Advanced Search (OLGA)

Gene: Scpep1 (serine carboxypeptidase 1) Rattus norvegicus

Analyze

Symbol:

Scpep1

Name:

serine carboxypeptidase 1

RGD ID:

620067

Description:

Predicted to enable serine-type carboxypeptidase activity. Involved in retinoic acid metabolic process. Predicted to be located in extracellular region. Orthologous to human SCPEP1 (serine carboxypeptidase 1); INTERACTS WITH (+)-schisandrin B; 17beta-estradiol; 17beta-estradiol 3-benzoate.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

retinoid-inducible serine carboxypeptidase; retinoid-inducible serine caroboxypetidase; Risc

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	SCPEP1 (serine carboxypeptidase 1)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Scpep1 (serine carboxypeptidase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Scpep1 (serine carboxypeptidase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	SCPEP1 (serine carboxypeptidase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	SCPEP1 (serine carboxypeptidase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Scpep1 (serine carboxypeptidase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	SCPEP1 (serine carboxypeptidase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	SCPEP1 (serine carboxypeptidase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Scpep1 (serine carboxypeptidase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Scpep1 (serine carboxypeptidase 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	SCPEP1 (serine carboxypeptidase 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	scpep1 (serine carboxypeptidase 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG32483	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	hiro	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG31821	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG31823	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	Y32F6A.5	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	Y32F6A.5	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	scpep1	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	74,200,491 - 74,230,107 (-)	NCBI		GRCr8
GRCr8 Ensembl	10	74,200,491 - 74,230,241 (-)	Ensembl		GRCr8 Ensembl
mRatBN7.2	10	73,703,275 - 73,732,892 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	73,703,278 - 73,732,850 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	78,318,490 - 78,347,988 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	77,823,415 - 77,852,910 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	73,286,585 - 73,316,078 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	76,230,371 - 76,263,866 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	76,230,373 - 76,263,866 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	73,846,394 - 73,880,406 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	77,347,473 - 77,377,945 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	10	72,609,315 - 72,638,737 (-)	NCBI		Celera
RGSC_v3.1	10	77,361,844 - 77,392,315 (-)	NCBI
Cytogenetic Map	10	q26	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

COVID-19 (ISO)

hereditary breast ovarian cancer syndrome (ISO)

Joubert syndrome 1 (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (EXP)

17beta-estradiol 3-benzoate (EXP)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3,7,8-Tetrachlorodibenzofuran (ISO)

2-acetamidofluorene (EXP)

2-hydroxypropanoic acid (ISO)

2-methylcholine (ISO)

3,3',4,4',5-pentachlorobiphenyl (EXP)

3,4-methylenedioxymethamphetamine (EXP)

3-chloropropane-1,2-diol (EXP)

4,4'-sulfonyldiphenol (ISO)

5-aza-2'-deoxycytidine (ISO)

acetamide (EXP)

aconitine (EXP)

aflatoxin B1 (ISO)

all-trans-retinoic acid (EXP,ISO)

ammonium chloride (EXP)

antirheumatic drug (ISO)

Aroclor 1254 (ISO)

arsenous acid (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol AF (ISO)

bleomycin A2 (EXP)

bortezomib (ISO)

cadmium dichloride (EXP)

calcitriol (ISO)

carbon nanotube (ISO)

chlorpyrifos (ISO)

cisplatin (ISO)

cobalt dichloride (EXP,ISO)

diarsenic trioxide (ISO)

Dibutyl phosphate (ISO)

dorsomorphin (ISO)

doxorubicin (ISO)

endosulfan (EXP)

entinostat (ISO)

ethyl methanesulfonate (ISO)

flutamide (EXP)

folic acid (ISO)

formaldehyde (ISO)

genistein (EXP)

gentamycin (EXP)

glafenine (EXP)

glycidyl methacrylate (ISO)

indole-3-methanol (EXP)

isoprenaline (ISO)

ivermectin (ISO)

lithium chloride (ISO)

Mesaconitine (EXP)

methyl methanesulfonate (ISO)

methylmercury chloride (ISO)

N-methyl-4-phenylpyridinium (ISO)

N-nitrosodiethylamine (EXP)

nitrates (ISO)

ozone (ISO)

paracetamol (EXP,ISO)

phenobarbital (ISO)

piperonyl butoxide (EXP)

rac-lactic acid (ISO)

resveratrol (ISO)

rotenone (EXP)

SB 431542 (ISO)

Soman (EXP)

T-2 toxin (ISO)

tamoxifen (ISO)

Tesaglitazar (EXP)

testosterone (EXP,ISO)

testosterone enanthate (ISO)

tetrachloromethane (EXP,ISO)

thiram (ISO)

titanium dioxide (ISO)

trichloroethene (EXP)

trichostatin A (ISO)

triphenyl phosphate (EXP,ISO)

urethane (ISO)

valproic acid (ISO)

vorinostat (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

blood vessel diameter maintenance (ISO)

negative regulation of blood pressure (ISO)

proteolysis (IEA)

regulation of biological quality (IEA)

retinoic acid metabolic process (IEP)

Cellular Component

extracellular region (IEA)

Molecular Function

carboxypeptidase activity (IEA)

hydrolase activity (IEA)

peptidase activity (IEA)

serine-type carboxypeptidase activity (IBA,IEA,ISO,TAS)

References

References - curated

#	Reference Title	Reference Citation
1.	Cloning of a novel retinoid-inducible serine carboxypeptidase from vascular smooth muscle cells.	Chen J, etal., J Biol Chem 2001 Sep 7;276(36):34175-81.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
5.	GOA pipeline	RGD automated data pipeline
6.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
7.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:19056867	PMID:19199708	PMID:23376485	PMID:23533145	PMID:24586188

Genomics

Comparative Map Data

Scpep1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	74,200,491 - 74,230,107 (-)	NCBI		GRCr8
GRCr8 Ensembl	10	74,200,491 - 74,230,241 (-)	Ensembl		GRCr8 Ensembl
mRatBN7.2	10	73,703,275 - 73,732,892 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	73,703,278 - 73,732,850 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	78,318,490 - 78,347,988 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	77,823,415 - 77,852,910 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	73,286,585 - 73,316,078 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	76,230,371 - 76,263,866 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	76,230,373 - 76,263,866 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	73,846,394 - 73,880,406 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	77,347,473 - 77,377,945 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	10	72,609,315 - 72,638,737 (-)	NCBI		Celera
RGSC_v3.1	10	77,361,844 - 77,392,315 (-)	NCBI
Cytogenetic Map	10	q26	NCBI

SCPEP1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	17	56,978,131 - 57,006,768 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	17	56,978,129 - 57,006,768 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	17	55,055,492 - 55,084,129 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	17	52,410,467 - 52,439,128 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	17	52,410,487 - 52,439,123	NCBI
Celera	17	51,517,044 - 51,545,707 (+)	NCBI		Celera
Cytogenetic Map	17	q22	NCBI
HuRef	17	50,416,496 - 50,445,158 (+)	NCBI		HuRef
CHM1_1	17	55,120,690 - 55,149,356 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	17	57,855,772 - 57,884,410 (+)	NCBI		T2T-CHM13v2.0

Scpep1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	11	88,814,846 - 88,846,268 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	11	88,814,846 - 88,846,291 (-)	Ensembl		GRCm39 Ensembl
GRCm38	11	88,924,020 - 88,955,442 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	11	88,924,020 - 88,955,465 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	11	88,785,334 - 88,816,756 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	11	88,740,110 - 88,771,522 (-)	NCBI		MGSCv36	mm8
Celera	11	98,535,098 - 98,568,204 (-)	NCBI		Celera
Cytogenetic Map	11	C	NCBI
cM Map	11	54.34	NCBI

Scpep1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955451	5,846,552 - 5,876,851 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955451	5,847,371 - 5,876,286 (-)	NCBI	ChiLan1.0	ChiLan1.0

SCPEP1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	19	73,151,012 - 73,179,770 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	17	77,961,953 - 77,990,686 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	17	51,055,293 - 51,084,032 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	17	55,915,746 - 55,944,374 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	17	55,915,746 - 55,944,377 (+)	Ensembl	panpan1.1		panPan2

SCPEP1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	9	31,770,494 - 31,803,741 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	9	31,774,602 - 31,803,741 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	9	31,010,418 - 31,043,464 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	9	32,578,347 - 32,611,364 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	9	32,578,396 - 32,611,601 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	9	31,363,955 - 31,397,132 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	9	31,647,649 - 31,680,837 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	9	31,731,073 - 31,764,270 (+)	NCBI		UU_Cfam_GSD_1.0

Scpep1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405602	31,143,599 - 31,171,166 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936490	5,904,396 - 5,939,915 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936490	5,903,884 - 5,939,953 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

SCPEP1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	12	33,265,562 - 33,298,142 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	12	33,265,509 - 33,296,805 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	12	33,995,016 - 34,027,373 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

SCPEP1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	16	36,398,059 - 36,427,429 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	16	36,398,615 - 36,427,404 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666077	7,216,719 - 7,246,075 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Scpep1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624795	12,016,302 - 12,042,353 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624795	12,016,363 - 12,041,615 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Scpep1
117 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	333
Count of miRNA genes:	200
Interacting mature miRNAs:	227
Transcripts:	ENSRNOT00000003219
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1549846	Scl47	Serum cholesterol level QTL 47	3.6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	10	51071897	96071897	Rat
1578779	Tcas10	Tongue tumor susceptibility QTL 10	3.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	10	31796281	76796281	Rat
1298069	Bp168	Blood pressure QTL 168	5.5		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	10	27023535	98502431	Rat
8657410	Bp374	Blood pressure QTL 374			heart left ventricle size trait (VT:0002753)	heart left ventricle end-diastolic diameter (CMO:0000982)	10	67476608	107713808	Rat
152025224	Bw193	Body weight QTL 193	6.47		body mass (VT:0001259)		10	52162433	75582749	Rat
631552	Vetf2	Vascular elastic tissue fragility QTL 2	4.5	0.0002	aorta elastic tissue integrity trait (VT:0010556)	artery internal elastic lamina non-tumorous lesion count (CMO:0001913)	10	35509383	91417879	Rat
61449	Ciaa2	CIA Autoantibody QTL 2	7.1		blood autoantibody amount (VT:0003725)	calculated serum anti-type 2 collagen antibody titer (CMO:0001279)	10	63719161	107713808	Rat
631557	Bp136	Blood pressure QTL 136		0.003	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	56868440	76129113	Rat
61325	Aia5	Adjuvant induced arthritis QTL 5		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23948641	107713808	Rat
1298078	Stresp5	Stress response QTL 5	2.99	0.00025	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	42546145	107713808	Rat
1549831	Bss6	Bone structure and strength QTL 6	4		lumbar vertebra strength trait (VT:0010574)	vertebra ultimate force (CMO:0001678)	10	58073360	103073360	Rat
12903252	Cm113	Cardiac mass QTL 113		0.047	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	10	66817119	107713808	Rat
70164	Bw21	Body weight QTL 21	4.36	0.00005	body mass (VT:0001259)	body weight (CMO:0000012)	10	54296336	99451733	Rat
61463	Bp12	Blood pressure QTL 12	6.3	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	41831278	86831278	Rat
1579919	Bp281	Blood pressure QTL 281		0.01	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	50464802	95464802	Rat
2298548	Neuinf7	Neuroinflammation QTL 7	3.4		nervous system integrity trait (VT:0010566)	spinal cord RT1-B protein level (CMO:0002132)	10	64939013	107713808	Rat
8694173	Bw149	Body weight QTL 149	4.38	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	10	44939359	89939359	Rat
2300218	Hpcl2	Hepatic cholesterol level QTL 2			liver cholesterol amount (VT:0010498)	liver cholesterol level (CMO:0001597)	10	45529164	96099749	Rat
70168	Eae12	Experimental allergic encephalomyelitis QTL 12		0.0009	nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	10	73599825	107713808	Rat
70171	Cari1	Carrageenan-induced inflammation QTL 1	4.9	0.0005	hypodermis integrity trait (VT:0010550)	inflammatory exudate volume (CMO:0001429)	10	54296227	107713808	Rat
2289982	Bp303	Blood pressure QTL 303			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	73950209	76129113	Rat
2289983	Bp304	Blood pressure QTL 304			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	74076752	74616323	Rat
12903269	Am15	Aortic mass QTL 15		0.042	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	10	66817119	107713808	Rat
10450493	Bp382	Blood pressure QTL 382		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	50860288	95860288	Rat
12903266	Cm114	Cardiac mass QTL 114		0.02	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	10	66817119	107713808	Rat
61354	Pia10	Pristane induced arthritis QTL 10		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23948641	107713808	Rat
2292617	Ept18	Estrogen-induced pituitary tumorigenesis QTL 18	3.9		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	10	73950353	96620293	Rat
2301967	Cm73	Cardiac mass QTL 73	4.55		heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	10	14991535	86964295	Rat
2313103	Bss80	Bone structure and strength QTL 80	2	0.0001	tibia strength trait (VT:1000284)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	10	62556066	107556066	Rat
70188	BpQTLcluster1	Blood pressure QTL cluster 1	4.864		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	1	42823274	87823274	Rat
12880372	Am12	Aortic mass QTL 12		0.003	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	10	66817119	107713808	Rat
70193	Mcs7	Mammary carcinoma susceptibility QTL 7	2.38		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	10	72724423	107713808	Rat
2313105	Bss79	Bone structure and strength QTL 79	1.8	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	10	62556066	107556066	Rat
12880375	Kidm66	Kidney mass QTL 66		0.009	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	10	66817119	107713808	Rat
9589030	Epfw9	Epididymal fat weight QTL 9	19.24	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	10	44939359	89939359	Rat
1357344	Bp249	Blood pressure QTL 249		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	67241334	98502431	Rat
2316949	Gluco60	Glucose level QTL 60	3.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	10	14991535	107556066	Rat
12880370	Cm105	Cardiac mass QTL 105		0.008	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	10	66817119	107713808	Rat
70198	BpQTLcluster9	Blood pressure QTL cluster 9	2.94		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	42823274	87823274	Rat
12880371	Cm106	Cardiac mass QTL 106		0.007	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	10	66817119	107713808	Rat
2306970	Anxrr22	Anxiety related response QTL 22	5.95		fear/anxiety-related behavior trait (VT:1000241)	number of periods of voluntary immobility (CMO:0001045)	10	61843496	98710773	Rat
11565453	Kidm58	Kidney mass QTL 58		0.002	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	10	66817119	107713808	Rat
1359017	Hrtrt21	Heart rate QTL 21	2.4		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	10	73695339	97272278	Rat
7387312	Bw125	Body weight QTL 125	3	0.0047	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight (CMO:0000356)	10	65390777	107713808	Rat
724555	Bp150	Blood pressure QTL 150		0.0001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	73950209	78707585	Rat
724556	Pur2	Proteinuria QTL 2	5.5		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	10	22931373	91127454	Rat
2306793	Ean5	Experimental allergic neuritis QTL 5	4.7		nervous system integrity trait (VT:0010566)	IFNG-secreting splenocyte count (CMO:0002122)	10	73049656	94495280	Rat
2306792	Ean4	Experimental allergic neuritis QTL 4	4		nervous system integrity trait (VT:0010566)	IFNG-secreting splenocyte count (CMO:0002122)	10	49495492	94495492	Rat
61387	Bp1	Blood pressure QTL 1	5.1		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	10	52269185	107713808	Rat
2317043	Aia7	Adjuvant induced arthritis QTL 7	3.82		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	10	73695339	83061459	Rat
2317042	Aia20	Adjuvant induced arthritis QTL 20	3.38		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	10	73695339	83061459	Rat
2298481	Eau9	Experimental allergic uveoretinitis QTL 9		0.0169	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	10	64139597	83061459	Rat
2298480	Eau7	Experimental allergic uveoretinitis QTL 7		0.0049	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	10	35509383	80509383	Rat
61396	Bp9	Blood pressure QTL 9	4.8	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	68920187	107713808	Rat
1358915	Stresp7	Stress response QTL 7	3.52		blood norepinephrine amount (VT:0005663)	plasma norepinephrine level (CMO:0001010)	10	65307813	107713808	Rat
70363	Bp71	Blood pressure QTL 71		0.04	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	61843496	106843496	Rat
61402	Niddm3	Non-insulin dependent diabetes mellitus QTL 3	4.58		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	10	61843633	83061236	Rat
1331791	Cm31	Cardiac mass QTL 31	3.84606		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	10	29800910	91417879	Rat
6893366	Bw106	Body weight QTL 106	0.3	0.47	body mass (VT:0001259)	body weight (CMO:0000012)	10	70698731	107713808	Rat
631530	Tls3	T-lymphoma susceptibility QTL 3	0	0.0001	thymus integrity trait (VT:0010555)	percentage of study population developing T-cell lymphomas during a period of time (CMO:0001911)	10	27587226	96099902	Rat
1354608	Cm33	Cardiac mass QTL 33	2.8		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	10	55307972	93608131	Rat
1558643	Cm44	Cardiac mass QTL 44	4.8	0.0000368	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	10	61843496	100198886	Rat
8552805	Bw145	Body weight QTL 145	2.2		body mass (VT:0001259)	change in body weight to body weight ratio (CMO:0002216)	10	43608793	88608793	Rat
631267	Cia20	Collagen induced arthritis QTL 20	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23948641	107713808	Rat
631269	Cia22	Collagen induced arthritis QTL 22	8.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	40535708	107713808	Rat
1576308	Schws1	Schwannoma susceptibility QTL 1		0.0041	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	10	40535708	107713808	Rat
631268	Cia21	Collagen induced arthritis QTL 21	3.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	14991535	107713808	Rat
7207811	Bmd90	Bone mineral density QTL 90	5.2		femur size trait (VT:1000369)	femoral neck cross-sectional area (CMO:0001697)	10	49943710	94943710	Rat
1576311	Pia26	Pristane induced arthritis QTL 26			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	31129113	76129113	Rat
631270	Cia23	Collagen induced arthritis QTL 23	3.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	40535708	107713808	Rat
7411614	Foco18	Food consumption QTL 18		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	10	44939359	89939359	Rat
1581559	Eae18	Experimental allergic encephalomyelitis QTL 18		0.00002	nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis severity score (CMO:0001419)	10	66108888	107555881	Rat
6893336	Cm75	Cardiac mass QTL 75	0.1	0.87	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	10	61843496	100198886	Rat
12880053	Cm104	Cardiac mass QTL 104		0.009	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	10	73950209	83959619	Rat
631547	Bp87	Blood pressure QTL 87	4.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	47869129	92869129	Rat
61427	Cia16	Collagen induced arthritis QTL 16	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	6864618	96620484	Rat
12880050	Am10	Aortic mass QTL 10		0.016	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	10	39503487	84503487	Rat
2292436	Bp310	Blood pressure QTL 310			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	50604677	95604677	Rat
6893342	Cm78	Cardiac mass QTL 78	0.1	0.88	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	10	35509383	88177745	Rat
1600367	Mcs15	Mammary carcinoma susceptibility QTL 15	4.5		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	10	72724423	107713808	Rat
1358188	Ept9	Estrogen-induced pituitary tumorigenesis QTL 9	3.9		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	10	73950353	96620293	Rat
634354	Rends3	Renal damage susceptibility QTL 3		0.05	kidney blood vessel morphology trait (VT:0000530)	organ lesion measurement (CMO:0000677)	10	61997479	106997479	Rat
2301405	Cm69	Cardiac mass QTL 69		0.031	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	10	66817119	107713808	Rat
631542	Bp82	Blood pressure QTL 82	6.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	27023535	99451848	Rat

Markers in Region

D10Got230

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	73,723,598 - 73,723,784 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	76,254,639 - 76,254,823	NCBI	Rnor6.0
Rnor_5.0	10	73,855,346 - 73,855,530	UniSTS	Rnor5.0
RGSC_v3.4	10	77,368,719 - 77,368,903	UniSTS	RGSC3.4
Celera	10	72,629,531 - 72,629,715	UniSTS
Cytogenetic Map	10	q26	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
9	11	49	113	91	90	59	25	59	6	218	97	16	93	45	60	31	33	33

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_133383	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039085041	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039085042	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063268279	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063268280	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063268281	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063268282	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC119015	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF330051	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473948	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ235041	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000010	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000003219 ⟹ ENSRNOP00000003219

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	10	74,200,491 - 74,230,043 (-)	Ensembl
mRatBN7.2 Ensembl	10	73,703,278 - 73,732,850 (-)	Ensembl
Rnor_6.0 Ensembl	10	76,230,373 - 76,263,866 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000104820 ⟹ ENSRNOP00000092430

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	10	74,200,491 - 74,227,960 (-)	Ensembl
mRatBN7.2 Ensembl	10	73,703,278 - 73,732,821 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000110780 ⟹ ENSRNOP00000081360

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	10	74,200,491 - 74,230,241 (-)	Ensembl
mRatBN7.2 Ensembl	10	73,703,283 - 73,732,821 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000125349 ⟹ ENSRNOP00000102225

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	10	74,200,491 - 74,230,089 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000153134 ⟹ ENSRNOP00000100653

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	10	74,200,491 - 74,221,591 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000157815 ⟹ ENSRNOP00000101186

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	10	74,200,491 - 74,230,241 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000172776 ⟹ ENSRNOP00000106936

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	10	74,200,491 - 74,230,241 (-)	Ensembl

RefSeq Acc Id:

NM_133383 ⟹ NP_596874

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	74,200,491 - 74,230,043 (-)	NCBI
mRatBN7.2	10	73,703,275 - 73,732,829 (-)	NCBI
Rnor_6.0	10	76,230,371 - 76,263,866 (-)	NCBI
Rnor_5.0	10	73,846,394 - 73,880,406 (+)	NCBI
RGSC_v3.4	10	77,347,473 - 77,377,945 (-)	RGD
Celera	10	72,609,315 - 72,638,737 (-)	RGD

Sequence:

show sequence

CTGAGGCGGGGTTTTCATCATGGAGCTGTCGCGGCGGATTTGTCTCGTCCGACTGTGGCTGTTG
CTACTGTCGTTCTTGCTGGGCTTCAGCGCGGGATCTGCCCTCAACTGGCGGGAACAAGAAGGCA
AGGAAGTATGGGATTACGTGACTGTTCGAGAGGATGCACGCATGTTCTGGTGGCTCTACTATGC
CACCAACCCTTGCAAGAACTTCTCAGAGCTGCCTCTGGTCATGTGGCTTCAGGGTGGTCCAGGT
GGTTCTAGCACTGGATTTGGAAACTTTGAGGAAATCGGCCCTCTTGACACCCGACTCAAGCCAC
GGAACACTACCTGGCTGCAGTGGGCCAGTCTCCTGTTTGTGGACAATCCTGTGGGCACGGGCTT
CAGTTACGTGAACACGACAGATGCCTACGCAAAGGACCTGGACACGGTGGCTTCCGACATGATG
GTCCTCCTGAAATCCTTCTTTGATTGTCATAAAGAATTCCAGACGGTTCCGTTCTACATTTTCT
CAGAATCCTACGGAGGAAAGATGGCTGCTGGCATCAGTTTAGAACTTCACAAGGCTATTCAGCA
AGGGACCATCAAGTGCAACTTCTCTGGGGTTGCTTTGGGTGACTCCTGGATCTCCCCTGTGGAT
TCAGTGCTGTCCTGGGGACCTTACCTGTACAGCGTGTCTCTCCTTGATAATAAAGGCTTGGCTG
AGGTGTCCGACATTGCGGAGCAAGTCCTCAATGCTGTAAACAAGGGCTTCTACAAGGAAGCCAC
TCAGCTGTGGGGGAAAGCAGAAATGATCATTGAAAAGAACACCGACGGGGTAAACTTCTATAAC
ATCTTAACTAAAAGCACCCCCGACACCTCTATGGAGTCGAGCCTCGAGTTCTTCCGGAGCCCCT
TAGTTCGTCTCTGTCAGCGCCACGTGAGACACCTACAAGGAGACGCCTTAAGTCAGCTCATGAA
CGGTCCCATCAAAAAGAAGCTCAAAATTATCCCTGACGATGTCTCCTGGGGAGCCCAGTCGTCC
TCCGTCTTCATAAGCATGGAAGAGGACTTCATGAAGCCTGTCATCGACATCGTGGATACGTTGC
TGGAACTCGGGGTCAATGTGACTGTGTACAATGGGCAGCTGGATCTCATTGTGGACACCATAGG
TCAGGAGTCCTGGGTTCAGAAGCTGAAGTGGCCACAGCTGTCCAGATTCAATCAGCTAAAATGG
AAGGCCCTGTACACCAATCCTAAGTCTTCAGAAACATCTGCGTTTGTCAAGTCCTATGAGAACT
TAGCGTTCTACTGGATCCTAAAGGCGGGTCACATGGTTCCTGCTGACCAAGGGGACATGGCTCT
GAAGATGATGAGGCTGGTTACTCAGCAGGAGTAGCTGAGCTGAGCTGGCCCTGGAGGCCCTGGA
GGCCCTGGAGGCCCTGGAGTAGGGCCCAGGATGCAGGTGCTAATGTCTATCCCCGGCGCTCTTC
TTCCCGACTCTACCATGGGATGTAACTCCAGGAGCCCCTGCCATCTCCCGTACCAAAAGACTGT
GGCTTCCGTGTCTACTCAGAAATCAGTTCTACTTCGTAAACAGTGTTTAAAACCAGACTCATTT
AATCAGAGTGAAGGATTGCAGTCCATTGGCTTCTTAGCACAGAAGCAGCTGATAACACAAGTAA
ACCCCAGCCCTTGAGAGGTAGAAGCAAGAGGATCAGAGGTTCAAGCGCATCCTCGGCTCCATCA
TAAGTTCAAAAGCCGCCTGCACCAAATGGGAGTCCTTGTCTCAAAAAAAAAAAAAAAAAAAAAA
AAGCAAAGAAAGCAAAGGACTCGATGACATGATTTATAGACAAAAGCAGTGGGAGAAAATACTA
AAGCCCCACTGAGCTGCCAGCCAGGTGTCTGTGACTACAGGTCTTTTATCTGCTACATATATAT
TTTTACAAAAATGAAATCCATATTGTTCGCTATTTTGCTGTCTGCTTTGCTCCCGTATCAACAT
GACTTGCACGTCTTTTCCCATCAATAAATGTGCCATGATATTTTTAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039085041 ⟹ XP_038940969

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	74,200,491 - 74,230,051 (-)	NCBI
mRatBN7.2	10	73,703,275 - 73,732,817 (-)	NCBI

RefSeq Acc Id:

XM_039085042 ⟹ XP_038940970

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	74,200,491 - 74,230,107 (-)	NCBI
mRatBN7.2	10	73,703,275 - 73,732,892 (-)	NCBI

RefSeq Acc Id:

XM_063268279 ⟹ XP_063124349

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	74,200,491 - 74,230,046 (-)	NCBI

RefSeq Acc Id:

XM_063268280 ⟹ XP_063124350

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	74,200,491 - 74,229,073 (-)	NCBI

RefSeq Acc Id:

XM_063268281 ⟹ XP_063124351

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	74,200,491 - 74,229,068 (-)	NCBI

RefSeq Acc Id:

XM_063268282 ⟹ XP_063124352

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	74,200,491 - 74,230,051 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_596874	(Get FASTA)	NCBI Sequence Viewer
	XP_038940969	(Get FASTA)	NCBI Sequence Viewer
	XP_038940970	(Get FASTA)	NCBI Sequence Viewer
	XP_063124349	(Get FASTA)	NCBI Sequence Viewer
	XP_063124350	(Get FASTA)	NCBI Sequence Viewer
	XP_063124351	(Get FASTA)	NCBI Sequence Viewer
	XP_063124352	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAK84661	(Get FASTA)	NCBI Sequence Viewer
	EDM05646	(Get FASTA)	NCBI Sequence Viewer
	EDM05647	(Get FASTA)	NCBI Sequence Viewer
	EDM05648	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000092430
	ENSRNOP00000101186
	ENSRNOP00000102225
GenBank Protein	Q920A6	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_596874 ⟸ NM_133383
- Peptide Label:	precursor
- UniProtKB:	Q920A6 (UniProtKB/Swiss-Prot), A6HHZ2 (UniProtKB/TrEMBL), A0A8L2Q1H7 (UniProtKB/TrEMBL)
- Sequence:	show sequence MELSRRICLVRLWLLLLSFLLGFSAGSALNWREQEGKEVWDYVTVREDARMFWWLYYATNPCKN FSELPLVMWLQGGPGGSSTGFGNFEEIGPLDTRLKPRNTTWLQWASLLFVDNPVGTGFSYVNTT DAYAKDLDTVASDMMVLLKSFFDCHKEFQTVPFYIFSESYGGKMAAGISLELHKAIQQGTIKCN FSGVALGDSWISPVDSVLSWGPYLYSVSLLDNKGLAEVSDIAEQVLNAVNKGFYKEATQLWGKA EMIIEKNTDGVNFYNILTKSTPDTSMESSLEFFRSPLVRLCQRHVRHLQGDALSQLMNGPIKKK LKIIPDDVSWGAQSSSVFISMEEDFMKPVIDIVDTLLELGVNVTVYNGQLDLIVDTIGQESWVQ KLKWPQLSRFNQLKWKALYTNPKSSETSAFVKSYENLAFYWILKAGHMVPADQGDMALKMMRLV TQQE hide sequence

Ensembl Acc Id:

ENSRNOP00000003219 ⟸ ENSRNOT00000003219

RefSeq Acc Id:	XP_038940970 ⟸ XM_039085042
- Peptide Label:	isoform X3
- UniProtKB:	A0A8L2Q1H7 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038940969 ⟸ XM_039085041
- Peptide Label:	isoform X1
- UniProtKB:	A0A8I6AI52 (UniProtKB/TrEMBL), A0A8I5ZSM7 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000092430 ⟸ ENSRNOT00000104820

Ensembl Acc Id:

ENSRNOP00000081360 ⟸ ENSRNOT00000110780

RefSeq Acc Id:	XP_063124352 ⟸ XM_063268282
- Peptide Label:	isoform X2
- UniProtKB:	A0A8I5ZSM7 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063124349 ⟸ XM_063268279
- Peptide Label:	isoform X1
- UniProtKB:	A0A8I6AI52 (UniProtKB/TrEMBL), A0A8I5ZSM7 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063124350 ⟸ XM_063268280
- Peptide Label:	isoform X1
- UniProtKB:	A0A8I6AI52 (UniProtKB/TrEMBL), A0A8I5ZSM7 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063124351 ⟸ XM_063268281
- Peptide Label:	isoform X1
- UniProtKB:	A0A8I6AI52 (UniProtKB/TrEMBL), A0A8I5ZSM7 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000101186 ⟸ ENSRNOT00000157815

Ensembl Acc Id:

ENSRNOP00000100653 ⟸ ENSRNOT00000153134

Ensembl Acc Id:

ENSRNOP00000102225 ⟸ ENSRNOT00000125349

Ensembl Acc Id:

ENSRNOP00000106936 ⟸ ENSRNOT00000172776

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q920A6-F1-model_v2	AlphaFold	Q920A6	1-452	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13697582

Promoter ID:

EPDNEW_R8107

Type:

initiation region

Name:

Scpep1_1

Description:

serine carboxypeptidase 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	10	76,263,856 - 76,263,916	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:620067	AgrOrtholog
BioCyc Gene	G2FUF-23706	BioCyc
Ensembl Genes	ENSRNOG00000002358	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000104820	ENTREZGENE
	ENSRNOT00000125349	ENTREZGENE
	ENSRNOT00000157815	ENTREZGENE
Gene3D-CATH	3.40.50.1820	UniProtKB/Swiss-Prot
InterPro	AB_hydrolase	UniProtKB/Swiss-Prot
	Peptidase_S10	UniProtKB/Swiss-Prot
	Ser_caboxypep_ser_AS	UniProtKB/Swiss-Prot
KEGG Report	rno:114861	UniProtKB/Swiss-Prot
NCBI Gene	114861	ENTREZGENE
PANTHER	PTHR11802	UniProtKB/Swiss-Prot
	RETINOID-INDUCIBLE SERINE CARBOXYPEPTIDASE	UniProtKB/Swiss-Prot
Pfam	Peptidase_S10	UniProtKB/Swiss-Prot
PhenoGen	Scpep1	PhenoGen
PRINTS	CRBOXYPTASEC	UniProtKB/Swiss-Prot
PROSITE	CARBOXYPEPT_SER_SER	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000002358	RatGTEx
Superfamily-SCOP	SSF53474	UniProtKB/Swiss-Prot
UniProt	A0A8I5ZSM7	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6AI52	ENTREZGENE, UniProtKB/TrEMBL
	A0A8L2Q1H7	ENTREZGENE, UniProtKB/TrEMBL
	A6HHZ1_RAT	UniProtKB/TrEMBL
	A6HHZ2	ENTREZGENE, UniProtKB/TrEMBL
	A6HHZ3_RAT	UniProtKB/TrEMBL
	Q920A6	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2004-12-14	Scpep1	serine carboxypeptidase 1	Risc	retinoid-inducible serine caroboxypetidase	Symbol and Name updated	1299863	APPROVED
2002-08-07	Risc				Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_regulation	expression is induced by retinoic acid	70518

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar