucida glycoprotein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Zp2 (zona pellucida glycoprotein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	ZP2 (zona pellucida glycoprotein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	ZP2 (zona pellucida glycoprotein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Zp2 (zona pellucida glycoprotein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	ZP2 (zona pellucida glycoprotein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	ZP2 (zona pellucida glycoprotein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Zp2 (zona pellucida glycoprotein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Zp2 (zona pellucida glycoprotein 2)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	ZP2 (zona pellucida glycoprotein 2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	si:dkeyp-50f7.2	Alliance	DIOPT (OrthoInspector\|SonicParanoid)
Danio rerio (zebrafish):	zpax4	Alliance	DIOPT (Ensembl Compara\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	zp2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Is Marker For:

Strains: WAG.OXYS-(D1Rat219-D1Rat81)/Nov

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	1	174,513,507 - 174,525,288 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	174,513,511 - 174,525,288 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	182,831,061 - 182,842,857 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	190,017,103 - 190,028,901 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	182,751,032 - 182,762,847 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	189,899,906 - 189,911,650 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	189,899,892 - 189,911,650 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	196,829,189 - 196,840,820 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
Celera	1	172,263,179 - 172,274,910 (-)	NCBI		Celera
Cytogenetic Map	1	q36	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

genetic disease (ISO)

Oocyte/Zygote/Embryo Maturation Arrest 6 (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (EXP)

17alpha-ethynylestradiol (ISO)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (EXP)

bisphenol A (EXP,ISO)

Butylbenzyl phthalate (EXP)

C60 fullerene (EXP)

chlorpyrifos (ISO)

decabromodiphenyl ether (EXP)

dibutyl phthalate (EXP)

diethyl phthalate (EXP)

diisobutyl phthalate (EXP)

diisononyl phthalate (EXP)

flavonoids (EXP)

glyphosate (ISO)

graphite (EXP)

hydroquinone O-beta-D-glucopyranoside (ISO)

kojic acid (ISO)

lipopolysaccharide (ISO)

melatonin (ISO)

N,N-dimethylformamide (ISO)

pirinixic acid (ISO)

potassium dichromate (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

binding of sperm to zona pellucida (IBA,IEA,ISO,ISS)

humoral immune response mediated by circulating immunoglobulin (ISO)

prevention of polyspermy (IBA,IEA,ISO,ISS)

regulation of acrosome reaction (ISO)

Cellular Component

collagen-containing extracellular matrix (IBA,IEA,ISO,ISS)

egg coat (IBA,IEA,ISO,ISS)

endoplasmic reticulum (IEA,ISO,ISS)

extracellular region (IEA)

inclusion body (ISO)

multivesicular body (IEA,ISO,ISS)

periplasmic space (ISO)

plasma membrane (IEA,ISO,ISS)

Molecular Function

acrosin binding (IBA,IEA,ISO)

identical protein binding (IEA,ISO)

protein binding (ISO)

structural constituent of egg coat (IBA,IEA,ISO,ISS)

References

References - curated

#	Reference Title	Reference Citation
1.	Rat zona pellucida glycoproteins: molecular cloning and characterization of the three major components.	Akatsuka K, etal., Mol Reprod Dev 1998 Dec;51(4):454-67.
2.	Ovastacin, a cortical granule protease, cleaves ZP2 in the zona pellucida to prevent polyspermy.	Burkart AD, etal., J Cell Biol. 2012 Apr 2;197(1):37-44. doi: 10.1083/jcb.201112094.
3.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
5.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
6.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
7.	GOA pipeline	RGD automated data pipeline
8.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
9.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:10793136	PMID:11739644	PMID:11751269	PMID:11906903	PMID:12052239	PMID:15950651	PMID:16342937	PMID:17047254	PMID:20394732	PMID:26879157	PMID:29895852

Genomics

Comparative Map Data

Zp2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	1	174,513,507 - 174,525,288 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	174,513,511 - 174,525,288 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	182,831,061 - 182,842,857 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	190,017,103 - 190,028,901 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	182,751,032 - 182,762,847 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	189,899,906 - 189,911,650 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	189,899,892 - 189,911,650 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	196,829,189 - 196,840,820 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
Celera	1	172,263,179 - 172,274,910 (-)	NCBI		Celera
Cytogenetic Map	1	q36	NCBI

ZP2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	16	21,197,450 - 21,214,510 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	16	21,197,450 - 21,214,510 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	16	21,208,771 - 21,225,831 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	16	21,116,274 - 21,130,369 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	16	21,116,273 - 21,130,369	NCBI
Celera	16	20,518,619 - 20,532,706 (-)	NCBI		Celera
Cytogenetic Map	16	p12.3-p12.2	NCBI
HuRef	16	19,743,981 - 19,758,073 (-)	NCBI		HuRef
CHM1_1	16	21,296,024 - 21,310,120 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	16	21,128,399 - 21,145,450 (-)	NCBI		T2T-CHM13v2.0

Zp2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	7	119,725,985 - 119,744,514 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	7	119,725,995 - 119,744,514 (-)	Ensembl		GRCm39 Ensembl
GRCm38	7	120,126,762 - 120,145,291 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	7	120,126,772 - 120,145,291 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	7	127,275,875 - 127,288,804 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	7	119,923,510 - 119,936,439 (-)	NCBI		MGSCv36	mm8
Celera	7	120,041,987 - 120,054,607 (-)	NCBI		Celera
Cytogenetic Map	7	F2	NCBI
cM Map	7	64.38	NCBI

Zp2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955493	400,868 - 412,596 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955493	400,868 - 412,660 (-)	NCBI	ChiLan1.0	ChiLan1.0

ZP2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	16	26,886,199 - 26,901,082 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	16	17,193,632 - 17,210,667 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	16	21,227,285 - 21,244,316 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	16	21,227,285 - 21,244,316 (-)	Ensembl	panpan1.1		panPan2

ZP2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	6	24,230,202 - 24,242,441 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	6	24,230,201 - 24,242,451 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	6	25,667,939 - 25,680,181 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	6	24,381,539 - 24,393,787 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	6	24,381,539 - 24,393,797 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	6	24,184,937 - 24,197,176 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	6	24,078,588 - 24,090,826 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	6	24,463,951 - 24,476,253 (+)	NCBI		UU_Cfam_GSD_1.0

Zp2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409344	118,296,926 - 118,311,637 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936501	6,394,838 - 6,407,442 (-)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936501	6,394,838 - 6,407,512 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

ZP2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	3	24,863,730 - 24,877,522 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	3	24,863,730 - 24,877,522 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	3	25,665,412 - 25,679,349 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

ZP2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	5	19,318,026 - 19,338,966 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	5	19,319,034 - 19,338,495 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666068	10,543,555 - 10,560,816 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Zp2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624782	7,275,207 - 7,287,114 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624782	7,275,156 - 7,287,480 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Zp2
56 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	18
Count of miRNA genes:	18
Interacting mature miRNAs:	18
Transcripts:	ENSRNOT00000071108
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
10059597	Bp377	Blood pressure QTL 377	3.42	0.025	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32737458	199368955	Rat
634314	Niddm44	Non-insulin dependent diabetes mellitus QTL 44			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	49393289	199050459	Rat
1578780	Cm52	Cardiac mass QTL 52	3.3	0.0001	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	1	81591954	219808434	Rat
1358902	Bw47	Body weight QTL 47	1.67		body mass (VT:0001259)	body weight (CMO:0000012)	1	90508614	180359386	Rat
1331751	Bp199	Blood pressure QTL 199	3.60022		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	94494440	181830018	Rat
1331749	Hrtrt11	Heart rate QTL 11	2.973		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	1	94494440	198211706	Rat
70209	Niddm23	Non-insulin dependent diabetes mellitus QTL 23	2.82		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	94494440	198324465	Rat
731168	Bp154	Blood pressure QTL 154	3.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	94642644	214537671	Rat
8655649	Arrd1	Age-related retinal degeneration QTL 1	4.89		retinal layer morphology trait (VT:0003727)	percentage of study population developing retinopathy during a period of time (CMO:0002453)	1	100357752	183970443	Rat
1354591	Cm36	Cardiac mass QTL 36	4.1		heart left ventricle mass (VT:0007031)	calculated heart weight (CMO:0000073)	1	102813953	201278233	Rat
1354615	Cm32	Cardiac mass QTL 32	5.2		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	1	102813953	201278233	Rat
1354606	Bp246	Blood pressure QTL 246	3.6		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	1	102813953	218753816	Rat
1300158	Bp173	Blood pressure QTL 173	3.48		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	1	115540693	185145286	Rat
7794788	Mcs32	Mammary carcinoma susceptibility QTL 32	2.61		mammary gland integrity trait (VT:0010552)	mammary tumor incidence/prevalence measurement (CMO:0000946)	1	115540693	238914717	Rat
7421630	Bp362	Blood pressure QTL 362		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	118608292	241799120	Rat
631205	Bp196	Blood pressure QTL 196	4	0.0001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	118944897	199050459	Rat
631544	Bp84	Blood pressure QTL 84	5.6		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	123350408	181759564	Rat
1358189	Cstrr1	Cold stress response QTL 1		0.0001	catecholamine amount (VT:0010543)	urine norepinephrine level (CMO:0001629)	1	123350408	182418476	Rat
1641895	Bp298	Blood pressure QTL 298			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	123350408	182418476	Rat
1578770	Stresp23	Stress response QTL 23			kidney sympathetic nerve activity (VT:0004050)	stimulated renal sympathetic nerve activity to basal renal sympathetic nerve activity ratio (CMO:0001786)	1	123350408	182418476	Rat
631549	Bp89	Blood pressure QTL 89	5.7		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	123350581	201284552	Rat
738006	Anxrr14	Anxiety related response QTL 14	4	0.00035	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	1	130636910	175636910	Rat
738028	Anxrr12	Anxiety related response QTL 12	4.9	0.00001	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	1	130636910	175636910	Rat
6893347	Bw98	Body weight QTL 98	0.2	0.53	body mass (VT:0001259)	body weight (CMO:0000012)	1	133680936	178680936	Rat
6893361	Bw104	Body weight QTL 104	0.59	0.27	body mass (VT:0001259)	body weight (CMO:0000012)	1	133680936	178680936	Rat
1558645	Bw55	Body weight QTL 55	3.2	0.004	body mass (VT:0001259)	body weight (CMO:0000012)	1	133680936	178680936	Rat
71118	Thym1	Thymus enlargement QTL 1	10.17	0.001	thymus mass (VT:0004954)	thymus weight to body weight ratio (CMO:0000612)	1	136829932	181829932	Rat
724550	Thym3	Thymus enlargement QTL 3	7.82	0.001	thymus mass (VT:0004954)	thymus weight to body weight ratio (CMO:0000612)	1	136829932	181829932	Rat
631519	Pia11	Pristane induced arthritis QTL 11	5.3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	1	136830018	181830018	Rat
1598853	Memor3	Memory QTL 3	4.5		exploratory behavior trait (VT:0010471)	total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443)	1	143506580	212458660	Rat
61348	Bp30	Blood pressure QTL 30	2.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	144017057	197814409	Rat
70160	Bw18	Body weight QTL 18	5.7		body mass (VT:0001259)	body weight (CMO:0000012)	1	144267353	196383668	Rat
737828	Hcas3	Hepatocarcinoma susceptibility QTL 3	4.9		liver integrity trait (VT:0010547)	liver tumorous lesion volume to total liver volume ratio (CMO:0001082)	1	144267353	222987745	Rat
2302378	Insul11	Insulin level QTL 11	3.25		blood insulin amount (VT:0001560)	serum insulin level (CMO:0000358)	1	144267353	251128347	Rat
7771612	Cm80	Cardiac mass QTL 80	8.4		heart left ventricle mass (VT:0007031)	heart left ventricle weight (CMO:0000776)	1	149448574	221264292	Rat
724531	Uae5	Urinary albumin excretion QTL 5	4		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	1	150700142	252085212	Rat
1578759	Uae30	Urinary albumin excretion QTL 30	3.3	0.003	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	150700247	252085048	Rat
1578778	Pur4	Proteinuria QTL 4	3.3	0.003	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	1	150700247	252085048	Rat
1354602	Bw35	Body weight QTL 35	12.2		body mass (VT:0001259)	body weight (CMO:0000012)	1	151162512	201278233	Rat
1354620	Kidm19	Kidney mass QTL 19	4		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	151162512	201278233	Rat
1354634	Kidm12	Kidney mass QTL 12	3.9		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	1	151162512	201278233	Rat
1354636	Lmblg1	Limb length QTL 1	6.4		tibia length (VT:0004357)	tibia length (CMO:0000450)	1	151162512	201278233	Rat
1354610	Bw34	Body weight QTL 34	4.1		body mass (VT:0001259)	body weight (CMO:0000012)	1	151162512	256448636	Rat
1354646	Kidm18	Kidney mass QTL 18	5.7		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	151162512	256448636	Rat
1354661	Bw33	Body weight QTL 33	5.2		body mass (VT:0001259)	body weight (CMO:0000012)	1	151162512	256448636	Rat
1358886	Bp260	Blood pressure QTL 260	3.67		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	151162766	225824951	Rat
61343	Bp28	Blood pressure QTL 28			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	151646613	196646613	Rat
1549837	Hcar15	Hepatocarcinoma resistance QTL 15		0.05	liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	153136852	260522016	Rat
2303622	Vencon6	Ventilatory control QTL 6		0.001	respiration trait (VT:0001943)	respiration rate (CMO:0000289)	1	154561505	199561505	Rat
4889428	Stresp24	Stress response QTL 24		0.05	heart pumping trait (VT:2000009)	absolute change in electrocardiographic low frequency R-R spectral component to high frequency R-R spectral component ratio (CMO:0002162)	1	155866514	200866514	Rat
631548	Bp88	Blood pressure QTL 88	5	0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	156677124	176484451	Rat
1354618	Kidm15	Kidney mass QTL 15	5		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	1	156677124	201278233	Rat
2312420	Pur17	Proteinuria QTL 17	7.1	0.0001	urine protein amount (VT:0005160)	urine total protein excretion rate (CMO:0000756)	1	156677124	218753816	Rat
1354580	Scort1	Serum corticosterone level QTL 1	3.4		blood corticosterone amount (VT:0005345)	blood corticosterone level (CMO:0001172)	1	156677124	256448636	Rat
61347	Bp197	Blood pressure QTL 197	4.2		arterial blood pressure trait (VT:2000000)	blood pressure measurement (CMO:0000003)	1	158633083	203633083	Rat
2292222	Bp307	Blood pressure QTL 307	3.06	0.0014	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	164310393	213533942	Rat
2292220	Bp306	Blood pressure QTL 306	3.47	0.00087	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	164310393	243914901	Rat
619613	Bp77	Blood pressure QTL 77		0.01	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	164747424	209747424	Rat
619613	Bp77	Blood pressure QTL 77		0.01	arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	164747424	209747424	Rat
737974	Bp161	Blood pressure QTL 161		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	164747558	181133855	Rat
2312558	Glom17	Glomerulus QTL 17	3.9	0.001	kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	1	166532971	191278129	Rat
1354653	Despr9	Despair related QTL 9		0.00019	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	1	167909849	212909849	Rat
619614	Bp78	Blood pressure QTL 78		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	169112897	197261052	Rat
619614	Bp78	Blood pressure QTL 78		0.001	arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	169112897	197261052	Rat
61341	Bp26	Blood pressure QTL 26			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	169537671	214537671	Rat
724562	Rends1	Renal damage susceptibility QTL 1		0.05	kidney glomerulus integrity trait (VT:0010546)	index of glomerular damage (CMO:0001135)	1	169537671	214537671	Rat
1358294	Bw37	Body weight QTL 37	5	0.000011	body mass (VT:0001259)	body weight (CMO:0000012)	1	171310381	216310381	Rat
2293689	Bss47	Bone structure and strength QTL 47	7.25	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra trabecular cross-sectional area (CMO:0001692)	1	171629477	216629477	Rat
2293693	Bss22	Bone structure and strength QTL 22	33.52	0.0001	femur morphology trait (VT:0000559)	femur cross-sectional area (CMO:0001661)	1	171629477	216629477	Rat
2300161	Bmd43	Bone mineral density QTL 43	8.4	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	1	171629477	216629477	Rat
2300174	Bmd42	Bone mineral density QTL 42	8.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	bone mineral density (CMO:0001226)	1	171629477	216629477	Rat
2300187	Bmd41	Bone mineral density QTL 41	8.9	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	1	171629477	216629477	Rat
2293654	Bss30	Bone structure and strength QTL 30	32.65	0.0001	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	1	171629477	216629477	Rat
2293673	Bss27	Bone structure and strength QTL 27	18.63	0.0001	femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	1	171629477	216629477	Rat
2293677	Bss41	Bone structure and strength QTL 41	9.38	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra cross-sectional area (CMO:0001689)	1	171629477	216629477	Rat
1549830	Bss1	Bone structure and strength QTL 1	4.8		femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	1	172609619	217609619	Rat
61326	Eae6	Experimental allergic encephalomyelitis QTL 6	5.3		body mass (VT:0001259)	change in body weight (CMO:0002045)	1	172949660	181830018	Rat
631214	Bw61	Body weight QTL61	3.4	0.0001	intramuscular adipose amount (VT:0010044)	intramuscular fat area (CMO:0001162)	1	173108781	218108781	Rat
631670	Iddm10	Insulin dependent diabetes mellitus QTL 10	1.9		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	1	174133260	196383668	Rat
70163	Bw20	Body weight QTL 20	5.1		body mass (VT:0001259)	body weight (CMO:0000012)	1	174133260	219133260	Rat

Markers in Region

BE114043

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	174,524,648 - 174,524,823 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	189,911,011 - 189,911,185	NCBI	Rnor6.0
Rnor_5.0	1	196,840,181 - 196,840,355	UniSTS	Rnor5.0
Celera	1	172,274,271 - 172,274,445	UniSTS
RH 3.4 Map	1	1375.9	UniSTS
Cytogenetic Map	1	q34	UniSTS

Related Rat Strains

The following Strains have been annotated to Zp2

WAG.OXYS-(D1Rat219-D1Rat81)/Nov

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium										6	16
Low	1	28	18	2	11	2	1	1	8	7	4	10	1
Below cutoff	2	3	11	11	8	11	7	7	33	17	12	1	7

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_031150	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039092370	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AB000929	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473956	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000044	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000080996 ⟹ ENSRNOP00000068928

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	1	189,899,892 - 189,911,571 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000088536 ⟹ ENSRNOP00000072132

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	174,513,511 - 174,525,288 (-)	Ensembl
Rnor_6.0 Ensembl	1	189,899,898 - 189,911,650 (-)	Ensembl

RefSeq Acc Id:

NM_031150 ⟹ NP_112412

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	1	174,513,511 - 174,525,288 (-)	NCBI
Rnor_6.0	1	189,899,906 - 189,911,650 (-)	NCBI
Rnor_5.0	1	196,829,189 - 196,840,820 (-)	NCBI
Celera	1	172,263,179 - 172,274,910 (-)	RGD

Sequence:

show sequence

CCTGGAGGTATCTTCCAACATGGCTAGGTGGCAGAGAGTCTACTGGTTGCGTTCTCTCTTCTTC
GCCCTTGTGACTTCAGTAAATTCATTAAGCCTTCCTCAGTCAGAGAATCCTGCCTTCCCAGGCA
CTCTCATTTGTGATAAAGATGAAGTGAGAGTAGAATTTTCAAGCAGATTTGACATGGAAAAGTG
GAATCCTTCCTTGGTGGATACCTTTGGTAATGAAATTTCGAACTGCACTTATGCTCTGGACTTG
GAAAAGTTTATCCTGAAATTCCCTTACGAGACCTGTACTATAAAAGTGATTGGTGGATACCAGG
TGAACATCAGAGTGCAGGACACCAATGCTGATGTAAGCTATAAAGATGACGTGCATCACTTTTT
CTGCCCAGCTATTCAAGCAGAGATTCATGAGGTCTCAGAAATTGTTGTCTGCATGGAGGATCTC
ATATCTTTTTCTTTCCCACAACTTTTCTCTAGGCTTGCTGATGAAAATCAGAATGTATCTGAGA
TGGGATGGATTATTAAGATTGGCAATGGTACAAGAGTCCACACTCTGCCCCTGAAGGATGCTAT
AGTACAAGGATTTAATCTCCTGATTGACAGCCAGAAAATAACCCTCCATGTGCCAGCCAATGCT
ACCGGAGTAGCTCACTATGTGCAAGAGAGCAGCTATCTCTATACTGTACAGCTGAAGCTCTTGT
TCTCAAGTCCTGGGCAGAAGATCACCTTCTCTTCACAAGCTATCTGTGCACCAGATCTTTCTGT
GGCTTGTAATGTGACACACATGAGTCTTACTATACCAGAATTTCCTGGGAAGCTAAAATCTGTG
GGCTTTGGACAAAGGAACATCCCTGAGGATCAATGGCATGCCAATGGAATTGACAAAGAAGCAA
CAAATGGCTTGAGACTGCATTTCAGAAAATCTCTCTTGAAGACAAAACCCTCTGAAAAGTGTCC
ATTCTACCAGTTCTACTTCTCTTCACTCGAGCTGACCTTTAACTTCCAAGGGGACATGCTATCC
ACAGTGATTGATCCCGAGTGCCACTGTGAGTCACCGGTCTCCATAGATGAACTGTGTACACGGG
ATGGGTTTATGGACTTTGAGGTCTACAGCCACCAAACAAAACCTGCACTAAACCTGGAGAGCCT
CCTGGTGGGAAACTCCTCCTGCCAGCCTATTTTCAAGGTTCAGTCTCTGGGGCTTGCAAGATTT
CACATACCTCTGAATGGATGTGGAACACGACAGAAATTTGAAGGTGATAAAGTCATCTATGAGA
ATGAAATCCATGCTCTCTGGGAAAATCCACCGTCAAACATTATTTTCAGAAACAGTGAGTTCAG
GATGACCGTGAGATGCCATTACATCAGAGACAGTATGCTACTAAGGGCCCATATCAAAAGCCAT
TCTTCTCCAGTGGCCTCTGTAAAGCCAGGTCCACTAGCGTTGGTCCTACAAACCTACCCAGACA
TATCCTACCAACGGCCTTATAGGAAGAATGAGTACCCTCTAGTGAGGTACCTCCGCCAGCCCAT
CTACATGGAAGTGACAGTCTTGAATAGAAATGATCCCAACATCAAGCTGGTTTTAGATGACTGC
TGGGCAACAACTTTTGAGGACCCAGCCTCTGTCCCCCAGTGGCAGATCATTATGGATGGCTGTG
AATATGAACTGGACAATTACCGCACTACTTTCCACGCAGCCAACTCCTCTGCAGCCCATTCTGG
TCACTACCAGAGGTTTGATGTGAAGACTTTTGCCTTTGTGTCAGAGTCTCGGGGGCTCTCCAGC
CTGATCTACTTCCACTGCAGTGCCTTGATCTGTAACCAAGCCTCCCCTCTGTGCTCTGTGACTT
GCCCTGCACCACTGAGGAACAAACGAGAGGCCAGCAAAGAAGGCACAATGACGGTTAGCCTCCC
AGGACCTATTATCTTGTTGTCAGATGACTCTTCATCCAAAGGTGTAATGAACCCTGACAGCTAT
GAGATTACCAAAGATATTGCTTCTAAAACATTGGGTGCTGTGGCTGCACTAGTGGGCTCAGCAG
TCATCATAGGTTTCATCTGTTACCTGCATAAGAAAAGAATTGTAAGGTTCAATTCCTGATTGGA
CTTTTGCAAATAAAAGAGGCTGCAGT

hide sequence

RefSeq Acc Id:

XM_039092370 ⟹ XP_038948298

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	1	174,513,507 - 174,518,850 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_112412	(Get FASTA)	NCBI Sequence Viewer
	XP_038948298	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	BAA24487	(Get FASTA)	NCBI Sequence Viewer
	EDM17629	(Get FASTA)	NCBI Sequence Viewer
	EDM17630	(Get FASTA)	NCBI Sequence Viewer
	O54767	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_112412 ⟸ NM_031150
- Peptide Label:	precursor
- UniProtKB:	O54767 (UniProtKB/Swiss-Prot), A6I8Q0 (UniProtKB/TrEMBL), M0R4S4 (UniProtKB/TrEMBL)
- Sequence:	show sequence MARWQRVYWLRSLFFALVTSVNSLSLPQSENPAFPGTLICDKDEVRVEFSSRFDMEKWNPSLVD TFGNEISNCTYALDLEKFILKFPYETCTIKVIGGYQVNIRVQDTNADVSYKDDVHHFFCPAIQA EIHEVSEIVVCMEDLISFSFPQLFSRLADENQNVSEMGWIIKIGNGTRVHTLPLKDAIVQGFNL LIDSQKITLHVPANATGVAHYVQESSYLYTVQLKLLFSSPGQKITFSSQAICAPDLSVACNVTH MSLTIPEFPGKLKSVGFGQRNIPEDQWHANGIDKEATNGLRLHFRKSLLKTKPSEKCPFYQFYF SSLELTFNFQGDMLSTVIDPECHCESPVSIDELCTRDGFMDFEVYSHQTKPALNLESLLVGNSS CQPIFKVQSLGLARFHIPLNGCGTRQKFEGDKVIYENEIHALWENPPSNIIFRNSEFRMTVRCH YIRDSMLLRAHIKSHSSPVASVKPGPLALVLQTYPDISYQRPYRKNEYPLVRYLRQPIYMEVTV LNRNDPNIKLVLDDCWATTFEDPASVPQWQIIMDGCEYELDNYRTTFHAANSSAAHSGHYQRFD VKTFAFVSESRGLSSLIYFHCSALICNQASPLCSVTCPAPLRNKREASKEGTMTVSLPGPIILL SDDSSSKGVMNPDSYEITKDIASKTLGAVAALVGSAVIIGFICYLHKKRIVRFNS hide sequence

RefSeq Acc Id:

ENSRNOP00000068928 ⟸ ENSRNOT00000080996

RefSeq Acc Id:

ENSRNOP00000072132 ⟸ ENSRNOT00000088536

RefSeq Acc Id:	XP_038948298 ⟸ XM_039092370
- Peptide Label:	isoform X1

Protein Domains

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-O54767-F1-model_v2	AlphaFold	O54767	1-695	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:620605	AgrOrtholog
BioCyc Gene	G2FUF-57628	BioCyc
Ensembl Genes	ENSRNOG00000057989	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000072132	ENTREZGENE
	ENSRNOP00000072132.1	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000088536	ENTREZGENE
	ENSRNOT00000088536.2	UniProtKB/TrEMBL
Gene3D-CATH	2.60.40.4100	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Zona pellucida, ZP-N domain	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	ZP-C	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ZP_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ZP_dom_CS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:81828	UniProtKB/Swiss-Prot
NCBI Gene	81828	ENTREZGENE
PANTHER	ZONA PELLUCIDA SPERM-BINDING PROTEIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ZONA PELLUCIDA SPERM-BINDING PROTEIN 2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Zona_pellucida	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Zp2	PhenoGen
PRINTS	ZPELLUCIDA	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	ZP_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ZP_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
SMART	SM00241	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A6I8Q0	ENTREZGENE, UniProtKB/TrEMBL
	A6I8Q1_RAT	UniProtKB/TrEMBL
	M0R4S4	ENTREZGENE, UniProtKB/TrEMBL
	O54767	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-04-05	Zp2	zona pellucida glycoprotein 2	Zp2	zona pellucida glycoprotein 2 (sperm receptor)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-09-25	Zp2	zona pellucida glycoprotein 2 (sperm receptor)	Zp2	zona pellucida glycoprotein 2	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-01-20	Zp2	zona pellucida glycoprotein 2		zona pellucida 2 glycoprotein	Name updated	1299863	APPROVED
2002-08-07	Zp2	zona pellucida 2 glycoprotein			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_product	may be a member of the ZPA family	634535

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM