Prss8 (serine protease 8) - Rat Genome Database

Name: Prss8
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Prss8 (serine protease 8) Rattus norvegicus

Analyze

Symbol:

Prss8

Name:

serine protease 8

RGD ID:

619973

Description:

Predicted to enable sodium channel regulator activity. Involved in several processes, including positive regulation of sodium ion transmembrane transport; response to mineralocorticoid; and response to peptide hormone. Located in extracellular space. Used to study alopecia. Orthologous to human PRSS8 (serine protease 8); INTERACTS WITH 1-naphthyl isothiocyanate; 2,2',4,4',5,5'-hexachlorobiphenyl; 2,2',4,4'-Tetrabromodiphenyl ether.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

CAP1; channel-activating protease 1; prostasin; protease, serine, 8

RGD Orthologs

Human

Mouse

Chinchilla

Bonobo

Dog

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	PRSS8 (serine protease 8)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Prss8 (protease, serine 8 (prostasin))	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Prss8 (serine protease 8)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	PRSS8 (serine protease 8)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	PRSS8 (serine protease 8)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Prss8 (serine protease 8)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	PRSS8 (serine protease 8)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	PRSS8 (serine protease 8)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Prss8 (serine protease 8)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	PRSS8 (serine protease 8)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Prss8 (protease, serine 8 (prostasin))	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	zgc:92313	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	1	182,536,229 - 182,540,745 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	182,536,229 - 182,540,815 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	190,886,770 - 190,891,286 (-)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	1	198,072,862 - 198,077,378 (-)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	1	190,743,263 - 190,747,782 (-)	NCBI	Rnor_WKY
Rnor_6.0	1	199,372,519 - 199,377,035 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	199,372,519 - 199,377,035 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	206,395,299 - 206,399,815 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	187,210,556 - 187,215,072 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	187,360,436 - 187,364,953 (-)	NCBI
Celera	1	180,187,038 - 180,191,554 (-)	NCBI		Celera
Cytogenetic Map	1	q37	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

alopecia (IAGP)

autosomal recessive congenital ichthyosis 4B (ISS)

branched-chain keto acid dehydrogenase kinase deficiency (ISO)

breast carcinoma (ISO)

Fetal Diseases (ISO)

genetic disease (ISO)

Neoplasm Metastasis (ISO)

neural tube defect (ISO)

ovarian cancer (ISO)

placenta disease (ISO)

Prenatal Injuries (ISO)

prostate carcinoma in situ (ISO)

Prostatic Neoplasms (ISO)

skin disease (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,1-dichloroethene (ISO)

1,2-dichloroethane (ISO)

1-naphthyl isothiocyanate (EXP)

17beta-estradiol (ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (EXP,ISO)

2,2',4,4'-Tetrabromodiphenyl ether (EXP)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,3,4,7,8-Pentachlorodibenzofuran (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

2,4-dinitrotoluene (EXP)

3,3',5,5'-tetrabromobisphenol A (EXP)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

acetamide (EXP)

acrylamide (EXP)

afimoxifene (ISO)

aflatoxin B1 (EXP,ISO)

all-trans-retinoic acid (ISO)

alpha-hexachlorocyclohexane (EXP)

ammonium chloride (EXP)

Aroclor 1254 (ISO)

arsane (ISO)

arsenic atom (ISO)

benzo[a]pyrene (ISO)

benzo[b]fluoranthene (ISO)

beta-naphthoflavone (EXP)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

cadmium atom (ISO)

carbon nanotube (ISO)

choline (ISO)

copper atom (ISO)

copper(0) (ISO)

copper(II) sulfate (ISO)

coumestrol (ISO)

cyanocob(III)alamin (ISO)

cyclosporin A (ISO)

decabromodiphenyl ether (EXP)

diethyl maleate (EXP)

disulfiram (ISO)

diuron (EXP)

dorsomorphin (ISO)

elemental selenium (ISO)

endosulfan (EXP)

entinostat (ISO)

epoxiconazole (ISO)

ethanol (EXP)

flavonoids (EXP)

folic acid (ISO)

folpet (ISO)

genistein (ISO)

glycine betaine (ISO)

isotretinoin (ISO)

L-methionine (ISO)

mercury dibromide (ISO)

Muraglitazar (EXP)

N-methyl-4-phenylpyridinium (EXP,ISO)

N-nitrosodiethylamine (EXP,ISO)

nickel atom (ISO)

nickel sulfate (ISO)

panobinostat (ISO)

PCB138 (ISO)

perfluorooctanoic acid (EXP)

phenobarbital (ISO)

phenylmercury acetate (ISO)

pirinixic acid (ISO)

propiconazole (ISO)

resveratrol (ISO)

SB 431542 (ISO)

selenium atom (ISO)

sodium arsenite (ISO)

sodium dodecyl sulfate (ISO)

sunitinib (ISO)

tamoxifen (ISO)

Tesaglitazar (EXP)

tetrachloromethane (ISO)

thioacetamide (EXP)

trichostatin A (ISO)

Triptolide (ISO)

triptonide (ISO)

urethane (ISO)

valproic acid (ISO)

vinclozolin (EXP)

zinc atom (ISO)

zinc(0) (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

hair follicle development (ISO)

positive regulation of sodium ion transmembrane transport (IDA)

positive regulation of sodium ion transport (IBA,ISO)

proteolysis (IEA)

response to mineralocorticoid (IEP)

response to peptide hormone (IEP)

response to xenobiotic stimulus (IEP)

transepithelial transport (ISO)

Cellular Component

extracellular space (IDA,ISO)

extrinsic component of plasma membrane (ISO)

membrane raft (ISO)

plasma membrane (IEA,ISO)

plasma membrane (ISO)

Molecular Function

protein binding (ISO)

serine-type endopeptidase activity (IEA)

sodium channel regulator activity (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Activation of epithelial sodium channels by prostasin in Xenopus oocytes.	Adachi M, etal., J Am Soc Nephrol 2001 Jun;12(6):1114-21.
2.	Prostasin serine protease inhibits breast cancer invasiveness and is transcriptionally regulated by promoter DNA methylation.	Chen LM and Chai KX, Int J Cancer. 2002 Jan 20;97(3):323-9.
3.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
5.	A new drug delivery system targeting ileal epithelial cells induced electrogenic sodium absorption: possible promotion of intestinal adaptation.	Haneda S, etal., J Gastrointest Surg. 2007 May;11(5):568-77.
6.	Inhibition of prostasin secretion by serine protease inhibitors in the kidney.	Iwashita K, etal., J Am Soc Nephrol. 2003 Jan;14(1):11-6.
7.	Blood-borne RT-PCR assay for prostasin- specific transcripts to identify circulating prostate cells in cancer patients.	Laribi A, etal., Eur Urol. 2001 Jan;39(1):65-71.
8.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
9.	Prostasin, a potential serum marker for ovarian cancer: identification through microarray technology.	Mok SC, etal., J Natl Cancer Inst. 2001 Oct 3;93(19):1458-64.
10.	Regulation of prostasin by aldosterone in the kidney.	Narikiyo T, etal., J Clin Invest 2002 Feb;109(3):401-8.
11.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
12.	GOA pipeline	RGD automated data pipeline
13.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
14.	Long-term effects of vasopressin on the subcellular localization of ENaC in the renal collecting system.	Sauter D, etal., Kidney Int. 2006 Mar;69(6):1024-32.
15.	The mouse frizzy (fr) and rat 'hairless' (frCR) mutations are natural variants of protease serine S1 family member 8 (Prss8).	Spacek DV, etal., Exp Dermatol. 2010 Jun;19(6):527-32. doi: 10.1111/j.1600-0625.2009.01054.x. Epub 2010 Feb 25.
16.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
17.	Down-regulated expression of prostasin in high-grade or hormone-refractory human prostate cancers.	Takahashi S, etal., Prostate. 2003 Feb 15;54(3):187-93.

Additional References at PubMed

PMID:16502470	PMID:16822939	PMID:16941024	PMID:19056867	PMID:19199708	PMID:19911255	PMID:20645929	PMID:22705055	PMID:23376485	PMID:23533145

Genomics

Comparative Map Data

Prss8
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	1	182,536,229 - 182,540,745 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	182,536,229 - 182,540,815 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	190,886,770 - 190,891,286 (-)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	1	198,072,862 - 198,077,378 (-)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	1	190,743,263 - 190,747,782 (-)	NCBI	Rnor_WKY
Rnor_6.0	1	199,372,519 - 199,377,035 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	199,372,519 - 199,377,035 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	206,395,299 - 206,399,815 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	187,210,556 - 187,215,072 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	187,360,436 - 187,364,953 (-)	NCBI
Celera	1	180,187,038 - 180,191,554 (-)	NCBI		Celera
Cytogenetic Map	1	q37	NCBI

PRSS8
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	16	31,131,433 - 31,135,727 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	16	31,131,433 - 31,135,727 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	16	31,142,754 - 31,147,048 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	16	31,050,255 - 31,054,652 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	16	31,050,256 - 31,054,652	NCBI
Celera	16	29,150,870 - 29,155,267 (+)	NCBI		Celera
Cytogenetic Map	16	p11.2	NCBI
HuRef	16	28,703,907 - 28,708,304 (-)	NCBI		HuRef
CHM1_1	16	32,460,477 - 32,464,874 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	16	31,518,914 - 31,523,208 (-)	NCBI		T2T-CHM13v2.0

Prss8
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	7	127,524,889 - 127,529,321 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	7	127,524,888 - 127,529,276 (-)	Ensembl		GRCm39 Ensembl
GRCm38	7	127,925,717 - 127,930,149 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	7	127,925,716 - 127,930,104 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	7	135,069,231 - 135,073,627 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	7	127,716,865 - 127,721,242 (-)	NCBI		MGSCv36	mm8
Celera	7	127,760,906 - 127,765,302 (-)	NCBI		Celera
Cytogenetic Map	7	F3	NCBI
cM Map	7	69.84	NCBI

Prss8
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955493	7,971,609 - 7,976,666 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955493	7,970,929 - 7,976,885 (-)	NCBI	ChiLan1.0	ChiLan1.0

PRSS8
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
PanPan1.1	16	31,500,225 - 31,504,555 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	16	31,500,225 - 31,504,623 (-)	Ensembl	panpan1.1		panPan2
Mhudiblu_PPA_v0	16	23,833,127 - 23,837,466 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3

PRSS8
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	6	17,110,251 - 17,114,564 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	6	17,110,300 - 17,114,816 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	6	18,685,630 - 18,689,940 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	6	17,241,173 - 17,245,485 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	6	17,241,217 - 17,244,733 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	6	17,041,381 - 17,045,690 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	6	16,960,412 - 16,964,722 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	6	17,272,597 - 17,276,908 (+)	NCBI		UU_Cfam_GSD_1.0

Prss8
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409344	125,389,779 - 125,393,813 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936501	13,485,310 - 13,491,905 (-)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936501	13,487,863 - 13,491,837 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

PRSS8
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	3	17,357,802 - 17,362,220 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	3	17,357,793 - 17,362,223 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	3	17,510,112 - 17,514,539 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

PRSS8
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	5	27,820,898 - 27,827,873 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	5	27,817,830 - 27,824,926 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666068	1,641,573 - 1,646,053 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Prss8
(Heterocephalus glaber - naked mole-rat)

Naked Mole-rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624782	14,169,866 - 14,173,676 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624782	14,169,204 - 14,177,137 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Prss8
12 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	292
Count of miRNA genes:	171
Interacting mature miRNAs:	204
Transcripts:	ENSRNOT00000026572
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
10059597	Bp377	Blood pressure QTL 377	3.42	0.025	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32737458	199368955	Rat
634314	Niddm44	Non-insulin dependent diabetes mellitus QTL 44			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	49393289	199050459	Rat
1578780	Cm52	Cardiac mass QTL 52	3.3	0.0001	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	1	81591954	219808434	Rat
1331749	Hrtrt11	Heart rate QTL 11	2.973		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	1	94494440	198211706	Rat
70209	Niddm23	Non-insulin dependent diabetes mellitus QTL 23	2.82		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	94494440	198324465	Rat
731168	Bp154	Blood pressure QTL 154	3.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	94642722	214537671	Rat
8655649	Arrd1	Age-related retinal degeneration QTL 1	4.89		retinal layer morphology trait (VT:0003727)	percentage of study population developing retinopathy during a period of time (CMO:0002453)	1	100357752	183970443	Rat
1354591	Cm36	Cardiac mass QTL 36	4.1		heart left ventricle mass (VT:0007031)	calculated heart weight (CMO:0000073)	1	102813953	201278233	Rat
1354615	Cm32	Cardiac mass QTL 32	5.2		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	1	102813953	201278233	Rat
1354606	Bp246	Blood pressure QTL 246	3.6		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	1	102813953	218753816	Rat
1300158	Bp173	Blood pressure QTL 173	3.48		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	1	115540693	185145286	Rat
7794788	Mcs32	Mammary carcinoma susceptibility QTL 32	2.61		mammary gland integrity trait (VT:0010552)	mammary tumor incidence/prevalence measurement (CMO:0000946)	1	115540693	238914717	Rat
7421630	Bp362	Blood pressure QTL 362		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	118608292	241799120	Rat
631205	Bp196	Blood pressure QTL 196	4	0.0001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	118944897	199050459	Rat
631549	Bp89	Blood pressure QTL 89	5.7		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	123350581	201284552	Rat
1598853	Memor3	Memory QTL 3	4.5		exploratory behavior trait (VT:0010471)	total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443)	1	143506580	212458660	Rat
61348	Bp30	Blood pressure QTL 30	2.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	144017057	197814409	Rat
70160	Bw18	Body weight QTL 18	5.7		body mass (VT:0001259)	body weight (CMO:0000012)	1	144267353	196383635	Rat
737828	Hcas3	Hepatocarcinoma susceptibility QTL 3	4.9		liver integrity trait (VT:0010547)	liver tumorous lesion volume to total liver volume ratio (CMO:0001082)	1	144267353	222987745	Rat
2302378	Insul11	Insulin level QTL 11	3.25		blood insulin amount (VT:0001560)	serum insulin level (CMO:0000358)	1	144267353	251128347	Rat
7771612	Cm80	Cardiac mass QTL 80	8.4		heart left ventricle mass (VT:0007031)	heart left ventricle weight (CMO:0000776)	1	149448574	221264292	Rat
724531	Uae5	Urinary albumin excretion QTL 5	4		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	1	150700142	252085212	Rat
1578759	Uae30	Urinary albumin excretion QTL 30	3.3	0.003	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	150700247	252085048	Rat
1578778	Pur4	Proteinuria QTL 4	3.3	0.003	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	1	150700247	252085048	Rat
1354602	Bw35	Body weight QTL 35	12.2		body mass (VT:0001259)	body weight (CMO:0000012)	1	151162512	201278233	Rat
1354620	Kidm19	Kidney mass QTL 19	4		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	151162512	201278233	Rat
1354634	Kidm12	Kidney mass QTL 12	3.9		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	1	151162512	201278233	Rat
1354636	Lmblg1	Limb length QTL 1	6.4		tibia length (VT:0004357)	tibia length (CMO:0000450)	1	151162512	201278233	Rat
1354610	Bw34	Body weight QTL 34	4.1		body mass (VT:0001259)	body weight (CMO:0000012)	1	151162512	256448636	Rat
1354646	Kidm18	Kidney mass QTL 18	5.7		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	151162512	256448636	Rat
1354661	Bw33	Body weight QTL 33	5.2		body mass (VT:0001259)	body weight (CMO:0000012)	1	151162512	256448636	Rat
1358886	Bp260	Blood pressure QTL 260	3.67		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	151162766	225824951	Rat
61343	Bp28	Blood pressure QTL 28			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	151646613	196646613	Rat
1549837	Hcar15	Hepatocarcinoma resistance QTL 15		0.05	liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	153136852	260522016	Rat
2303622	Vencon6	Ventilatory control QTL 6		0.001	respiration trait (VT:0001943)	respiration rate (CMO:0000289)	1	154561505	199561505	Rat
4889428	Stresp24	Stress response QTL 24		0.05	heart pumping trait (VT:2000009)	absolute change in electrocardiographic low frequency R-R spectral component to high frequency R-R spectral component ratio (CMO:0002162)	1	155866514	200866514	Rat
1354618	Kidm15	Kidney mass QTL 15	5		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	1	156677124	201278233	Rat
2312420	Pur17	Proteinuria QTL 17	7.1	0.0001	urine protein amount (VT:0005160)	urine total protein excretion rate (CMO:0000756)	1	156677124	218753816	Rat
1354580	Scort1	Serum corticosterone level QTL 1	3.4		blood corticosterone amount (VT:0005345)	blood corticosterone level (CMO:0001172)	1	156677124	256448636	Rat
61347	Bp197	Blood pressure QTL 197	4.2		arterial blood pressure trait (VT:2000000)	blood pressure measurement (CMO:0000003)	1	158633083	203633083	Rat
2292222	Bp307	Blood pressure QTL 307	3.06	0.0014	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	164310393	213533942	Rat
2292220	Bp306	Blood pressure QTL 306	3.47	0.00087	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	164310393	243914901	Rat
619613	Bp77	Blood pressure QTL 77		0.01	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	164747424	209747424	Rat
619613	Bp77	Blood pressure QTL 77		0.01	arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	164747424	209747424	Rat
2312558	Glom17	Glomerulus QTL 17	3.9	0.001	kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	1	166532971	191278129	Rat
1354653	Despr9	Despair related QTL 9		0.00019	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	1	167909849	212909849	Rat
619614	Bp78	Blood pressure QTL 78		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	169112897	197261052	Rat
619614	Bp78	Blood pressure QTL 78		0.001	arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	169112897	197261052	Rat
61341	Bp26	Blood pressure QTL 26			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	169537671	214537671	Rat
724562	Rends1	Renal damage susceptibility QTL 1		0.05	kidney glomerulus integrity trait (VT:0010546)	index of glomerular damage (CMO:0001135)	1	169537671	214537671	Rat
1358294	Bw37	Body weight QTL 37	5	0.000011	body mass (VT:0001259)	body weight (CMO:0000012)	1	171310381	216310381	Rat
2293689	Bss47	Bone structure and strength QTL 47	7.25	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra trabecular cross-sectional area (CMO:0001692)	1	171629477	216629477	Rat
2293693	Bss22	Bone structure and strength QTL 22	33.52	0.0001	femur morphology trait (VT:0000559)	femur cross-sectional area (CMO:0001661)	1	171629477	216629477	Rat
2300161	Bmd43	Bone mineral density QTL 43	8.4	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	1	171629477	216629477	Rat
2300174	Bmd42	Bone mineral density QTL 42	8.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	bone mineral density (CMO:0001226)	1	171629477	216629477	Rat
2300187	Bmd41	Bone mineral density QTL 41	8.9	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	1	171629477	216629477	Rat
2293654	Bss30	Bone structure and strength QTL 30	32.65	0.0001	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	1	171629477	216629477	Rat
2293673	Bss27	Bone structure and strength QTL 27	18.63	0.0001	femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	1	171629477	216629477	Rat
2293677	Bss41	Bone structure and strength QTL 41	9.38	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra cross-sectional area (CMO:0001689)	1	171629477	216629477	Rat
1549830	Bss1	Bone structure and strength QTL 1	4.8		femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	1	172609619	217609619	Rat
631214	Bw61	Body weight QTL61	3.4	0.0001	intramuscular adipose amount (VT:0010044)	intramuscular fat area (CMO:0001162)	1	173108781	218108781	Rat
631670	Iddm10	Insulin dependent diabetes mellitus QTL 10	1.9		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	1	174133260	196383635	Rat
70163	Bw20	Body weight QTL 20	5.1		body mass (VT:0001259)	body weight (CMO:0000012)	1	174133260	219133260	Rat
738032	Hcas5	Hepatocarcinoma susceptibility QTL 5	3.12		liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	176426412	257976495	Rat
1600380	Niddm70	Non-insulin dependent diabetes mellitus QTL 70	3.1	0.0008	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	1	176550523	221550523	Rat
10059600	Bp378	Blood pressure QTL 378	3.08	0.05	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	176869060	221869060	Rat
1354624	Cm35	Cardiac mass QTL35	5.7		heart left ventricle mass (VT:0007031)	calculated heart weight (CMO:0000073)	1	177227632	256448636	Rat
1354652	Kidm20	Kidney mass QTL 20	4.3		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	177227632	256448636	Rat
1558658	Bw59	Body weight QTL 59	3.5	0.0003	body mass (VT:0001259)	body weight (CMO:0000012)	1	178784622	223784622	Rat
2325725	Eae31	Experimental allergic encephalomyelitis QTL 31			nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis severity score (CMO:0001419)	1	178810256	188377506	Rat
634321	Hc1	Hypercalciuria QTL 1	2.91		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	1	178810256	240830002	Rat
1578763	Kidm29	Kidney mass QTL 29	3.3	0.0001	kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	1	179567751	260522016	Rat
1302787	Stl25	Serum triglyceride level QTL 25	2.7	0.0073	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	1	180359209	210702199	Rat
6903303	Scl34	Serum cholesterol QTL 34	2.5	0.0033	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	1	180359209	218108781	Rat
737977	Bp160	Blood pressure QTL 160		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	181133855	226133855	Rat
61378	Bp43	Blood pressure QTL 43	22.6		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	181746937	196383635	Rat
724559	Pancm1	Pancreatic morphology QTL 1	7.1		islet of Langerhans morphology trait (VT:0005215)	pancreatic islet damage composite score (CMO:0001156)	1	181759564	214537555	Rat
2293083	Iddm25	Insulin dependent diabetes mellitus QTL 25	4.18		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	181829673	224569684	Rat

Markers in Region

RH135325

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	182,535,741 - 182,536,093 (+)	MAPPER	mRatBN7.2
mRatBN7.2	2	79,485,084 - 79,485,282 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	81,566,109 - 81,566,306	NCBI	Rnor6.0
Rnor_6.0	1	199,372,032 - 199,372,383	NCBI	Rnor6.0
Rnor_5.0	2	101,229,751 - 101,229,948	UniSTS	Rnor5.0
Rnor_5.0	1	206,394,812 - 206,395,163	UniSTS	Rnor5.0
RGSC_v3.4	1	187,210,069 - 187,210,420	UniSTS	RGSC3.4
RGSC_v3.4	2	80,630,086 - 80,630,283	UniSTS	RGSC3.4
Celera	2	75,105,730 - 75,105,927	UniSTS
Celera	1	180,186,544 - 180,186,895	UniSTS
Cytogenetic Map	2	q22	UniSTS
Cytogenetic Map	1	q36	UniSTS

AI179378

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	182,536,658 - 182,536,802 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	199,372,949 - 199,373,092	NCBI	Rnor6.0
Rnor_5.0	1	206,395,729 - 206,395,872	UniSTS	Rnor5.0
RGSC_v3.4	1	187,210,986 - 187,211,129	UniSTS	RGSC3.4
Celera	1	180,187,468 - 180,187,611	UniSTS
Cytogenetic Map	1	q36	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3		2	2		2				35	10	11
Low		2	38	25	19	25	3	3	13		31		3
Below cutoff		21	17	14		14	5	8	35				5

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_138836	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AB017638	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AC106629	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AC111812	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF202076	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC061800	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473956	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000044	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSRNOT00000026572 ⟹ ENSRNOP00000026572

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	182,536,229 - 182,540,815 (-)	Ensembl
Rnor_6.0 Ensembl	1	199,372,519 - 199,377,035 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000094049 ⟹ ENSRNOP00000086587

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	182,536,229 - 182,540,761 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000103493 ⟹ ENSRNOP00000080070

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	182,536,229 - 182,539,584 (-)	Ensembl

RefSeq Acc Id:

NM_138836 ⟹ NP_620191

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	1	182,536,229 - 182,540,745 (-)	NCBI
Rnor_6.0	1	199,372,519 - 199,377,035 (-)	NCBI
Rnor_5.0	1	206,395,299 - 206,399,815 (-)	NCBI
RGSC_v3.4	1	187,210,556 - 187,215,072 (-)	RGD
Celera	1	180,187,038 - 180,191,554 (-)	RGD

Sequence:

show sequence

TGTGCTGAACAGGGCCACACTGGTCACTACAGAGACCAAAGGCGTGTCCCGTCTTCTATACCCT
GTGTCCATTTCCTGCCGAGAAGCCTGCTTCAACCTTCCCAGCCTAGATCCTGGGATTCTTCACT
TCTGAGCCCACACCTAGATCCTGACTTCCAAACCAGCCTTCAATTCCATCCCTTTCTACCTAGA
GTCTCCTTCAGGGGGGCCCTTGTCCGGGGCCATGGCCCTAAGGGTGGGCCTGGGACTTGGGCAG
CTGGAAGCCCTGTTTATTCTGCTCCTTATTGGATTGCTCCAGTCAAGAATCGGAGCTGATGGGA
CTGAAGCTTCCTGTGGTGCAGTCATCCAGCCACGCATCACAGGTGGTGGCAGTGCGAAGCCTGG
TCAATGGCCCTGGCAGGTCAGCATCACCTACAATGGCGTCCACGTTTGTGGTGGGTCTCTCGTG
TCAAATCAATGGGTGGTGTCAGCTGCTCACTGCTTCCCCAGAGAACACAGCAAGGAAGAGTATG
AGGTAAAGCTGGGGGCCCACCAGCTGGACTCCTTCAGCAATGACATCGTGGTCCACACAGTAGC
TCAGATCATCTCCCACTCGAGCTACCGTGAGGAGGGCTCCCAGGGTGACATCGCGCTCATCCGC
CTCAGCAGCCCTGTCACCTTCTCCCGCTACATCAGACCCATCTGCCTCCCTGCAGCCAATGCCT
CCTTTCCCAATGGCCTCCACTGTACTGTCACAGGATGGGGTCATGTGGCTCCTTCAGTGAGCCT
CCAGACCCCTAGGCCTCTGCAGCAGCTTGAGGTACCACTCATCAGCCGTGAAACCTGTAGCTGC
CTGTACAACATTAATGCAGTGCCTGAAGAACCCCACACTATCCAGCAGGACATGCTGTGCGCTG
GCTATGTTAAGGGAGGCAAGGATGCTTGCCAGGGTGACTCTGGAGGCCCACTCTCTTGTCCCAT
AGACGGCCTCTGGTATTTGGCAGGCATTGTGAGTTGGGGTGATGCGTGTGGCGCCCCCAACCGG
CCTGGAGTATATACTCTGACTTCTACCTACGCTTCCTGGATCCACCACCACGTGGCAGAGCTCC
AGCCTCGCGCGGTTCCCCAGACTCAGGAGTCCCAGCCGGACGGCCACCTCTGCAACCATCATCC
TGTCTTCAACTTAGCCGCAGCCCAGAAATTGTCAAGGCCCATACTTTTCCTGCCACTGAGTCTG
ACCCTGGGCCTCTTCTCCCTTTGGCTTGAACATTAAGCTACTTAATCCTCAAAGTTGACCATGC
TTCCACGACCACAGCACGCCCAAGGACATGTGCCTGTTCAGGAGGTCAGCACGCCGACTTGATC
TTTGAGCCCACTCTTCTGCATTTGCTCCTTGGGATTATAATTTAATCTAGGGCCAAGAAGTTTA
CAGCCTGTGGAATGGACCAGGACTCTAGCCACCTTTCTCTATTATCTGCAGTTTATTGGTTAGG
CTCCTATGGAGCTCCCAGAAGCCTCACTTCAACCTGTATTTAGCACACAGCAGCTGCCTAGCTG
ACTGCTGCAGAAGGCTGGCTTCAGGGCCGACCCACCCTGCCTGATGAGCCCTTCACTTCGTCCT
CTTCCTGCCTCCAGGGCTTTGCCTGTCTTTCTGACAGGGAAGACAGCAGCCTTAATCTCCTGGA
CTCCGGAGGACTGAGCCCCCACCGGAGCTGGCTGGGGCTGGGGTCAGGGTGAGGAGTAAAAGGA
GGAAGGAGGAAATGTTTTTAACACAACTGGCTGGATGTGAAATGAAATGAAGAATATCACCCTT
CAGCACTTCTTCCTGCCTCCGAAGTCCAGCACACCAGCAGAATTTGCTTTATTAATAAATGACA
CAAAACAGGTCTGTACACATATTTACAGGTTAGAGGCCAGGAAACACAGATCCAAAGAAGGGCA
CAGGCCATTCACTTCTTGGAGAGCTTGACTTGTTTGTGCTTCGGGGGTGCCCACTTGAGGCAGA
CAGAGTCCACTGTGGGAGGAAAGAGGAATGAGAGGTCAGCAGGACCTCTGGGCCAAGTCTGCTT
ACACCTGGCTGCCCCTCTGGGCCCAGGCCAGGTTTCACCTTCACGGGATGAGAACAAAAGGGAG
CTTTGGACCTGGGGGGAGGGGATCCCAGGAATGAGTAACCACCTCTAGGCTGCTGTCCTAGAAA
CTGGTTCAACTGGTTTGGATCTTGAGGAGCCC

hide sequence

Protein Sequences


Protein RefSeqs	NP_620191	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAG32641	(Get FASTA)	NCBI Sequence Viewer
	AAH61800	(Get FASTA)	NCBI Sequence Viewer
	BAB20281	(Get FASTA)	NCBI Sequence Viewer
	EDM17210	(Get FASTA)	NCBI Sequence Viewer
	EDM17211	(Get FASTA)	NCBI Sequence Viewer
	EDM17212	(Get FASTA)	NCBI Sequence Viewer
	Q9ES87	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:	NP_620191 ⟸ NM_138836
- Peptide Label:	precursor
- UniProtKB:	Q9ES87 (UniProtKB/Swiss-Prot)
- Sequence:	show sequence MALRVGLGLGQLEALFILLLIGLLQSRIGADGTEASCGAVIQPRITGGGSAKPGQWPWQVSITY NGVHVCGGSLVSNQWVVSAAHCFPREHSKEEYEVKLGAHQLDSFSNDIVVHTVAQIISHSSYRE EGSQGDIALIRLSSPVTFSRYIRPICLPAANASFPNGLHCTVTGWGHVAPSVSLQTPRPLQQLE VPLISRETCSCLYNINAVPEEPHTIQQDMLCAGYVKGGKDACQGDSGGPLSCPIDGLWYLAGIV SWGDACGAPNRPGVYTLTSTYASWIHHHVAELQPRAVPQTQESQPDGHLCNHHPVFNLAAAQKL SRPILFLPLSLTLGLFSLWLEH hide sequence

RefSeq Acc Id:

ENSRNOP00000026572 ⟸ ENSRNOT00000026572

RefSeq Acc Id:

ENSRNOP00000086587 ⟸ ENSRNOT00000094049

RefSeq Acc Id:

ENSRNOP00000080070 ⟸ ENSRNOT00000103493

Protein Domains

Peptidase S1

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q9ES87-F1-model_v2	AlphaFold	Q9ES87	1-342	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13690447

Promoter ID:

EPDNEW_R972

Type:

initiation region

Name:

Prss8_1

Description:

protease, serine, 8

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	1	199,377,034 - 199,377,094	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:619973	AgrOrtholog
BioCyc Gene	G2FUF-57328	BioCyc
Ensembl Genes	ENSRNOG00000019616	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000026572	ENTREZGENE
	ENSRNOP00000026572.6	UniProtKB/TrEMBL
	ENSRNOP00000080070.1	UniProtKB/TrEMBL
	ENSRNOP00000086587.1	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000026572	ENTREZGENE
	ENSRNOT00000026572.7	UniProtKB/TrEMBL
	ENSRNOT00000094049.1	UniProtKB/TrEMBL
	ENSRNOT00000103493.1	UniProtKB/TrEMBL
Gene3D-CATH	2.40.10.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:5598332	IMAGE-MGC_LOAD
InterPro	Peptidase_S1_PA	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Peptidase_S1_PA_chymotrypsin	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Peptidase_S1A	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Trypsin_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	TRYPSIN_HIS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	TRYPSIN_SER	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:192107	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:72305	IMAGE-MGC_LOAD
NCBI Gene	192107	ENTREZGENE
PANTHER	PROSTASIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	TRANSMEMBRANE PROTEASE SERINE	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Trypsin	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Prss8	PhenoGen
PRINTS	CHYMOTRYPSIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	TRYPSIN_DOM	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	TRYPSIN_HIS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	TRYPSIN_SER	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
SMART	Tryp_SPc	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF50494	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A8I5ZPB9_RAT	UniProtKB/TrEMBL
	A0A8I6A1I1_RAT	UniProtKB/TrEMBL
	F1MA37_RAT	UniProtKB/TrEMBL
	PRSS8_RAT	UniProtKB/Swiss-Prot, ENTREZGENE
UniProt Secondary	Q6GSY8	UniProtKB/Swiss-Prot
	Q9ER01	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2018-01-26	Prss8	serine protease 8	Prss8	protease, serine, 8	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-02-26	Prss8	protease, serine, 8 (prostasin)			Symbol and Name status set to approved	625702	APPROVED
2002-08-07	Prss8	protease, serine, 8 (prostasin)			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_disease	high urinary excretion of prostasin seen in patients with primary aldosteronism	625693
gene_expression	expressed in kidney	625693
gene_process	mediates sodium balance	625693
gene_regulation	mRNA and protein increase in the kidney after treatment with aldosterone	625693

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI