Acaa2 (acetyl-CoA acyltransferase 2)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Acaa2 (acetyl-CoA acyltransferase 2) Rattus norvegicus

Analyze

Symbol:

Acaa2

Name:

acetyl-CoA acyltransferase 2

RGD ID:

620482

Description:

Enables acetyl-CoA C-acyltransferase activity and acyl-CoA hydrolase activity. Involved in acetyl-CoA metabolic process and fatty acid beta-oxidation. Located in mitochondrial matrix. Orthologous to human ACAA2 (acetyl-CoA acyltransferase 2); PARTICIPATES IN fatty acid beta degradation pathway; 3-hydroxy-3-methylglutaryl-CoA lyase deficiency pathway; 3-hydroxyacyl-CoA dehydrogenase deficiency pathway; INTERACTS WITH 1,2,4-trimethylbenzene; 1,3-dinitrobenzene; 17alpha-ethynylestradiol.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

3-ketoacyl-CoA thiolase, mitochondrial; acetyl-CoA acetyltransferase; acetyl-CoA acyltransferase; acetyl-Coenzyme A acyltransferase 2; acetyl-Coenzyme A acyltransferase 2 (mitochondrial 3-oxoacyl-Coenzyme A thiolase); acyl-CoA hydrolase, mitochondrial; beta-ketothiolase; mitochondrial 3-oxoacyl-CoA thiolase

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	ACAA2 (acetyl-CoA acyltransferase 2)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, Treefam
Mus musculus (house mouse):	Acaa2 (acetyl-CoA acyltransferase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Acaa2 (acetyl-CoA acyltransferase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	ACAA2 (acetyl-CoA acyltransferase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	ACAA2 (acetyl-CoA acyltransferase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Acaa2 (acetyl-CoA acyltransferase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	ACAA2 (acetyl-CoA acyltransferase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	ACAA2 (acetyl-CoA acyltransferase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Acaa2 (acetyl-CoA acyltransferase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	ACAA2 (acetyl-CoA acyltransferase 2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Acaa2 (acetyl-CoA acyltransferase 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	acaa2 (acetyl-CoA acyltransferase 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	acaa-2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	yip2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	acaa2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	18	68,345,136 - 68,373,246 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	18	68,345,012 - 68,373,249 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	18	70,453,198 - 70,481,430 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	18	71,122,661 - 71,150,827 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	18	68,979,238 - 69,007,466 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	18	70,733,872 - 70,762,395 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	18	70,733,872 - 70,762,395 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	18	69,873,084 - 69,901,836 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	18	71,587,259 - 71,632,610 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	18	71,660,459 - 71,705,811 (+)	NCBI
Celera	18	66,521,595 - 66,549,734 (+)	NCBI		Celera
Cytogenetic Map	18	q12.2	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

adult respiratory distress syndrome (ISO)

genetic disease (ISO)

intellectual disability (ISO)

osteoarthritis (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-dexrazoxane (ISO)

(S)-nicotine (ISO)

1,2,4-trimethylbenzene (EXP)

1,2-dimethylhydrazine (ISO)

1,3-dinitrobenzene (EXP)

1,4-benzoquinone (ISO)

1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine (ISO)

15-deoxy-Delta(12,14)-prostaglandin J2 (ISO)

17alpha-ethynylestradiol (EXP)

17beta-estradiol (EXP,ISO)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4,6-trinitrotoluene (EXP)

2,4-dinitrotoluene (EXP)

2-acetamidofluorene (EXP)

3,3',4,4',5-pentachlorobiphenyl (EXP)

3-chloropropane-1,2-diol (EXP)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-sulfonyldiphenol (ISO)

4-amino-2,6-dinitrotoluene (EXP)

6-(4-chlorophenyl)imidazo[2,1-b][1,3]thiazole-5-carbaldehyde O-(3,4-dichlorobenzyl)oxime (ISO)

acetamide (EXP)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

alpha-hexachlorocyclohexane (EXP)

ammonium chloride (EXP)

aristolochic acid A (ISO)

arsenous acid (ISO)

atrazine (ISO)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (EXP)

bisphenol A (EXP,ISO)

Bisphenol B (ISO)

bisphenol F (ISO)

buspirone (EXP)

cadmium atom (ISO)

cadmium dichloride (ISO)

carbon nanotube (ISO)

CGP 52608 (ISO)

chlorpyrifos (EXP)

ciglitazone (ISO)

ciprofibrate (EXP)

cisplatin (EXP,ISO)

clobetasol (ISO)

clofibrate (EXP,ISO)

clofibric acid (EXP)

cobalt dichloride (EXP)

copper atom (EXP)

copper(0) (EXP)

copper(II) sulfate (ISO)

coumarin (EXP)

coumestrol (ISO)

Cuprizon (EXP)

cyclosporin A (ISO)

cyproconazole (ISO)

decabromodiphenyl ether (EXP)

dexamethasone (ISO)

dextran sulfate (ISO)

diarsenic trioxide (ISO)

dibutyl phthalate (EXP,ISO)

dioxygen (ISO)

dipentyl phthalate (EXP)

diquat (ISO)

disodium selenite (ISO)

diuron (ISO)

doxorubicin (EXP,ISO)

elemental selenium (ISO)

endosulfan (EXP)

Enterolactone (ISO)

epoxiconazole (ISO)

ethanol (ISO)

farnesol (ISO)

fenofibrate (EXP,ISO)

finasteride (EXP)

flavone (ISO)

flutamide (EXP,ISO)

folic acid (ISO)

furan (EXP)

gemfibrozil (EXP)

genistein (ISO)

gentamycin (EXP)

GW 4064 (ISO)

GW 7647 (ISO)

indometacin (EXP)

isotretinoin (ISO)

ivermectin (ISO)

ketoconazole (EXP)

leflunomide (EXP)

methotrexate (ISO)

methoxychlor (EXP)

mono(2-ethylhexyl) phthalate (ISO)

Muraglitazar (EXP)

N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (ISO)

N-nitrosodiethylamine (EXP)

nefazodone (EXP)

nickel atom (ISO)

nicotine (ISO)

nimesulide (EXP)

nitrofen (EXP)

obeticholic acid (ISO)

oleic acid (ISO)

ouabain (ISO)

paracetamol (ISO)

perfluorohexanesulfonic acid (ISO)

perfluorooctane-1-sulfonic acid (EXP,ISO)

perfluorooctanoic acid (EXP,ISO)

phenobarbital (EXP,ISO)

phlorizin (ISO)

pirinixic acid (EXP,ISO)

pravastatin (EXP,ISO)

pregnenolone 16alpha-carbonitrile (EXP)

propiconazole (ISO)

quercetin (ISO)

resveratrol (ISO)

rotenone (EXP)

sarin (ISO)

selenium atom (ISO)

simvastatin (EXP)

sodium arsenite (ISO)

sodium fluoride (ISO)

sulforaphane (ISO)

sunitinib (ISO)

temozolomide (ISO)

Tesaglitazar (EXP)

testosterone (EXP)

tetrachloroethene (ISO)

tetrachloromethane (EXP,ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

tributylstannane (ISO)

troglitazone (EXP)

tunicamycin (ISO)

urethane (ISO)

valproic acid (EXP,ISO)

vancomycin (ISO)

vinclozolin (EXP)

vitamin E (ISO)

zaragozic acid A (EXP,ISO)

zinc atom (EXP)

zinc(0) (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

acetyl-CoA metabolic process (IDA)

cellular response to hypoxia (IEA,ISO)

fatty acid beta-oxidation (IBA,IDA,IEA)

negative regulation of mitochondrial membrane permeability involved in apoptotic process (IEA,ISO)

negative regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway (IEA,ISO,ISS)

Cellular Component

mitochondrial matrix (IDA,NAS)

mitochondrion (IBA,IEA,ISO)

Molecular Function

acetyl-CoA C-acetyltransferase activity (IBA,IEA,ISO)

acetyl-CoA C-acyltransferase activity (IDA,ISO)

acetyl-CoA hydrolase activity (IEA)

acyl-CoA hydrolase activity (IDA,IEA,ISO)

acyltransferase activity, transferring groups other than amino-acyl groups (IEA)

myristoyl-CoA hydrolase activity (IEA)

palmitoyl-CoA hydrolase activity (IEA)

protein binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

3-hydroxy-3-methylglutaryl-CoA lyase deficiency pathway (ISO)

3-hydroxyacyl-CoA dehydrogenase deficiency pathway (ISO)

3-hydroxyisobutyric aciduria pathway (ISO)

3-methylcrotonyl CoA carboxylase 1 deficiency pathway (ISO)

3-methylglutaconic aciduria type 1 pathway (ISO)

3-methylglutaconic aciduria type 3 pathway (ISO)

carnitine palmitoyltransferase I deficiency pathway (ISO)

ethylmalonic encephalopathy pathway (ISO)

fatty acid beta degradation pathway (IDA,ISO)

fatty acid elongation pathway (IEA,ISO)

fatty acid metabolic pathway (IEA,ISO)

glutaric aciduria type I pathway (ISO)

isobutyryl-CoA dehydrogenase deficiency pathway (ISO)

isovaleric acidemia pathway (ISO)

maple syrup urine disease pathway (ISO)

medium chain acyl-CoA dehydrogenase deficiency pathway (ISO)

methylmalonate semialdehyde dehydrogenase deficiency pathway (ISO)

methylmalonic acidemia pathway (ISO)

propionic acidemia pathway (ISO)

short-chain acyl-CoA dehydrogenase deficiency pathway (ISO)

trifunctional protein deficiency pathway (ISO)

valine, leucine and isoleucine degradation pathway (IEA,ISO)

very long-chain acyl-CoA dehydrogenase deficiency pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	cDNA-derived amino acid sequence of rat mitochondrial 3-oxoacyl-CoA thiolase with no transient presequence: structural relationship with peroxisomal isozyme.	Arakawa H, etal., EMBO J 1987 May;6(5):1361-6.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
4.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
5.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
6.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
7.	SMPDB Annotation Import Pipeline	Pipeline to import SMPDB annotations from SMPDB into RGD
8.	GOA pipeline	RGD automated data pipeline
9.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
10.	Complete beta-oxidation of valproate: cleavage of 3-oxovalproyl-CoA by a mitochondrial 3-oxoacyl-CoA thiolase.	Silva MF, etal., Biochem J. 2002 Mar 15;362(Pt 3):755-60.
11.	Acetate generation in rat liver mitochondria; acetyl-CoA hydrolase activity is demonstrated by 3-ketoacyl-CoA thiolase.	Yamashita H, etal., Biochim Biophys Acta. 2006 Jan;1761(1):17-23. Epub 2006 Jan 30.

Additional References at PubMed

PMID:12865426	PMID:14651853	PMID:18371312	PMID:18614015	PMID:22658674	PMID:23376485	PMID:24625528	PMID:25478839	PMID:29867124	PMID:30053369

Genomics

Comparative Map Data

Acaa2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	18	68,345,136 - 68,373,246 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	18	68,345,012 - 68,373,249 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	18	70,453,198 - 70,481,430 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	18	71,122,661 - 71,150,827 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	18	68,979,238 - 69,007,466 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	18	70,733,872 - 70,762,395 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	18	70,733,872 - 70,762,395 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	18	69,873,084 - 69,901,836 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	18	71,587,259 - 71,632,610 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	18	71,660,459 - 71,705,811 (+)	NCBI
Celera	18	66,521,595 - 66,549,734 (+)	NCBI		Celera
Cytogenetic Map	18	q12.2	NCBI

ACAA2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	18	49,782,164 - 49,813,533 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	18	49,782,164 - 49,813,953 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	18	47,308,534 - 47,339,903 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	18	45,563,873 - 45,593,900 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	18	45,563,872 - 45,593,900	NCBI
Celera	18	44,166,539 - 44,196,918 (-)	NCBI		Celera
Cytogenetic Map	18	q21.1	NCBI
HuRef	18	44,164,298 - 44,194,528 (-)	NCBI		HuRef
CHM1_1	18	47,305,498 - 47,335,866 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	18	49,981,292 - 50,015,307 (-)	NCBI		T2T-CHM13v2.0

Acaa2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	18	74,912,283 - 74,939,278 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	18	74,912,268 - 74,939,279 (+)	Ensembl		GRCm39 Ensembl
GRCm38	18	74,779,212 - 74,806,207 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	18	74,779,197 - 74,806,208 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	18	74,938,866 - 74,965,861 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	18	74,904,577 - 74,931,572 (+)	NCBI		MGSCv36	mm8
Celera	18	76,003,491 - 76,030,308 (+)	NCBI		Celera
Cytogenetic Map	18	E2	NCBI
cM Map	18	50.76	NCBI

Acaa2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955402	34,857,317 - 34,885,169 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955402	34,857,317 - 34,885,169 (-)	NCBI	ChiLan1.0	ChiLan1.0

ACAA2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	18	53,003,387 - 53,033,936 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	18	43,164,504 - 43,195,038 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	18	46,512,374 - 46,542,737 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	18	46,512,374 - 46,542,737 (-)	Ensembl	panpan1.1		panPan2

ACAA2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	7	79,028,636 - 79,057,720 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	7	78,425,399 - 78,464,609 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	7	79,086,363 - 79,125,478 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	7	79,086,417 - 79,125,474 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	7	78,802,328 - 78,841,679 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	7	78,830,801 - 78,869,895 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	7	79,116,676 - 79,155,898 (+)	NCBI		UU_Cfam_GSD_1.0

Acaa2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404944	38,003,267 - 38,029,972 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936497	13,242,644 - 13,269,532 (+)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936497	13,242,644 - 13,269,007 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

ACAA2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	99,284,140 - 99,311,321 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	1	99,284,467 - 99,310,759 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	108,842,950 - 108,869,736 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

ACAA2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	18	31,152,067 - 31,181,020 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	18	31,152,074 - 31,181,706 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666050	5,299,842 - 5,328,903 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Acaa2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624778	13,307,094 - 13,336,120 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624778	13,307,236 - 13,336,347 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Acaa2
173 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	42
Count of miRNA genes:	37
Interacting mature miRNAs:	41
Transcripts:	ENSRNOT00000067018
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1578661	Bss20	Bone structure and strength QTL 20	3.7		femur morphology trait (VT:0000559)	femoral neck cross-sectional area (CMO:0001697)	18	11791518	83218561	Rat
1578667	Bss21	Bone structure and strength QTL 21	3.5		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	18	11791518	83218561	Rat
1600373	Mamtr6	Mammary tumor resistance QTL 6			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	18	19278901	83218561	Rat
1331741	Bp232	Blood pressure QTL 232	3.59112		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	18	21372893	83213037	Rat
1331733	Bp233	Blood pressure QTL 233	3.97196		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	24796977	79788953	Rat
2325839	Bp348	Blood pressure QTL 348		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	25570985	70570985	Rat
2293704	Bss35	Bone structure and strength QTL 35	4.59	0.0002	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	18	28964853	73964853	Rat
2300157	Bmd66	Bone mineral density QTL 66	13.1	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	18	28964853	73964853	Rat
2300177	Bmd65	Bone mineral density QTL 65	19.7	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	18	28964853	73964853	Rat
9589816	Gluco68	Glucose level QTL 68	7.25	0.001	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	18	29792965	74792965	Rat
8694378	Bw157	Body weight QTL 157	3.59	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	18	29792965	74792965	Rat
9590318	Scort22	Serum corticosterone level QTL 22	7.64	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	18	29792965	74792965	Rat
1331754	Bp230	Blood pressure QTL 230	4.61609		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	29792965	74792965	Rat
738005	Anxrr11	Anxiety related response QTL 11	3.4		exploratory behavior trait (VT:0010471)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	18	30039813	75039813	Rat
61429	Cia17	Collagen induced arthritis QTL 17	4.6		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	18	31359408	70263868	Rat
2303120	Mamtr8	Mammary tumor resistance QTL 8		0.001	mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	18	31359408	83218561	Rat
631274	Sprol1	Serum protein level QTL 1	5.3		blood total protein amount (VT:0005567)	serum total protein level (CMO:0000661)	18	31393320	77209694	Rat
631518	Bw11	Body weight QTL 11	2.8		body mass (VT:0001259)	body weight (CMO:0000012)	18	35870723	80870723	Rat
61367	Iddm4	Insulin dependent diabetes mellitus QTL 4	2.33	0.0074	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	18	38192455	83192455	Rat
1598826	Anxrr20	Anxiety related response QTL 20	3.04		body movement coordination trait (VT:0005424)	number of rearing movements in an experimental apparatus (CMO:0001752)	18	41432971	83828827	Rat
6893683	Bw110	Body weight QTL 110	2.7	0.002	body mass (VT:0001259)	body weight (CMO:0000012)	18	43345022	83828827	Rat
8694366	Abfw8	Abdominal fat weight QTL 8	6.38	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	18	46640675	83828827	Rat
8694432	Bw165	Body weight QTL 165	3.81	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	18	46640675	83828827	Rat
9589041	Epfw12	Epididymal fat weight QTL 12	17.08	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	18	46640675	83828827	Rat
2303571	Bw92	Body weight QTL 92	3		body mass (VT:0001259)	body weight (CMO:0000012)	18	48520044	83828827	Rat
2303584	Gluco55	Glucose level QTL 55	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	18	48520044	83828827	Rat
738008	Hcar14	Hepatocarcinoma resistance QTL 14	4.3		liver integrity trait (VT:0010547)	liver nonremodeling tumorous lesion number (CMO:0001462)	18	51464733	83218561	Rat
1359020	Ppulsi2	Prepulse inhibition QTL 2	2.71		prepulse inhibition trait (VT:0003088)	acoustic startle response measurement (CMO:0001519)	18	52292875	73997283	Rat
631509	Sald2	Serum aldosterone level QTL 2	2.9		blood aldosterone amount (VT:0005346)	serum aldosterone level (CMO:0000487)	18	52539763	69140759	Rat
12880368	Bw187	Body weight QTL 187		0.045	body mass (VT:0001259)	body weight (CMO:0000012)	18	52539763	76104388	Rat
12904067	Cm122	Cardiac mass QTL 122		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	18	52539763	76104388	Rat
12904069	Cm123	Cardiac mass QTL 123		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	18	52539763	76104388	Rat
12904070	Cm124	Cardiac mass QTL 124		0.01	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	18	52539763	76104388	Rat
12904071	Am18	Aortic mass QTL 18		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	18	52539763	76104388	Rat
12904073	Kidm71	Kidney mass QTL 71		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	18	52539763	76104388	Rat
2301417	Bp319	Blood pressure QTL 319		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	52539763	76104388	Rat
1298072	Cia26	Collagen induced arthritis QTL 26	3.6		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	18	54709769	83828827	Rat
724542	Kidm2	Kidney mass QTL 2	2.6		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	18	59172115	83828827	Rat
2312600	Bp341	Blood pressure QTL 341		0.05	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	18	59330409	70263868	Rat
2301969	Bp324	Blood pressure QTL 324	4.05		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	18	59712417	76477814	Rat
70185	BpQTLcluster15	Blood pressure QTL cluster 15	4.61		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	18	59712417	76477814	Rat
70185	BpQTLcluster15	Blood pressure QTL cluster 15	4.61		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	59712417	76477814	Rat
70185	BpQTLcluster15	Blood pressure QTL cluster 15	4.61		arterial blood pressure trait (VT:2000000)	absolute change in mean arterial blood pressure (CMO:0000533)	18	59712417	76477814	Rat
70185	BpQTLcluster15	Blood pressure QTL cluster 15	4.61		arterial blood pressure trait (VT:2000000)	absolute change in systolic blood pressure (CMO:0000607)	18	59712417	76477814	Rat
1331770	Bp234	Blood pressure QTL 234	3.807		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	59796478	71893566	Rat
6903353	Bp353	Blood pressure QTL 353	2.8		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	18	59796478	83828827	Rat
6903356	Bp354	Blood pressure QTL 354	4.6		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	59796478	83828827	Rat
61384	Bp48	Blood pressure QTL 48	19.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	18	60622311	77209844	Rat
631675	Iddm15	Insulin dependent diabetes mellitus QTL 15			urine glucose amount (VT:0001758)	percentage of study population developing diabetes mellitus during a period of time (CMO:0001114)	18	60622311	77209844	Rat

Markers in Region

D18Mco7

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	18	68,361,937 - 68,362,093 (+)	MAPPER	mRatBN7.2
Rnor_6.0	18	70,751,072 - 70,751,227	NCBI	Rnor6.0
Rnor_5.0	18	69,890,284 - 69,890,439	UniSTS	Rnor5.0
RGSC_v3.4	18	71,603,978 - 71,604,134	RGD	RGSC3.4
RGSC_v3.4	18	71,603,979 - 71,604,134	UniSTS	RGSC3.4
RGSC_v3.1	18	71,677,179 - 71,677,335	RGD
Celera	18	66,538,396 - 66,538,551	UniSTS
Cytogenetic Map	18	q12.3	UniSTS

RH129363

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	18	68,373,051 - 68,373,240 (+)	MAPPER	mRatBN7.2
Rnor_6.0	18	70,762,201 - 70,762,389	NCBI	Rnor6.0
Rnor_5.0	18	69,901,642 - 69,901,830	UniSTS	Rnor5.0
RGSC_v3.4	18	71,632,416 - 71,632,604	UniSTS	RGSC3.4
RGSC_v3.4	18	71,616,004 - 71,616,192	UniSTS	RGSC3.4
Celera	18	66,549,540 - 66,549,728	UniSTS
RH 3.4 Map	18	691.0	UniSTS
Cytogenetic Map	18	q12.3	UniSTS

RH129395

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	18	68,373,087 - 68,373,246 (+)	MAPPER	mRatBN7.2
Rnor_6.0	18	70,762,237 - 70,762,395	NCBI	Rnor6.0
Rnor_5.0	18	69,901,678 - 69,901,836	UniSTS	Rnor5.0
RGSC_v3.4	18	71,632,452 - 71,632,610	UniSTS	RGSC3.4
RGSC_v3.4	18	71,616,040 - 71,616,198	UniSTS	RGSC3.4
Celera	18	66,549,576 - 66,549,734	UniSTS
RH 3.4 Map	18	688.0	UniSTS
Cytogenetic Map	18	q12.3	UniSTS

RH129515

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	18	68,372,955 - 68,373,164 (+)	MAPPER	mRatBN7.2
Rnor_6.0	18	70,762,105 - 70,762,313	NCBI	Rnor6.0
Rnor_5.0	18	69,901,546 - 69,901,754	UniSTS	Rnor5.0
RGSC_v3.4	18	71,632,320 - 71,632,528	UniSTS	RGSC3.4
RGSC_v3.4	18	71,615,908 - 71,616,116	UniSTS	RGSC3.4
Celera	18	66,549,444 - 66,549,652	UniSTS
RH 3.4 Map	18	689.2	UniSTS
Cytogenetic Map	18	q12.3	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High			2	2		2
Medium	3	43	55	39	19	39	8	11	74	35	41	11	8
Low
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_130433	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC135265	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474095	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ209815	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ215874	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ216726	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ228855	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000301	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X05341	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000067018 ⟹ ENSRNOP00000060140

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	18	68,345,012 - 68,373,249 (+)	Ensembl
Rnor_6.0 Ensembl	18	70,733,872 - 70,762,395 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000085601 ⟹ ENSRNOP00000073665

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	18	68,350,357 - 68,373,249 (+)	Ensembl
Rnor_6.0 Ensembl	18	70,739,492 - 70,762,134 (+)	Ensembl

RefSeq Acc Id:

NM_130433 ⟹ NP_569117

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	18	68,345,136 - 68,373,246 (+)	NCBI
Rnor_6.0	18	70,733,872 - 70,762,395 (+)	NCBI
Rnor_5.0	18	69,873,084 - 69,901,836 (+)	NCBI
RGSC_v3.4	18	71,587,259 - 71,632,610 (+)	RGD
Celera	18	66,521,595 - 66,549,734 (+)	RGD

Sequence:

show sequence

TAACCTTGGCCCCGGCGGCGCGGGGGGGGGGGGGGGCAGGGATGGAAAAGTAGGGGAAAGGGCA
GGGGCGCGGCCTCTCGGGGCGCCGCCACACTATTAAGGCTGGGCTAGGGCTGGTGGCCGAGTGA
AGCTGTGAGAGACCCGTGGAATAACTGAGCTTCGTCATGGCGCTGCTACGAGGTGTGTTTATCG
TTGCTGCGAAGCGAACACCCTTTGGAGCTTATGGGGGTCTTCTCAAGGACTTCACTGCCACTGA
CTTAACTGAATTTGCTGCCAGGGCTGCCCTGTCTGCTGGCAAAGTTCCACCGGAAACCATCGAT
AGTGTCATCGTGGGCAATGTCATGCAGAGCTCTTCAGATGCGGCGTACCTGGCAAGGCATGTGG
GTTTACGTGTGGGAGTCCCGACGGAGACTGGGGCCCTCACCCTCAACAGACTCTGTGGCTCTGG
TTTCCAGTCCATCGTGAGCGGATGTCAGGAAATCTGCTCGAAAGACGCTGAGGTCGTCTTATGT
GGAGGAACCGAGAGCATGAGCCAGTCCCCCTACTCTGTCAGAAATGTGCGCTTCGGAACCAAAT
TTGGGTTAGATCTCAAGCTGGAAGATACTTTGTGGGCAGGATTAACGGATCAACACGTGAAGCT
CCCCATGGGGATGACTGCAGAGAACCTGGCTGCAAAATACAACATAAGCAGAGAAGACTGCGAC
AGATACGCCCTGCAGTCCCAGCAGAGGTGGAAAGCCGCTAACGAGGCTGGCTACTTTAATGAGG
AGATGGCCCCCATTGAGGTGAAGACCAAGAAGGGCAAACAGACCATGCAAGTGGATGAGCACGC
CCGGCCCCAAACGACCCTGGAGCAGCTGCAGAACCTCCCGCCAGTGTTCAAGAAAGAGGGGACG
GTCACAGCAGGGAACGCCTCGGGCATGTCTGACGGTGCTGGGGTCGTCATCATAGCCAGCGAAG
ATGCTGTCAAAAAACATAACTTCACACCACTGGCCAGAGTCGTGGGCTACTTTGTGTCTGGATG
TGACCCTGCTATCATGGGGATCGGTCCAGTCCCTGCCATCACTGGAGCATTGAAGAAAGCTGGG
CTGAGCCTTAAGGACATGGATTTGATAGACGTGAATGAAGCATTTGCTCCTCAGTTCTTGGCTG
TTCAGAAGAGCTTGGATCTCGACCCCAGTAAAACCAACGTGAGTGGAGGTGCCATAGCCCTGGG
TCACCCGCTGGGAGGATCTGGATCCAGAATCACCGCACACCTGGTTCACGAGTTAAGGCGTCGA
GGTGGAAAATACGCAGTGGGATCAGCTTGCATTGGAGGTGGCCAAGGCATCTCCCTGATCATCC
AGAACACAGCCTGAAGGGATTGCAAGCATCCTACCCACCCTCACTTGGCCAGGCTACGGAACAC
AGGCGACCTTTGAGTCAGCCCTGCTGTGACAGTAAATGCATTTGACCAAGCCTTGATGGGTTCT
GTCTACTTCATACCTGCCTAGCGTGTTAGAATAAAAAGACCAGCCATCAGAGGCCTTTAGAGAT
ACCTACTGGTGTCATTGTCAGCAGCCACCACTGTATGCCTTACATGGTGAAATTACAAACTGAA
TAAATGTTGCCTTAACTCC

hide sequence

Protein Sequences


Protein RefSeqs	NP_569117	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	CAA28952	(Get FASTA)	NCBI Sequence Viewer
	EDL82875	(Get FASTA)	NCBI Sequence Viewer
	EDL82876	(Get FASTA)	NCBI Sequence Viewer
	EDL82877	(Get FASTA)	NCBI Sequence Viewer
	EDL82878	(Get FASTA)	NCBI Sequence Viewer
	EDL82879	(Get FASTA)	NCBI Sequence Viewer
	EDL82880	(Get FASTA)	NCBI Sequence Viewer
	EDL82881	(Get FASTA)	NCBI Sequence Viewer
	EDL82882	(Get FASTA)	NCBI Sequence Viewer
	EDL82883	(Get FASTA)	NCBI Sequence Viewer
	EDL82884	(Get FASTA)	NCBI Sequence Viewer
	EDL82885	(Get FASTA)	NCBI Sequence Viewer
	P13437	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_569117 ⟸ NM_130433

- UniProtKB:

P13437 (UniProtKB/Swiss-Prot), G3V9U2 (UniProtKB/TrEMBL), A6KRG3 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MALLRGVFIVAAKRTPFGAYGGLLKDFTATDLTEFAARAALSAGKVPPETIDSVIVGNVMQSSS
DAAYLARHVGLRVGVPTETGALTLNRLCGSGFQSIVSGCQEICSKDAEVVLCGGTESMSQSPYS
VRNVRFGTKFGLDLKLEDTLWAGLTDQHVKLPMGMTAENLAAKYNISREDCDRYALQSQQRWKA
ANEAGYFNEEMAPIEVKTKKGKQTMQVDEHARPQTTLEQLQNLPPVFKKEGTVTAGNASGMSDG
AGVVIIASEDAVKKHNFTPLARVVGYFVSGCDPAIMGIGPVPAITGALKKAGLSLKDMDLIDVN
EAFAPQFLAVQKSLDLDPSKTNVSGGAIALGHPLGGSGSRITAHLVHELRRRGGKYAVGSACIG
GGQGISLIIQNTA

hide sequence

RefSeq Acc Id:

ENSRNOP00000060140 ⟸ ENSRNOT00000067018

RefSeq Acc Id:

ENSRNOP00000073665 ⟸ ENSRNOT00000085601

Protein Domains

Thiolase C-terminal Thiolase N-terminal

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P13437-F1-model_v2	AlphaFold	P13437	1-397	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:620482	AgrOrtholog
BioCyc Gene	G2FUF-7008	BioCyc
BioCyc Pathway	FAO-PWY [fatty acid beta-oxidation I (generic)]	BioCyc
	PWY-7948 [4-oxopentanoate degradation]	BioCyc
	PWY-8181 [2-methyl-branched fatty acid beta-oxidation]	BioCyc
	PWY-8182 [valproate beta-oxidation]	BioCyc
	PWY66-391 [fatty acid beta-oxidation VI (mammalian peroxisome)]	BioCyc
Ensembl Genes	ENSRNOG00000013766	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000060140	ENTREZGENE
	ENSRNOP00000060140.3	UniProtKB/TrEMBL
	ENSRNOP00000073665.2	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000067018	ENTREZGENE
	ENSRNOT00000067018.4	UniProtKB/TrEMBL
	ENSRNOT00000085601.2	UniProtKB/TrEMBL
Gene3D-CATH	3.40.47.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	Thiolase	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Thiolase-like	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Thiolase_acyl_enz_int_AS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Thiolase_AS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Thiolase_C	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Thiolase_CS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Thiolase_N	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:170465	UniProtKB/Swiss-Prot
NCBI Gene	170465	ENTREZGENE
PANTHER	3-KETOACYL-COA THIOLASE, MITOCHONDRIAL	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ACETYL-COA C-ACYLTRANSFERASE	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Thiolase_C	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Thiolase_N	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Acaa2	PhenoGen
PIRSF	Ac-CoA_Ac_transf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	THIOLASE_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	THIOLASE_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	THIOLASE_3	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF53901	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A0G2K642_RAT	UniProtKB/TrEMBL
	A6KRG0_RAT	UniProtKB/TrEMBL
	A6KRG2_RAT	UniProtKB/TrEMBL
	A6KRG3	ENTREZGENE, UniProtKB/TrEMBL
	A6KRG4_RAT	UniProtKB/TrEMBL
	A6KRG5_RAT	UniProtKB/TrEMBL
	A6KRG6_RAT	UniProtKB/TrEMBL
	A6KRG7_RAT	UniProtKB/TrEMBL
	A6KRG8_RAT	UniProtKB/TrEMBL
	A6KRG9_RAT	UniProtKB/TrEMBL
	A6KRH0_RAT	UniProtKB/TrEMBL
	G3V9U2	ENTREZGENE, UniProtKB/TrEMBL
	P13437	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2011-07-28	Acaa2	acetyl-CoA acyltransferase 2	Acaa2	acetyl-Coenzyme A acyltransferase 2	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-08-29	Acaa2	acetyl-Coenzyme A acyltransferase 2	Acaa2	acetyl-Coenzyme A acyltransferase 2 (mitochondrial 3-oxoacyl-Coenzyme A thiolase)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-09-10	Acaa2	acetyl-Coenzyme A acyltransferase 2 (mitochondrial 3-oxoacyl-Coenzyme A thiolase)			Symbol and Name status set to approved	1299863	APPROVED
2002-08-07	Acaa2	acetyl-Coenzyme A acyltransferase 2 (mitochondrial 3-oxoacyl-Coenzyme A thiolase)			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_homology	has 37% identity with peroxisomal 3-oxoacyl-CoA thiolase	632025
gene_protein	397 amino acids	632025

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

RGD Manual Annotations

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

RGD Manual Annotations

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)