Amph (amphiphysin) - Rat Genome Database

Name: Amph
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes Projects (beta) QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Amph (amphiphysin) Rattus norvegicus

Analyze

Symbol:

Amph (Ensembl: LOC100910792)

Name:

amphiphysin (Ensembl:amphiphysin-like)

RGD ID:

620274

Description:

Enables phosphatase binding activity. Involved in positive regulation of endocytosis. Located in axon terminus. Is extrinsic component of synaptic vesicle membrane. Orthologous to human AMPH (amphiphysin); PARTICIPATES IN Fc gamma receptor mediated signaling pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 3,3',4,4',5-pentachlorobiphenyl; ammonium chloride.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

Amph1; amphiphysin 1; amphiphysin-like; LOC100909679; LOC687233; similar to amphiphysin 1; uncharacterized protein LOC100909679

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	AMPH (amphiphysin)	RGD	RGD
Mus musculus (house mouse):	Amph (amphiphysin)	RGD	RGD
Chinchilla lanigera (long-tailed chinchilla):	Amph (amphiphysin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	LOC100995139 (amphiphysin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	AMPH (amphiphysin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Amph (amphiphysin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	AMPH (amphiphysin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Amph (amphiphysin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	AMPH (amphiphysin)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Amph (amphiphysin)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	amph (amphiphysin)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Amph	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	amph-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	17	45,739,385 - 45,982,905 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	17	45,739,395 - 45,983,315 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	17	48,180,900 - 48,690,815 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	17	52,949,166 - 53,178,746 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	17	47,057,349 - 47,292,588 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	17	48,304,324 - 48,562,838 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	17	48,304,322 - 48,562,905 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	17	46,357,604 - 46,621,763 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	17	53,558,804 - 53,802,936	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	17	53,561,655 - 53,805,777	NCBI
Cytogenetic Map	17	q11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

COVID-19 (ISO)

genetic disease (ISO)

pleomorphic xanthoastrocytoma (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dichloroethane (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

3,3',4,4',5-pentachlorobiphenyl (EXP)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4-hydroxynon-2-enal (ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

ammonium chloride (EXP)

antirheumatic drug (ISO)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

Bisphenol B (ISO)

butanal (ISO)

cadmium dichloride (EXP)

carbon nanotube (ISO)

CGP 52608 (ISO)

cyclosporin A (ISO)

dexamethasone (ISO)

dichlorine (EXP)

dorsomorphin (ISO)

endosulfan (EXP)

ethanol (ISO)

folic acid (ISO)

fonofos (ISO)

genistein (EXP)

glyphosate (EXP)

heroin (ISO)

hydrogen peroxide (ISO)

indometacin (ISO)

ivermectin (ISO)

methoxychlor (EXP)

methylmercury chloride (ISO)

ozone (EXP)

paracetamol (ISO)

paraquat (EXP)

parathion (ISO)

PCB138 (EXP)

perfluorononanoic acid (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (ISO)

phenylmercury acetate (ISO)

pirinixic acid (ISO)

pregnenolone 16alpha-carbonitrile (EXP)

progesterone (ISO)

propanal (ISO)

SB 431542 (ISO)

terbufos (ISO)

tert-butyl hydroperoxide (ISO)

testosterone (ISO)

tetrachloromethane (EXP)

trichostatin A (ISO)

triclosan (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

learning (ISO)

positive regulation of endocytosis (IMP)

positive regulation of GTPase activity (IDA)

synaptic vesicle endocytosis (IBA,ISO)

Cellular Component

axon terminus (IDA)

cytoplasm (IEA)

cytoskeleton (IEA)

extrinsic component of synaptic vesicle membrane (IDA)

glutamatergic synapse (ISO)

leading edge membrane (IEA,ISO)

photoreceptor ribbon synapse (ISO)

plasma membrane (IBA)

presynapse (ISO)

presynaptic endocytic zone (ISO)

synapse (IEA,ISO)

synaptic vesicle (IBA,ISO)

terminal bouton (HDA)

Molecular Function

phosphatase binding (IPI)

phospholipid binding (IBA,IEA,ISO)

protein binding (IPI,ISO)

protein-containing complex binding (IPI)

Molecular Pathway Annotations Click to see Annotation Detail View

Fc gamma receptor mediated signaling pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Syndapin I and endophilin I bind overlapping proline-rich regions of dynamin I: role in synaptic vesicle endocytosis.	Anggono V and Robinson PJ, J Neurochem. 2007 Aug;102(3):931-43. Epub 2007 Apr 16.
2.	Dynamin is a minibrain kinase/dual specificity Yak1-related kinase 1A substrate.	Chen-Hwang MC, etal., J Biol Chem 2002 May 17;277(20):17597-604.
3.	Decreased synaptic vesicle recycling efficiency and cognitive deficits in amphiphysin 1 knockout mice.	Di Paolo G, etal., Neuron 2002 Feb 28;33(5):789-804.
4.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
5.	The calcineurin-binding protein cain is a negative regulator of synaptic vesicle endocytosis.	Lai MM, etal., J Biol Chem. 2000 Nov 3;275(44):34017-20.
6.	Amphiphysin, a novel protein associated with synaptic vesicles.	Lichte B, etal., EMBO J. 1992 Jul;11(7):2521-30.
7.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
8.	Synaptojanin forms two separate complexes in the nerve terminal. Interactions with endophilin and amphiphysin.	Micheva KD, etal., J Biol Chem. 1997 Oct 24;272(43):27239-45. doi: 10.1074/jbc.272.43.27239.
9.	Dynamin 2 cooperates with amphiphysin 1 in phagocytosis in sertoli cells.	Nakanishi A, etal., Acta Med Okayama. 2008 Dec;62(6):385-91.
10.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
11.	Identification and characterization of a synaptojanin 2 splice isoform predominantly expressed in nerve terminals.	Nemoto Y, etal., J Biol Chem 2001 Nov 2;276(44):41133-42.
12.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
13.	GOA pipeline	RGD automated data pipeline
14.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
15.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
16.	The NECAP PHear domain increases clathrin accessory protein binding potential.	Ritter B, etal., EMBO J. 2007 Sep 19;26(18):4066-77. Epub 2007 Aug 30.
17.	NECAP 1 regulates AP-2 interactions to control vesicle size, number, and cargo during clathrin-mediated endocytosis.	Ritter B, etal., PLoS Biol. 2013 Oct;11(10):e1001670. doi: 10.1371/journal.pbio.1001670. Epub 2013 Oct 1.
18.	The epsins define a family of proteins that interact with components of the clathrin coat and contain a new protein module.	Rosenthal JA, etal., J Biol Chem 1999 Nov 26;274(48):33959-65.
19.	TTP specifically regulates the internalization of the transferrin receptor.	Tosoni D, etal., Cell. 2005 Dec 2;123(5):875-88.
20.	Crystal structure of the alpha appendage of AP-2 reveals a recruitment platform for clathrin-coat assembly.	Traub LM, etal., Proc Natl Acad Sci U S A. 1999 Aug 3;96(16):8907-12.
21.	Amphiphysin heterodimers: potential role in clathrin-mediated endocytosis.	Wigge P, etal., Mol Biol Cell 1997 Oct;8(10):2003-15.
22.	Composition of isolated synaptic boutons reveals the amounts of vesicle trafficking proteins.	Wilhelm BG, etal., Science. 2014 May 30;344(6187):1023-8. doi: 10.1126/science.1252884.
23.	A single PXXP motif in the C-terminal region of srGAP3 mediates binding to multiple SH3 domains.	Wuertenberger S and Groemping Y, FEBS Lett. 2015 Apr 28;589(10):1156-63. doi: 10.1016/j.febslet.2015.03.014. Epub 2015 Mar 24.
24.	Expression of the endocytic proteins dynamin and amphiphysin in rat gastric enterochromaffin-like cells.	Zanner R, etal., J Cell Sci. 2004 May 1;117(Pt 11):2369-76.

Additional References at PubMed

PMID:8552632	PMID:9195986	PMID:9259551	PMID:9694653	PMID:11382783	PMID:15090044	PMID:15207364	PMID:15262992	PMID:15821731	PMID:15953416	PMID:16903783	PMID:17855509
PMID:18344231	PMID:19144635	PMID:19759398	PMID:21700703	PMID:22750946	PMID:22871113	PMID:23785143	PMID:28235806	PMID:29476059

Genomics

Comparative Map Data

Amph
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	17	45,739,385 - 45,982,905 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	17	45,739,395 - 45,983,315 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	17	48,180,900 - 48,690,815 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	17	52,949,166 - 53,178,746 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	17	47,057,349 - 47,292,588 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	17	48,304,324 - 48,562,838 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	17	48,304,322 - 48,562,905 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	17	46,357,604 - 46,621,763 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	17	53,558,804 - 53,802,936	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	17	53,561,655 - 53,805,777	NCBI
Cytogenetic Map	17	q11	NCBI

AMPH
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	7	38,383,704 - 38,631,373 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	7	38,383,704 - 38,631,420 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	7	38,423,305 - 38,670,973 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	7	38,389,830 - 38,637,545 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	7	38,196,545 - 38,444,260	NCBI
Celera	7	38,411,134 - 38,658,846 (-)	NCBI		Celera
Cytogenetic Map	7	p14.1	NCBI
HuRef	7	38,307,292 - 38,555,371 (-)	NCBI		HuRef
CHM1_1	7	38,425,940 - 38,673,786 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	7	38,540,588 - 38,788,026 (-)	NCBI		T2T-CHM13v2.0
CRA_TCAGchr7v2	7	38,460,969 - 38,708,834 (-)	NCBI

Amph
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	13	19,132,325 - 19,338,202 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	13	19,132,375 - 19,335,091 (+)	Ensembl		GRCm39 Ensembl
GRCm38	13	18,948,142 - 19,154,032 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	13	18,948,205 - 19,150,921 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	13	19,040,240 - 19,242,784 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	13	18,955,836 - 19,158,380 (+)	NCBI		MGSCv36	mm8
Celera	13	19,259,525 - 19,457,406 (+)	NCBI		Celera
Cytogenetic Map	13	A2	NCBI
cM Map	13	6.89	NCBI

Amph
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955460	4,804,442 - 5,023,202 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955460	4,804,400 - 5,024,312 (+)	NCBI	ChiLan1.0	ChiLan1.0

LOC100995139
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	7	91,539,581 - 91,785,970 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	7	39,015,699 - 39,262,120 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	7	39,250,081 - 39,495,844 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	7	39,250,081 - 39,495,844 (-)	Ensembl	panpan1.1		panPan2

AMPH
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	18	11,132,078 - 11,261,847 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	18	11,143,446 - 11,260,841 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	18	10,903,625 - 11,114,792 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	18	11,099,548 - 11,310,938 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	18	11,098,056 - 11,309,936 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	18	11,076,355 - 11,287,485 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	18	11,044,639 - 11,263,972 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	18	11,160,063 - 11,371,410 (+)	NCBI		UU_Cfam_GSD_1.0

Amph
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	94,747,942 - 94,972,174 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936478	13,960,771 - 14,183,764 (-)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936478	13,959,669 - 14,183,835 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

AMPH
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	9	108,799,793 - 108,971,660 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	9	108,800,718 - 108,971,575 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	9	119,651,630 - 119,751,221 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

Amph
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624740	22,399,244 - 22,614,608 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624740	22,399,302 - 22,615,736 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Amph
3522 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	81
Count of miRNA genes:	78
Interacting mature miRNAs:	81
Transcripts:	ENSRNOT00000017102
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1354658	Spl8	Serum phospholipid level QTL 8	3.8		blood VLDL phospholipid amount (VT:0010507)	blood very low density lipoprotein phospholipid level (CMO:0001571)	17	1	60781592	Rat
1354581	Bp247	Blood pressure QTL 247	4.5		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	17	1	69599340	Rat
1354662	Rf49	Renal function QTL 49	2.9		blood creatinine amount (VT:0005328)	plasma creatinine level (CMO:0000537)	17	1	69599340	Rat
1354596	Bw32	Body weight QTL 32	4.5		body mass (VT:0001259)	body weight (CMO:0000012)	17	4299130	60781592	Rat
1354630	Cm34	Cardiac mass QTL 34	8.7		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	17	4299130	69599340	Rat
1354638	Insul1	Insulin level QTL 1	4.8		blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	17	4299130	69599340	Rat
1354651	Lmblg2	Limb length QTL 2	6		tibia length (VT:0004357)	tibia length (CMO:0000450)	17	4299130	69599340	Rat
2303627	Vencon8	Ventilatory control QTL 8		0.001	respiration trait (VT:0001943)	tidal volume (CMO:0000222)	17	4528038	49528038	Rat
10054088	Scort28	Serum corticosterone level QTL 28	2.04	0.0102	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	17	4528038	49528038	Rat
2303561	Bw91	Body weight QTL 91	2		body mass (VT:0001259)	body weight (CMO:0000012)	17	8868462	53868462	Rat
1331765	Hrtrt15	Heart rate QTL 15	4.094		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	17	15330613	55836425	Rat
1354640	Scl32	Serum cholesterol level QTL 32	5.4		blood HDL cholesterol amount (VT:0000184)	blood high density lipoprotein cholesterol level (CMO:0000052)	17	15781592	60781592	Rat
1354659	Scl68	Serum cholesterol level QTL 68	3.9		blood VLDL cholesterol amount (VT:0005144)	blood very low density lipoprotein cholesterol level (CMO:0000648)	17	15781592	60781592	Rat
7394837	Memor18	Memory QTL 18			exploratory behavior trait (VT:0010471)	measurement of voluntary locomotion into, out of or within a discrete space in an experimental apparatus (CMO:0000957)	17	18640182	63640182	Rat
1354628	Stl13	Serum triglyceride level QTL 13	3.8		blood triglyceride amount (VT:0002644)	blood triglyceride level (CMO:0000118)	17	21293039	60781592	Rat
70157	Niddm32	Non-insulin dependent diabetes mellitus QTL 32	4.34		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	17	22454924	50909196	Rat
61394	Bp8	Blood pressure QTL 8	2.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	17	23080567	59555013	Rat
7488966	Bp370	Blood pressure QTL 370		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	23653184	57246843	Rat
12903978	Cm118	Cardiac mass QTL 118		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	17	23653184	68653184	Rat
12903979	Cm119	Cardiac mass QTL 119		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	17	23653184	68653184	Rat
12903980	Cm120	Cardiac mass QTL 120		0.002	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	17	23653184	68653184	Rat
12903981	Am17	Aortic mass QTL 17		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	17	23653184	68653184	Rat
1559055	Bp278	Blood pressure QTL 278		0.04	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	23653184	68653184	Rat
12903982	Kidm70	Kidney mass QTL 70		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	17	23653184	70974005	Rat
1354619	Bp242	Blood pressure QTL 242	6.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	17	24599340	69599340	Rat
1581512	Cm55	Cardiac mass QTL 55	2.8	0.05	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	17	27027949	56836890	Rat
4889955	Bss93	Bone structure and strength QTL 93	4.4		tibia size trait (VT:0100001)	tibia cortical bone volume to tibia total bone volume ratio (CMO:0001727)	17	27027949	60463643	Rat
2302377	Scl61	Serum cholesterol level QTL 61	4.36		blood HDL cholesterol amount (VT:0000184)	serum high density lipoprotein cholesterol level (CMO:0000361)	17	27389946	53481766	Rat
8552928	Pigfal9	Plasma insulin-like growth factor 1 level QTL 9	9		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	17	28409147	73409147	Rat
9590107	Sffal7	Serum free fatty acids level QTL 7	4.81	0.001	blood free fatty acid amount (VT:0001553)	plasma free fatty acids level (CMO:0000546)	17	28409147	73409147	Rat
10450503	Bp386	Blood pressure QTL 386		0.28	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	31368391	62109574	Rat
2324621	Coatc5	Coat color QTL 5			coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	17	31368391	73951021	Rat
2313854	Bp343	Blood pressure QTL 343	3.9		life span trait (VT:0005372)	age at time of death (CMO:0001193)	17	31990784	50909196	Rat
724549	Niddm56	Non-insulin dependent diabetes mellitus QTL 56		0.03	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	17	31990784	76990784	Rat
1354663	Bvd5	Brain ventricular dilatation QTL 5	3.51	0.001	brain ventricle morphology trait (VT:0000822)	hydrocephalus severity score (CMO:0001881)	17	31990784	81292925	Rat
1300148	Bp192	Blood pressure QTL 192	3.47		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	17	34550843	73951021	Rat
724528	Uae4	Urinary albumin excretion QTL 4	4.9	0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	17	35837085	69599340	Rat
2301412	Kidm40	Kidney mass QTL 40		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	17	37479847	82479847	Rat
2317054	Aia12	Adjuvant induced arthritis QTL 12	4.24		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	17	38281509	83281509	Rat
2317060	Aia26	Adjuvant induced arthritis QTL 26	3.22		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	17	38281509	83281509	Rat
1598871	Memor5	Memory QTL 5	5.3		exploratory behavior trait (VT:0010471)	total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443)	17	40540041	80387013	Rat
1358295	Aocep1	Aortic cell protein QTL 1	6.1	0.00000071	thoracic aorta cellular protein amount (VT:0010598)	aortic cell percentage	17	40990005	85990005	Rat
631497	Bp98	Blood pressure QTL 98	3.66		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	17	41354651	60463643	Rat
1354635	Bp245	Blood pressure QTL 245	6		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	17	42073160	69599340	Rat
1354635	Bp245	Blood pressure QTL 245	6		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	42073160	69599340	Rat

Markers in Region

RH131007

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	8	63,318,169 - 63,318,360 (+)	MAPPER	mRatBN7.2
mRatBN7.2	17	45,886,101 - 45,886,303 (+)	MAPPER	mRatBN7.2
Rnor_6.0	17	48,455,564 - 48,455,765	NCBI	Rnor6.0
Rnor_6.0	8	67,747,980 - 67,748,170	NCBI	Rnor6.0
Rnor_5.0	17	46,508,844 - 46,509,045	UniSTS	Rnor5.0
Rnor_5.0	8	67,476,727 - 67,476,917	UniSTS	Rnor5.0
RGSC_v3.4	8	67,001,823 - 67,002,013	UniSTS	RGSC3.4
RGSC_v3.4	17	53,705,754 - 53,705,955	UniSTS	RGSC3.4
Celera	17	41,984,143 - 41,984,344	UniSTS
Celera	8	62,733,083 - 62,733,273	UniSTS
Cytogenetic Map	17	q11	UniSTS
Cytogenetic Map	8	q24	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium								15
Low	2	8		6				57	26	25	11
Below cutoff	41	13	7	10	7	8	9	2	9	16		8

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_022217	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039096040	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039096041	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039096042	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	JACYVU010000293	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	Y13381	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000017102 ⟹ ENSRNOP00000017102

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	17	45,739,395 - 45,983,315 (-)	Ensembl
Rnor_6.0 Ensembl	17	48,304,322 - 48,562,838 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000080800 ⟹ ENSRNOP00000073615

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	17	45,739,395 - 45,982,989 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000084702 ⟹ ENSRNOP00000070116

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	17	45,739,395 - 45,983,315 (-)	Ensembl
Rnor_6.0 Ensembl	17	48,304,329 - 48,562,905 (-)	Ensembl

RefSeq Acc Id:

NM_022217 ⟹ NP_071553

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	17	45,739,385 - 45,982,883 (-)	NCBI
Rnor_6.0	17	48,304,324 - 48,562,838 (-)	NCBI
Rnor_5.0	17	46,357,604 - 46,621,763 (-)	NCBI
RGSC_v3.4	17	53,558,804 - 53,802,936 (-)	RGD

Sequence:

show sequence

ATGGCCGACATCAAGACGGGCATCTTCGCCAAAAACGTGCAAAAGCGGCTCAACCGGGCACAGG
AAAAGGTCCTCCAGAAGCTGGGAAAGGCAGATGAAACAAAAGATGAACAGTTTGAAGAATATGT
TCAGAACTTCAAGCGGCAAGAGGCAGAGGGTACCAGACTTCAGCGAGAACTGCGAGGATATTTA
GCGGCAATCAAAGGTATGCAGGAGGCCTCAATGAAGCTTACCGAGTCACTACATGAAGTCTACG
AGCCAGATTGGTATGGACGGGAAGATGTAAAGATGGTTGGTGAGAAGTGTGATGTGCTGTGGGA
AGACTTCCATCAAAAGCTAGTGGATGGGTCCTTGCTGACACTGGACACGTACCTGGGCCAGTTT
CCTGACATAAAGAATCGCATCGCTAAGCGCAGCAGGAAGCTCGTGGATTACGACAGTGCCCGCC
ATCACCTGGAGGCTCTGCAGAGTTCCAAAAGGAAGGATGAGAGTCGGATCTCTAAGGCAGAAGA
GGAGTTTCAGAAAGCACAGAAAGTGTTTGAAGAGTTCAATGTTGACTTACAAGAAGAATTGCCA
TCACTATGGTCAAGACGAGTTGGGTTTTATGTCAATACTTTCAAAAACGTCTCTAGCCTTGAGG
CCAAGTTTCACAAGGAAATCGCAGTGCTTTGCCACAAGCTTTATGAAGTGATGACGAAACTTGG
TGATCAGCACGCTGACAAGGCCTTCAGCATTCAAGGAGCTCCCAGTGATTCGGGTCCTCTTCGC
ATTGCAAAGACACCATCACCCCCAGAGGAGGCTTCACCCCTCCCCAGCCCAACGGCTAGTCCCA
ACCACACATTAGCACCTGCATCTCCTGCCCCAGTGCGACCCAGATCACCTTCACAGACAAGGAA
AGGGCCTCCTGTCCCACCTCTGCCTAAAGTCACCCCAACAAAGGAACTACAGCAGGAGAACATC
ATCAATTTCTTTGAGGACAACTTTGTACCAGAAATCAATGTGACAACACCTTCCCAGAATGAAG
TCCTGGAGGTGAAGAAGGAGGAGACTTTGCTGGATTTGGACTTTGACCCTTTCAAACCTGATGT
GACCCCAGCAGGTTCTGCTGCAGCGACCCACTCACCCATGTCTCAGACATTGCCCTGGGACTTA
TGGACGACAAGCACTGATTTGGTACAACCGGCTTCTGGAGGTTCGTTTAATGATTTTACCCAGC
CCCAGGATACTTCATTATTCACGATGCAGACAGATCAGAATATGGCTGAAACTGAGCAGGCTCT
ACCTACAGAGCCCCAGGCAGAGGAGCCTCCCACCACTGCTGCTGCACCTACTGCTGGGCTGGAC
CTTGGGCTAGAGATGGAGGAGCCAAAGGAGGAGGCAGCGATCCCTCCTGGAACTGATGCTGGTG
AGACTGTGGGAACTGAGGGGTCCACAGGGGAGGAAGCAGAGGCAGAGAAGGCAGCCCTACCTGC
TGGAGAAGGCGAAAGTCCTGAGGGAGCCAAAATCGATGTGGAAAGCACTGAGCTTGCAAGCAGT
GAGAGCCCTCAAGCAGCAGAGCTTGAAGCTGGTGCTCCTCAGGAAAAGGTCATCCCTTCTGTTG
TCATAGAGCCAGCCTCCAACCATGAAGGAGAAGAACACCAAGAAACCACTACGGGTACTGAAAC
AAGGGAGGCCACTGAGGACGTGGCTCCCCAGGGCCCAGCCGGTGAGAAGCAGGAACTGGCTACA
GAGCCCACGCCTCTGGATTCTCAGGCTGCTACGCCTGCACCAGCAGGTGCTGTGGATGCTTCGC
TGTCTGCAGGGGATGCCGCTCAGGAACTGCCTCCTGGCTTTCTCTACAAGGTGGAAACTCTGCA
TGACTTCGAGGCAGCGAACTCTGATGAACTTACCCTACAAAGGGGTGATGTGGTGCTCGTGGTG
CCCTCAGACTCAGAAGCCGACCAGGATGCAGGCTGGTTGGTGGGGGTGAAGGAGTCAGACTGGC
TTCAGTACAGAGACCTGGCCACATACAAAGGCCTCTTTCCAGAGAACTTCACACGACACCTAGA
ATAG

hide sequence

RefSeq Acc Id:

XM_039096040 ⟹ XP_038951968

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	17	45,739,385 - 45,886,191 (-)	NCBI

RefSeq Acc Id:

XM_039096041 ⟹ XP_038951969

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	17	45,739,385 - 45,982,905 (-)	NCBI

RefSeq Acc Id:

XM_039096042 ⟹ XP_038951970

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	17	45,739,385 - 45,982,867 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_071553	(Get FASTA)	NCBI Sequence Viewer
	XP_038951968	(Get FASTA)	NCBI Sequence Viewer
	XP_038951969	(Get FASTA)	NCBI Sequence Viewer
	XP_038951970	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	CAA73808	(Get FASTA)	NCBI Sequence Viewer
	O08838	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_071553 ⟸ NM_022217

- UniProtKB:

O08838 (UniProtKB/Swiss-Prot)

- Sequence:

show sequence

MADIKTGIFAKNVQKRLNRAQEKVLQKLGKADETKDEQFEEYVQNFKRQEAEGTRLQRELRGYL
AAIKGMQEASMKLTESLHEVYEPDWYGREDVKMVGEKCDVLWEDFHQKLVDGSLLTLDTYLGQF
PDIKNRIAKRSRKLVDYDSARHHLEALQSSKRKDESRISKAEEEFQKAQKVFEEFNVDLQEELP
SLWSRRVGFYVNTFKNVSSLEAKFHKEIAVLCHKLYEVMTKLGDQHADKAFSIQGAPSDSGPLR
IAKTPSPPEEASPLPSPTASPNHTLAPASPAPVRPRSPSQTRKGPPVPPLPKVTPTKELQQENI
INFFEDNFVPEINVTTPSQNEVLEVKKEETLLDLDFDPFKPDVTPAGSAAATHSPMSQTLPWDL
WTTSTDLVQPASGGSFNDFTQPQDTSLFTMQTDQNMAETEQALPTEPQAEEPPTTAAAPTAGLD
LGLEMEEPKEEAAIPPGTDAGETVGTEGSTGEEAEAEKAALPAGEGESPEGAKIDVESTELASS
ESPQAAELEAGAPQEKVIPSVVIEPASNHEGEEHQETTTGTETREATEDVAPQGPAGEKQELAT
EPTPLDSQAATPAPAGAVDASLSAGDAAQELPPGFLYKVETLHDFEAANSDELTLQRGDVVLVV
PSDSEADQDAGWLVGVKESDWLQYRDLATYKGLFPENFTRHLE

hide sequence

RefSeq Acc Id:

ENSRNOP00000070116 ⟸ ENSRNOT00000084702

RefSeq Acc Id:

ENSRNOP00000017102 ⟸ ENSRNOT00000017102

RefSeq Acc Id:	XP_038951969 ⟸ XM_039096041
- Peptide Label:	isoform X2
- UniProtKB:	O08838 (UniProtKB/Swiss-Prot)

RefSeq Acc Id:	XP_038951970 ⟸ XM_039096042
- Peptide Label:	isoform X3
- UniProtKB:	O08838 (UniProtKB/Swiss-Prot)

RefSeq Acc Id:	XP_038951968 ⟸ XM_039096040
- Peptide Label:	isoform X1
- UniProtKB:	O08838 (UniProtKB/Swiss-Prot), A0A0G2K5Z4 (UniProtKB/TrEMBL)

RefSeq Acc Id:

ENSRNOP00000073615 ⟸ ENSRNOT00000080800

Protein Domains

BAR SH3

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-A0A0G2K5Z4-F1-model_v2	AlphaFold	A0A0G2K5Z4	1-614	view protein structure
AF-O08838-F1-model_v2	AlphaFold	O08838	1-683	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:620274	AgrOrtholog
BIND	130419
	130420
	130421
	134465
	144371
BioCyc Gene	G2FUF-9132	BioCyc
Ensembl Genes	ENSRNOG00000012490	Ensembl
	ENSRNOG00000059510	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000017102	ENTREZGENE
	ENSRNOP00000017102.7	UniProtKB/TrEMBL
	ENSRNOP00000070116.2	UniProtKB/TrEMBL
	ENSRNOP00000073615	ENTREZGENE
	ENSRNOP00000073615.2	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000017102	ENTREZGENE
	ENSRNOT00000017102.7	UniProtKB/TrEMBL
	ENSRNOT00000080800	ENTREZGENE
	ENSRNOT00000080800.2	UniProtKB/TrEMBL
	ENSRNOT00000084702.2	UniProtKB/TrEMBL
Gene3D-CATH	1.20.1270.60	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SH3 Domains	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	AH/BAR_dom_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Amphiphysin	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Amphiphysin_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Amphiphysin_I_SH3	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	BAR_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SH3-like_dom_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SH3_domain	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:60668	UniProtKB/Swiss-Prot
NCBI Gene	60668	ENTREZGENE
PANTHER	AMPHIPHYSIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR46514:SF2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	BAR	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SH3_9	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Amph	PhenoGen
PRINTS	AMPHIPHYSIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	AMPHIPHYSIN1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SH3DOMAIN	UniProtKB/Swiss-Prot
PROSITE	BAR	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SH3	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
SMART	BAR	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SH3	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF103657	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SSF50044	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A0G2JX32_RAT	UniProtKB/TrEMBL
	A0A0G2K5Z4	ENTREZGENE, UniProtKB/TrEMBL
	AMPH_RAT	UniProtKB/Swiss-Prot
	F1LPP0_RAT	UniProtKB/TrEMBL
	O08838	ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2021-03-09	Amph	amphiphysin	LOC100909679	amphiphysin-like	Data Merged	737654	PROVISIONAL
2013-04-17	Amph	amphiphysin	LOC687233	similar to amphiphysin 1	Data Merged	737654	PROVISIONAL
2012-07-05	LOC100909679	amphiphysin-like			Symbol and Name status set to provisional	70820	PROVISIONAL
2008-02-22	Amph	amphiphysin	Amph1	amphiphysin 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-11-19	LOC687233	similar to amphiphysin 1			Symbol and Name status set to provisional	70820	PROVISIONAL
2005-01-20	Amph1	amphiphysin 1		amphiphysin	Symbol updated	1299863	APPROVED
2002-08-07	Amph1	amphiphysin			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_domains	contains a src homology 3 domain	631926
gene_physical_interaction	forms a heterodimer with Amph2 that activates dynamin GTPase activity	631926

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Annotations - KEGG (archival)