Cyb5a (cytochrome b5 type A) - Rat Genome Database

Name: Cyb5a
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Cyb5a (cytochrome b5 type A) Rattus norvegicus

Analyze

Symbol:

Cyb5a

Name:

cytochrome b5 type A

RGD ID:

620558

Description:

Predicted to enable enzyme binding activity and heme binding activity. Involved in response to cadmium ion. Located in endoplasmic reticulum membrane. Biomarker of pyelonephritis. Human ortholog(s) of this gene implicated in methemoglobinemia and methemoglobinemia and ambiguous genitalia. Orthologous to human CYB5A (cytochrome b5 type A); INTERACTS WITH (+)-schisandrin B; 1,2,4-trichlorobenzene; 1,2-dimethylhydrazine.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

Cyb5; cytochrome b-5; cytochrome b5; cytochrome b5 type A (microsomal); MGC108694

RGD Orthologs

Human

Mouse

Chinchilla

Bonobo

Dog

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	CYB5A (cytochrome b5 type A)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Cyb5a (cytochrome b5 type A (microsomal))	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	LOC102012144 (cytochrome b5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	LOC100968898 (cytochrome b5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	CYB5A (cytochrome b5 type A (microsomal))	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	LOC101960314 (cytochrome b5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	CYB5A (cytochrome b5 type A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	CYB5A (cytochrome b5 type A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	LOC101711375 (cytochrome b5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Cyb5a (cytochrome b5 type A (microsomal))	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	CYB5A (cytochrome b5 type A)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	cyb5a (cytochrome b5 type A (microsomal))	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	CYB5	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Cyt-b5	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	cytb-5.1	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	cytb-5.2	Alliance	DIOPT (Ensembl Compara\|OMA\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	cyb5a	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	18	78,213,067 - 78,245,677 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	18	78,202,342 - 78,258,535 (+)	Ensembl		mRatBN7.2 Ensembl
mRatBN7.2 Ensembl	18	14,179,160 - 14,180,288 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	18	80,316,171 - 80,348,668 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	18	80,988,228 - 81,020,725 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	18	78,823,908 - 78,856,406 (+)	NCBI	Rnor_WKY
Rnor_6.0	18	81,694,818 - 81,726,821 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	18	81,694,808 - 81,726,821 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	18	80,739,215 - 80,770,883 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	18	81,415,972 - 81,452,606 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	18	81,489,421 - 81,526,056 (+)	NCBI
Celera	18	76,829,153 - 76,861,638 (+)	NCBI		Celera
Cytogenetic Map	18	q12.3	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

adult respiratory distress syndrome (ISO)

chromosome 18q deletion syndrome (ISO)

Congenital Methemoglobinemia (ISO)

endometriosis (ISO)

genetic disease (ISO)

intestinal volvulus (ISO)

methemoglobinemia (ISO)

methemoglobinemia and ambiguous genitalia (ISO)

Neurodevelopmental Disorders (ISO)

obesity (ISO)

pulmonary valve stenosis (ISO)

pyelonephritis (IEP)

stomatitis (ISO)

Volvulus Of Midgut (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

(1->4)-beta-D-glucan (ISO)

1,2,4-trichlorobenzene (EXP)

1,2-dimethylhydrazine (EXP,ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (ISO)

17beta-hydroxy-5alpha-androstan-3-one (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (EXP)

2,3,7,8-tetrabromodibenzodioxine (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2-hydroxypropanoic acid (ISO)

2-methylcholine (ISO)

2-tert-butylhydroquinone (ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-sulfonyldiphenol (ISO)

4-(N-nitrosomethylamino)-1-(3-pyridyl)butan-1-one (ISO)

4-nitroquinoline N-oxide (EXP)

7,12-dimethyltetraphene (EXP)

acetamide (EXP)

acrylamide (ISO)

aflatoxin B1 (ISO)

alfentanil (ISO)

Allylamine (EXP)

alpha-hexachlorocyclohexane (EXP)

ammonium chloride (EXP)

anthracen-2-amine (ISO)

aristolochic acid A (EXP)

Aroclor 1254 (EXP)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

atrazine (ISO)

benzo[a]pyrene (EXP,ISO)

benzo[a]pyrene diol epoxide I (ISO)

benzo[b]fluoranthene (ISO)

Benzo[k]fluoranthene (ISO)

bexarotene (EXP)

bisphenol A (EXP,ISO)

Bisphenol B (ISO)

bisphenol F (ISO)

bromobenzene (EXP)

calcidiol (EXP)

carbamazepine (ISO)

carbon nanotube (ISO)

cefaloridine (EXP)

cetrorelix (ISO)

chlorzoxazone (ISO)

cisplatin (EXP,ISO)

citral (EXP)

clofibrate (EXP)

clofibric acid (EXP)

copper(II) sulfate (ISO)

crocidolite asbestos (ISO)

cyclosporin A (ISO)

cyproconazole (ISO)

cytarabine (ISO)

dexamethasone (ISO)

dibenz[a,h]anthracene (ISO)

dibutyl phthalate (EXP)

diethyl maleate (ISO)

diiodine (EXP)

dorsomorphin (ISO)

doxorubicin (ISO)

epoxiconazole (ISO)

ethanol (EXP)

ferroheme b (ISO)

fipronil (EXP,ISO)

flavonoids (EXP)

flutamide (EXP)

genistein (EXP,ISO)

gentamycin (EXP)

geranial (EXP)

geraniol (EXP)

halothane (ISO)

heme b (ISO)

hesperetin (EXP)

hydrogen peroxide (ISO)

hydroxylamine (ISO)

indometacin (EXP,ISO)

inulin (ISO)

isoniazide (EXP)

isotretinoin (ISO)

ivermectin (ISO)

lamivudine (ISO)

limonene (EXP)

lycopene (ISO)

m-xylene (EXP)

Malotilate (ISO)

mercury dibromide (ISO)

methapyrilene (EXP)

methoxychlor (EXP)

methylmercury chloride (ISO)

metoprolol (ISO)

N,N-diethyl-m-toluamide (ISO)

N-Nitrosodi-n-propylamine (ISO)

N-nitrosodiethylamine (EXP,ISO)

NADP zwitterion (ISO)

NADP(+) (ISO)

naphthalene (ISO)

nefazodone (EXP)

nimesulide (EXP)

oxaliplatin (EXP)

paracetamol (EXP,ISO)

paraquat (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (ISO)

phenethyl caffeate (EXP)

phenobarbital (EXP,ISO)

phenylmercury acetate (ISO)

pirinixic acid (ISO)

pregnenolone 16alpha-carbonitrile (EXP,ISO)

progesterone (ISO)

propiconazole (ISO)

Propiverine (EXP)

quercetin (ISO)

rac-lactic acid (ISO)

Rebamipide (EXP)

resveratrol (ISO)

SB 431542 (ISO)

silibinin (EXP)

sodium arsenate (ISO)

sodium arsenite (ISO)

sodium perchlorate (EXP)

Sudan I (EXP,ISO)

sunitinib (ISO)

tangeretin (EXP)

taurine (EXP)

temozolomide (ISO)

testosterone (ISO)

testosterone enanthate (ISO)

tetrachloroethene (ISO)

tetrachloromethane (EXP)

tetracycline (ISO)

thapsigargin (ISO)

thioacetamide (EXP)

topotecan (EXP,ISO)

tributylstannane (EXP)

trichloroethene (ISO)

trichostatin A (ISO)

trovafloxacin (ISO)

tungsten (ISO)

tunicamycin (ISO)

urethane (ISO)

valdecoxib (EXP)

valproic acid (EXP,ISO)

zidovudine (EXP,ISO)

zinc atom (EXP)

zinc(0) (EXP)

zingerone (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

electron transport chain (IEA)

response to cadmium ion (IEP)

Cellular Component

cytosol (ISO)

endoplasmic reticulum (IDA,ISO)

endoplasmic reticulum membrane (IBA,IDA)

intracellular membrane-bounded organelle (IBA,ISO)

membrane (IEA,ISO)

mitochondrial outer membrane (IBA)

Molecular Function

electron transfer activity (TAS)

enzyme binding (ISO)

heme binding (IBA,IEA)

metal ion binding (IEA)

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Chemical shift-based constraints for solution structure determination of paramagnetic low-spin heme proteins with bis-His and His-CN axial ligands: the cases of oxidized cytochrome b(5) and Met80Ala cyano-cytochrome c.	Banci L, etal., J Biol Inorg Chem 2002 Apr;7(4-5):416-26.
2.	Phenobarbital influence on neuromuscular block produced by rocuronium in rats.	Braga Ade F, etal., Acta Cir Bras. 2008 Jul-Aug;23(4):343-7.
3.	Membrane-bound cytochrome b5 reductase (methemoglobin reductase) in human erythrocytes. Study in normal and methemoglobinemic subjects.	Choury D, etal., J Clin Invest. 1981 Jan;67(1):149-55.
4.	Toward engineering the stability and hemin-binding properties of microsomal cytochromes b5 into rat outer mitochondrial membrane cytochrome b5: examining the influence of residues 25 and 71.	Cowley AB, etal., Biochemistry 2002 Oct 1;41(39):11566-81.
5.	Heterologous expression of an endogenous rat cytochrome b(5)/cytochrome b(5) reductase fusion protein: identification of histidines 62 and 85 as the heme axial ligands.	Davis CA, etal., Arch Biochem Biophys 2002 Apr 1;400(1):63-75.
6.	Recessive hereditary methemoglobinemia: two novel mutations in the NADH-cytochrome b5 reductase gene.	Fermo E, etal., Blood Cells Mol Dis. 2008 Jul-Aug;41(1):50-5. doi: 10.1016/j.bcmd.2008.02.002. Epub 2008 Mar 17.
7.	Investigation of the electron-transfer mechanism by cross-linking between Zn-substituted myoglobin and cytochrome b(5).	Furukawa Y, etal., J Am Chem Soc. 2002 Apr 17;124(15):4008-19.
8.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
9.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
10.	Epidemiological evaluation of recurrent stomatitis, nitrates in drinking water, and cytochrome b5 reductase activity.	Gupta SK, etal., Am J Gastroenterol. 1999 Jul;94(7):1808-12.
11.	[Disorders of the processes of protein biosynthesis and a decrease in the content of cytochromes P-450 and b5 in the microsomal fraction of rat kidney in the dynamics of development of acute pyelonephritis]	Karimov KhIa, etal., Ukr Biokhim Zh. 1998 Jul-Aug;70(4):139-42.
12.	Proteomic analysis of rat liver peroxisome: presence of peroxisome-specific isozyme of Lon protease.	Kikuchi M, etal., J Biol Chem. 2004 Jan 2;279(1):421-8. Epub 2003 Oct 15.
13.	Serine-proline replacement at residue 127 of NADH-cytochrome b5 reductase causes hereditary methemoglobinemia, generalized type.	Kobayashi Y, etal., Blood. 1990 Apr 1;75(7):1408-13.
14.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
15.	Black tea polyphenols modulate xenobiotic-metabolizing enzymes, oxidative stress and adduct formation in a rat hepatocarcinogenesis model.	Murugan RS, etal., Free Radic Res. 2008 Oct;42(10):873-84.
16.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
17.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
18.	Effects of chronic exposure to cadmium on renal cytochrome P450-dependent monooxygenase system in rats.	Plewka A, etal., Arch Toxicol. 2004 Apr;78(4):194-200. Epub 2003 Nov 1.
19.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
20.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
21.	Comprehensive gene review and curation	RGD comprehensive gene curation
22.	Integration of cytochrome b5 into endoplasmic reticulum membrane: participation of carboxy-terminal portion of the transmembrane domain.	Tanaka S, etal., J Biochem (Tokyo). 2003 Feb;133(2):247-51.
23.	Identification of two homologous cytochrome b5s in rat brain.	Yoo M Biochem Biophys Res Commun 1997 Jul 30;236(3):641-2.

Additional References at PubMed

PMID:1396600	PMID:2752049	PMID:6840088	PMID:7093287	PMID:8639599	PMID:9363779	PMID:9425037	PMID:9622481	PMID:11294656	PMID:12477932	PMID:12668680	PMID:14563830
PMID:14651853	PMID:15379561	PMID:15489334	PMID:15680923	PMID:16807901	PMID:18398853	PMID:18398854	PMID:19817686	PMID:19946888	PMID:20511233	PMID:22375059	PMID:23376485
PMID:29227865	PMID:31006538

Genomics

Comparative Map Data

Cyb5a
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	18	78,213,067 - 78,245,677 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	18	78,202,342 - 78,258,535 (+)	Ensembl		mRatBN7.2 Ensembl
mRatBN7.2 Ensembl	18	14,179,160 - 14,180,288 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	18	80,316,171 - 80,348,668 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	18	80,988,228 - 81,020,725 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	18	78,823,908 - 78,856,406 (+)	NCBI	Rnor_WKY
Rnor_6.0	18	81,694,818 - 81,726,821 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	18	81,694,808 - 81,726,821 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	18	80,739,215 - 80,770,883 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	18	81,415,972 - 81,452,606 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	18	81,489,421 - 81,526,056 (+)	NCBI
Celera	18	76,829,153 - 76,861,638 (+)	NCBI		Celera
Cytogenetic Map	18	q12.3	NCBI

CYB5A
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	18	74,250,846 - 74,291,963 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	18	74,250,846 - 74,291,973 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	18	71,918,081 - 71,959,198 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	18	70,071,507 - 70,110,201 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	18	70,071,507 - 70,110,201	NCBI
Celera	18	68,787,880 - 68,826,566 (-)	NCBI		Celera
Cytogenetic Map	18	q22.3	NCBI
HuRef	18	68,652,932 - 68,691,654 (-)	NCBI		HuRef
CHM1_1	18	71,915,750 - 71,954,471 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	18	74,478,400 - 74,519,513 (-)	NCBI		T2T-CHM13v2.0

Cyb5a
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	18	84,869,463 - 84,897,996 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	18	84,856,829 - 84,897,996 (+)	Ensembl		GRCm39 Ensembl
GRCm38	18	84,851,338 - 84,879,871 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	18	84,838,704 - 84,879,871 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	18	85,020,806 - 85,049,255 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	18	84,985,607 - 85,014,056 (+)	NCBI		MGSCv36	mm8
Celera	18	85,916,355 - 85,944,796 (+)	NCBI		Celera
Cytogenetic Map	18	E4	NCBI
cM Map	18	57.53	NCBI

LOC102012144
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955402	57,701,931 - 57,739,163 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955402	57,701,931 - 57,739,163 (-)	NCBI	ChiLan1.0	ChiLan1.0

LOC100968898
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	18	77,480,954 - 77,519,968 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	18	67,638,406 - 67,677,111 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	18	70,919,329 - 70,957,873 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	18	70,919,617 - 70,957,732 (-)	Ensembl	panpan1.1		panPan2

CYB5A
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	1	5,070,817 - 5,106,668 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	1	5,070,865 - 5,106,932 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
ROS_Cfam_1.0 Ensembl	1	4,881,337 - 4,922,028 (+)	Ensembl		ROS_Cfam_1.0 Ensembl

LOC101960314
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404944	18,855,437 - 18,885,877 (+)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936616	4,176,576 - 4,210,276 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CYB5A
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	149,737,571 - 149,773,219 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	1	149,737,584 - 149,773,222 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	165,902,066 - 165,937,612 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

CYB5A
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	18	5,599,198 - 5,636,620 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	18	5,599,206 - 5,640,012 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666060	20,247,043 - 20,284,435 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

LOC101711375
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624806	6,399,460 - 6,436,735 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624806	6,399,708 - 6,434,667 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Cyb5a
101 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	197
Count of miRNA genes:	141
Interacting mature miRNAs:	149
Transcripts:	ENSRNOT00000020446, ENSRNOT00000064490
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1578661	Bss20	Bone structure and strength QTL 20	3.7		femur morphology trait (VT:0000559)	femoral neck cross-sectional area (CMO:0001697)	18	11791518	83218561	Rat
1578667	Bss21	Bone structure and strength QTL 21	3.5		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	18	11791518	83218561	Rat
1600373	Mamtr6	Mammary tumor resistance QTL 6			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	18	19278901	83218561	Rat
1331741	Bp232	Blood pressure QTL 232	3.59112		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	18	21372893	83213037	Rat
1331733	Bp233	Blood pressure QTL 233	3.97196		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	24796977	79788953	Rat
2303120	Mamtr8	Mammary tumor resistance QTL 8		0.001	mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	18	31359408	83218561	Rat
631518	Bw11	Body weight QTL 11	2.8		body mass (VT:0001259)	body weight (CMO:0000012)	18	35870723	80870723	Rat
61367	Iddm4	Insulin dependent diabetes mellitus QTL 4	2.33	0.0074	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	18	38192455	83192455	Rat
1598826	Anxrr20	Anxiety related response QTL 20	3.04		body movement coordination trait (VT:0005424)	number of rearing movements in an experimental apparatus (CMO:0001752)	18	41432971	83828827	Rat
6893683	Bw110	Body weight QTL 110	2.7	0.002	body mass (VT:0001259)	body weight (CMO:0000012)	18	43345022	83828827	Rat
8694366	Abfw8	Abdominal fat weight QTL 8	6.38	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	18	46640675	83828827	Rat
8694432	Bw165	Body weight QTL 165	3.81	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	18	46640675	83828827	Rat
9589041	Epfw12	Epididymal fat weight QTL 12	17.08	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	18	46640675	83828827	Rat
2303571	Bw92	Body weight QTL 92	3		body mass (VT:0001259)	body weight (CMO:0000012)	18	48520044	83828827	Rat
2303584	Gluco55	Glucose level QTL 55	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	18	48520044	83828827	Rat
738008	Hcar14	Hepatocarcinoma resistance QTL 14	4.3		liver integrity trait (VT:0010547)	liver nonremodeling tumorous lesion number (CMO:0001462)	18	51464733	83218561	Rat
1298072	Cia26	Collagen induced arthritis QTL 26	3.6		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	18	54709769	83828827	Rat
724542	Kidm2	Kidney mass QTL 2	2.6		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	18	59172115	83828827	Rat
6903353	Bp353	Blood pressure QTL 353	2.8		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	18	59796478	83828827	Rat
6903356	Bp354	Blood pressure QTL 354	4.6		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	59796478	83828827	Rat
634333	Pia19	Pristane induced arthritis QTL 19	3.4		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	18	73997140	79532029	Rat

Markers in Region

RH140952

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	18	14,179,275 - 14,179,492 (+)	MAPPER	mRatBN7.2
Rnor_6.0	18	13,903,992 - 13,904,208	NCBI	Rnor6.0
Rnor_5.0	18	13,686,964 - 13,687,180	UniSTS	Rnor5.0
RGSC_v3.4	18	14,598,173 - 14,598,389	UniSTS	RGSC3.4
Celera	18	14,157,870 - 14,158,086	UniSTS
RH 3.4 Map	18	167.4	UniSTS
Cytogenetic Map	18	q12.3	UniSTS
Cytogenetic Map	18	p12	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High			17	17		17
Medium	3	43	40	24	19	24	8	11	74	35	41	11	8
Low
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_022245	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039097080	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039097081	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039097082	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF007107	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF007108	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC086945	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474021	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	D13205	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ209861	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ210489	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ210790	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ210834	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ211029	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ224354	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000301	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSRNOT00000020446 ⟹ ENSRNOP00000020446

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	18	78,213,054 - 78,258,535 (+)	Ensembl
Rnor_6.0 Ensembl	18	81,694,808 - 81,726,821 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000098124 ⟹ ENSRNOP00000089416

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	18	78,213,106 - 78,245,427 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000102664 ⟹ ENSRNOP00000088469

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	18	78,202,342 - 78,246,646 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000105279 ⟹ ENSRNOP00000086849

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	18	78,202,342 - 78,246,646 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000106026 ⟹ ENSRNOP00000084531

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	18	78,213,086 - 78,246,646 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000110451 ⟹ ENSRNOP00000094995

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	18	14,179,160 - 14,180,288 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000112034 ⟹ ENSRNOP00000084294

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	18	78,213,671 - 78,246,646 (+)	Ensembl

RefSeq Acc Id:

NM_022245 ⟹ NP_071581

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	18	78,213,137 - 78,245,674 (+)	NCBI
Rnor_6.0	18	81,694,818 - 81,726,821 (+)	NCBI
Rnor_5.0	18	80,739,215 - 80,770,883 (+)	NCBI
RGSC_v3.4	18	81,415,972 - 81,452,606 (+)	RGD
Celera	18	76,829,153 - 76,861,638 (+)	RGD

Sequence:

show sequence

TCCGGCCCGGGACATTGCACTACCCTGCAAGCTGTGTTGCAGGGCCCGGAAGGCTCACTGTTCC
GAAATGGCCGAGCAGTCAGACAAGGATGTGAAGTACTACACTCTGGAGGAGATTCAGAAGCACA
AAGACAGCAAGAGCACCTGGGTGATCCTACATCATAAGGTGTACGATCTGACCAAGTTTCTCGA
AGAGCATCCTGGTGGGGAAGAAGTCCTAAGAGAGCAAGCTGGGGGTGATGCTACTGAGAACTTT
GAGGACGTCGGGCACTCTACGGATGCACGAGAACTGTCCAAAACATACATCATCGGGGAGCTCC
ATCCAGATGACAGATCAAAGATAGCCAAGCCTTCGGAAACCCTTATCACTACTGTCGAGTCTAA
TTCCAGTTGGTGGACCAACTGGGTGATCCCAGCCATCTCAGCCCTGGTGGTAGCTCTGATGTAT
CGCCTCTACATGGCAGAAGATTAACCTGTCTGTCCGAAGCCAAGGAAGGAAAAGACTGCCCCAG
AGAGGGGAGAAAAGAAGCCAGTGTTAATCACTTCCACTGACAGAAACCCTCCCCCTGAGAATGT
AATTGTAATATATCTGTCTCCCTCTCCTCCTATGCTAGGAGAACAAAGATGGGACTCTTTGTAC
TCTTAAACTTTCAAATGTGCCTTTTTACTCAACTTCATTTTGACATTTCTTCACTACGTAATTT
ACTTATTGTAAACATGATCTTTTTAAATAATATCTGGCTTGTAAAGT

hide sequence

RefSeq Acc Id:

XM_039097080 ⟹ XP_038953008

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	18	78,213,067 - 78,245,411 (+)	NCBI

RefSeq Acc Id:

XM_039097081 ⟹ XP_038953009

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	18	78,213,068 - 78,245,677 (+)	NCBI

RefSeq Acc Id:

XM_039097082 ⟹ XP_038953010

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	18	78,213,068 - 78,245,420 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_071581	(Get FASTA)	NCBI Sequence Viewer
	XP_038953008	(Get FASTA)	NCBI Sequence Viewer
	XP_038953009	(Get FASTA)	NCBI Sequence Viewer
	XP_038953010	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAB67609	(Get FASTA)	NCBI Sequence Viewer
	AAB67610	(Get FASTA)	NCBI Sequence Viewer
	AAH86945	(Get FASTA)	NCBI Sequence Viewer
	BAA02492	(Get FASTA)	NCBI Sequence Viewer
	EDL75178	(Get FASTA)	NCBI Sequence Viewer
	EDL75179	(Get FASTA)	NCBI Sequence Viewer
	EDL75180	(Get FASTA)	NCBI Sequence Viewer
	EDL75181	(Get FASTA)	NCBI Sequence Viewer
	EDL75182	(Get FASTA)	NCBI Sequence Viewer
	P00173	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:	NP_071581 ⟸ NM_022245
- UniProtKB:	O35768 (UniProtKB/Swiss-Prot), P00173 (UniProtKB/Swiss-Prot)
- Sequence:	show sequence MAEQSDKDVKYYTLEEIQKHKDSKSTWVILHHKVYDLTKFLEEHPGGEEVLREQAGGDATENFE DVGHSTDARELSKTYIIGELHPDDRSKIAKPSETLITTVESNSSWWTNWVIPAISALVVALMYR LYMAED hide sequence

RefSeq Acc Id:

ENSRNOP00000020446 ⟸ ENSRNOT00000020446

RefSeq Acc Id:	XP_038953008 ⟸ XM_039097080
- Peptide Label:	isoform X1

RefSeq Acc Id:	XP_038953009 ⟸ XM_039097081
- Peptide Label:	isoform X2

RefSeq Acc Id:	XP_038953010 ⟸ XM_039097082
- Peptide Label:	isoform X2

RefSeq Acc Id:

ENSRNOP00000084294 ⟸ ENSRNOT00000112034

RefSeq Acc Id:

ENSRNOP00000086849 ⟸ ENSRNOT00000105279

RefSeq Acc Id:

ENSRNOP00000084531 ⟸ ENSRNOT00000106026

RefSeq Acc Id:

ENSRNOP00000088469 ⟸ ENSRNOT00000102664

RefSeq Acc Id:

ENSRNOP00000094995 ⟸ ENSRNOT00000110451

RefSeq Acc Id:

ENSRNOP00000089416 ⟸ ENSRNOT00000098124

Protein Domains

Cytochrome b5 heme-binding

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P00173-F1-model_v2	AlphaFold	P00173	1-134	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13700895

Promoter ID:

EPDNEW_R11419

Type:

initiation region

Name:

Cyb5a_1

Description:

cytochrome b5 type A

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	18	81,694,809 - 81,694,869	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:620558	AgrOrtholog
BioCyc Gene	G2FUF-6743	BioCyc
Ensembl Genes	ENSRNOG00000015205	Ensembl, UniProtKB/TrEMBL
	ENSRNOG00000070068	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000020446.4	UniProtKB/TrEMBL
	ENSRNOP00000084294.1	UniProtKB/TrEMBL
	ENSRNOP00000084531	ENTREZGENE
	ENSRNOP00000084531.1	UniProtKB/TrEMBL
	ENSRNOP00000086849.1	UniProtKB/TrEMBL
	ENSRNOP00000088469.1	UniProtKB/TrEMBL
	ENSRNOP00000089416.1	UniProtKB/TrEMBL
	ENSRNOP00000094995.1	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000020446.5	UniProtKB/TrEMBL
	ENSRNOT00000098124.1	UniProtKB/TrEMBL
	ENSRNOT00000102664.1	UniProtKB/TrEMBL
	ENSRNOT00000105279.1	UniProtKB/TrEMBL
	ENSRNOT00000106026	ENTREZGENE
	ENSRNOT00000106026.1	UniProtKB/TrEMBL
	ENSRNOT00000110451.1	UniProtKB/TrEMBL
	ENSRNOT00000112034.1	UniProtKB/TrEMBL
Gene3D-CATH	3.10.120.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7322141	IMAGE-MGC_LOAD
InterPro	Cyt_B5-like_heme/steroid-bd	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Cyt_B5-like_heme/steroid_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Cyt_B5_heme-BS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:64001	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:108694	IMAGE-MGC_LOAD
NCBI Gene	64001	ENTREZGENE
PANTHER	CYTOCHROME B5	UniProtKB/Swiss-Prot
	CYTOCHROME B5	UniProtKB/Swiss-Prot
	CYTOCHROME B5	UniProtKB/TrEMBL
	CYTOCHROME B5	UniProtKB/TrEMBL
Pfam	Cyt-b5	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PharmGKB	CYB5A	RGD
PhenoGen	Cyb5a	PhenoGen
PRINTS	CYTOCHROMEB5	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	CYTOCHROME_B5_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	CYTOCHROME_B5_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
SMART	Cyt-b5	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF55856	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A8I5ZZA5_RAT	UniProtKB/TrEMBL
	A0A8I6A1N0_RAT	UniProtKB/TrEMBL
	A0A8I6A321_RAT	UniProtKB/TrEMBL
	A0A8I6A7X5_RAT	UniProtKB/TrEMBL
	A0A8I6A8N4_RAT	UniProtKB/TrEMBL
	A0A8I6AM61_RAT	UniProtKB/TrEMBL
	A0A8L2QAA3_RAT	UniProtKB/TrEMBL
	CYB5_RAT	UniProtKB/Swiss-Prot
	O35768	ENTREZGENE
	P00173	ENTREZGENE
UniProt Secondary	O35768	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-04-13	Cyb5a	cytochrome b5 type A	Cyb5a	cytochrome b5 type A (microsomal)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-09-26	Cyb5a	cytochrome b5 type A (microsomal)	Cyb5	cytochrome b-5	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-09-10	Cyb5	cytochrome b-5		cytochrome b5	Name updated	1299863	APPROVED
2002-08-07	Cyb5	cytochrome b5			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_domains	contains both heme and FAD prosthetic groups	632262

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM