Rala (RAS like proto-oncogene A) - Rat Genome Database

Name: Rala
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Rala (RAS like proto-oncogene A) Rattus norvegicus

Analyze

Symbol:

Rala

Name:

RAS like proto-oncogene A

RGD ID:

619851

Description:

Predicted to enable several functions, including Edg-2 lysophosphatidic acid receptor binding activity; enzyme binding activity; and guanyl ribonucleotide binding activity. Involved in regulation of postsynaptic neurotransmitter receptor internalization. Is active in Schaffer collateral - CA1 synapse and synaptic membrane. Orthologous to human RALA (RAS like proto-oncogene A); PARTICIPATES IN ceramide signaling pathway; pancreatic cancer pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene; 2,6-dinitrotoluene.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

-ral simian leukemia viral oncogene homolog A (ras related); RALA Ras like proto-oncogene A; ras-related protein Ral-A; v-ral simian leukemia viral oncogene homolog A (ras related)

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	RALA (RAS like proto-oncogene A)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Rala (v-ral simian leukemia viral oncogene A (ras related))	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Rala (RAS like proto-oncogene A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	RALA (RAS like proto-oncogene A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	RALA (RAS like proto-oncogene A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Rala (RAS like proto-oncogene A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	RALA (RAS like proto-oncogene A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	RALA (RAS like proto-oncogene A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Rala (RAS like proto-oncogene A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	RALA (RAS like proto-oncogene A)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Mus musculus (house mouse):	Rala (v-ral simian leukemia viral oncogene A (ras related))	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	ralab (v-ral simian leukemia viral oncogene homolog Ab (ras related))	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder\|PANTHER)
Danio rerio (zebrafish):	ralaa (v-ral simian leukemia viral oncogene homolog Aa (ras related))	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	ral-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Rala	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	rala	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	17	47,092,163 - 47,145,192 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	17	47,092,207 - 47,144,063 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	17	50,320,930 - 50,334,044 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	17	54,323,855 - 54,336,969 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	17	48,425,724 - 48,438,842 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	17	49,676,073 - 49,729,133 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	17	49,714,294 - 49,727,664 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	17	47,733,086 - 47,785,809 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	17	55,017,444 - 55,030,555 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	17	55,020,284 - 55,033,396 (+)	NCBI
Celera	17	43,214,914 - 43,228,029 (+)	NCBI		Celera
Cytogenetic Map	17	q11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

genetic disease (ISO)

Greig cephalopolysyndactyly syndrome (ISO)

HIATT-NEU-COOPER NEURODEVELOPMENTAL SYNDROME (ISO)

intellectual disability (ISO)

pancreatic ductal adenocarcinoma (ISO)

pleomorphic xanthoastrocytoma (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-demecolcine (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4,6-tribromophenol (ISO)

2,4-dinitrotoluene (EXP)

2,6-dinitrotoluene (EXP)

2-hydroxypropanoic acid (ISO)

2-methylcholine (ISO)

2-nitrotoluene (EXP)

3,4-methylenedioxymethamphetamine (EXP)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-diaminodiphenylmethane (ISO)

4,4'-sulfonyldiphenol (ISO)

6-propyl-2-thiouracil (EXP)

acrylamide (EXP)

all-trans-retinoic acid (ISO)

amitrole (EXP)

ammonium chloride (EXP)

antirheumatic drug (ISO)

arsenite(3-) (ISO)

arsenous acid (ISO)

atazanavir sulfate (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

bisphenol A (EXP,ISO)

Bisphenol B (ISO)

bisphenol F (ISO)

bortezomib (ISO)

bromochloroacetic acid (EXP)

cadmium atom (ISO)

cadmium dichloride (ISO)

CGP 52608 (ISO)

chenodeoxycholic acid (ISO)

chloropicrin (ISO)

clofibrate (ISO)

cobalt dichloride (ISO)

copper(II) sulfate (ISO)

Cuprizon (EXP)

cyclosporin A (ISO)

deguelin (ISO)

deoxycholic acid (ISO)

dexamethasone (ISO)

diarsenic trioxide (ISO)

diazinon (ISO)

dichlorine (EXP)

doxorubicin (ISO)

ethyl methanesulfonate (ISO)

finasteride (EXP)

flutamide (EXP)

folic acid (ISO)

formaldehyde (ISO)

fulvestrant (ISO)

gamma-hexachlorocyclohexane (EXP)

glycochenodeoxycholic acid (ISO)

glycocholic acid (ISO)

glycodeoxycholic acid (ISO)

glyphosate (ISO)

haloperidol (EXP)

hydrogen cyanide (ISO)

indometacin (ISO)

ivermectin (ISO)

lipopolysaccharide (ISO)

methidathion (ISO)

methimazole (EXP)

methyl methanesulfonate (ISO)

methylmercury chloride (ISO)

N-methyl-4-phenylpyridinium (ISO)

nefazodone (ISO)

nickel atom (ISO)

ozone (EXP)

pentachlorophenol (ISO)

phenol red (ISO)

picoxystrobin (ISO)

pirinixic acid (EXP)

pyrimidifen (ISO)

quercetin (ISO)

rac-lactic acid (ISO)

reactive oxygen species (ISO)

rotenone (ISO)

sodium arsenite (ISO)

Soman (EXP)

sulfadimethoxine (EXP)

tert-butyl hydroperoxide (ISO)

tetrachloromethane (ISO)

thioacetamide (EXP)

trichloroethene (EXP)

valproic acid (ISO)

zoledronic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cell division (IEA)

establishment of protein localization to mitochondrion (ISO,ISS)

exocytosis (IEA)

membrane raft localization (ISO,ISS)

neural tube closure (ISO)

positive regulation of epidermal growth factor receptor signaling pathway (ISO)

positive regulation of filopodium assembly (ISO)

positive regulation of mitochondrial fission (ISO,ISS)

Ras protein signal transduction (IBA,ISO)

receptor internalization (ISO)

regulation of actin cytoskeleton organization (ISO)

regulation of exocytosis (IBA,ISO,ISS)

regulation of postsynaptic neurotransmitter receptor internalization (EXP,IDA,IMP)

signal transduction (IEA)

Cellular Component

cell surface (ISO)

cleavage furrow (ISO,ISS)

cytosol (TAS)

endocytic vesicle (ISO)

Flemming body (IEA)

focal adhesion (IEA,ISO)

membrane (IEA)

mitochondrion (ISO,ISS)

plasma membrane (IBA,ISO,ISS)

Schaffer collateral - CA1 synapse (EXP,IDA,IMP)

synaptic membrane (IDA,IEP)

Molecular Function

ATPase binding (ISO)

Edg-2 lysophosphatidic acid receptor binding (ISO,ISS)

G protein activity (IEA)

GDP binding (IBA,ISO)

GTP binding (IBA,IEA,ISO,NAS)

GTPase activity (IBA,IEA,ISO)

myosin binding (ISO)

protein binding (IPI,ISO)

ubiquitin protein ligase binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

ceramide signaling pathway (IEA)

pancreatic cancer pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Identification and characterization of Ral-binding protein 1, a potential downstream target of Ral GTPases.	Cantor SB, etal., Mol Cell Biol 1995 Aug;15(8):4578-84.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Regulated RalBP1 binding to RalA and PSD-95 controls AMPA receptor endocytosis and LTD.	Han K, etal., PLoS Biol. 2009 Sep;7(9):e1000187. Epub 2009 Sep 8.
4.	Dysregulation of KRAS signaling in pancreatic cancer is not associated with KRAS mutations and outcome.	Lemstrova R, etal., Oncol Lett. 2017 Nov;14(5):5980-5988. doi: 10.3892/ol.2017.6946. Epub 2017 Sep 14.
5.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
6.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
7.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
8.	GOA pipeline	RGD automated data pipeline
9.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
10.	Isolation of cDNA clones and tissue expression of rat ral A and ral B GTP-binding proteins.	Wildey GM, etal., Biochem Biophys Res Commun 1993 Jul 15;194(1):552-9.

Additional References at PubMed

PMID:10051605	PMID:15034142	PMID:15592429	PMID:15817490	PMID:15920473	PMID:15980073	PMID:16330713	PMID:17202486	PMID:17634366	PMID:17765682	PMID:17875936	PMID:18426794
PMID:18697830	PMID:18756269	PMID:19056867	PMID:19199708	PMID:19306925	PMID:19383721	PMID:19890390	PMID:20005108	PMID:20025911	PMID:20458337	PMID:21148297	PMID:21423176
PMID:22820503	PMID:22871113	PMID:23063435	PMID:23346930	PMID:23533145	PMID:24056301	PMID:24165023	PMID:25931508

Genomics

Comparative Map Data

Rala
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	17	47,092,163 - 47,145,192 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	17	47,092,207 - 47,144,063 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	17	50,320,930 - 50,334,044 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	17	54,323,855 - 54,336,969 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	17	48,425,724 - 48,438,842 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	17	49,676,073 - 49,729,133 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	17	49,714,294 - 49,727,664 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	17	47,733,086 - 47,785,809 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	17	55,017,444 - 55,030,555 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	17	55,020,284 - 55,033,396 (+)	NCBI
Celera	17	43,214,914 - 43,228,029 (+)	NCBI		Celera
Cytogenetic Map	17	q11	NCBI

RALA
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	7	39,623,572 - 39,708,120 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	7	39,623,565 - 39,708,120 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	7	39,663,171 - 39,747,719 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	7	39,629,687 - 39,714,244 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	7	39,436,401 - 39,520,955	NCBI
Celera	7	39,650,672 - 39,735,235 (+)	NCBI		Celera
Cytogenetic Map	7	p14.1	NCBI
HuRef	7	39,547,203 - 39,631,708 (+)	NCBI		HuRef
CHM1_1	7	39,665,812 - 39,750,388 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	7	39,781,130 - 39,865,684 (+)	NCBI		T2T-CHM13v2.0
CRA_TCAGchr7v2	7	39,701,014 - 39,785,596 (+)	NCBI

Rala
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	13	18,055,160 - 18,118,802 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	13	18,055,156 - 18,118,824 (-)	Ensembl		GRCm39 Ensembl
GRCm38	13	17,880,575 - 17,944,217 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	13	17,880,571 - 17,944,239 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	13	17,972,409 - 18,036,051 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	13	17,665,717 - 17,729,359 (-)	NCBI		MGSCv36	mm8
Celera	13	18,186,452 - 18,249,466 (-)	NCBI		Celera
Cytogenetic Map	13	A2	NCBI
cM Map	13	6.05	NCBI

Rala
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955460	3,789,136 - 3,808,676 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955460	3,789,136 - 3,853,315 (-)	NCBI	ChiLan1.0	ChiLan1.0

RALA
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	7	97,052,156 - 97,141,708 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	7	44,528,146 - 44,611,431 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	7	44,559,380 - 44,580,495 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	7	44,559,380 - 44,580,495 (-)	Ensembl	panpan1.1		panPan2

RALA
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	18	10,022,490 - 10,047,583 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	18	10,024,311 - 10,039,183 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	18	9,870,700 - 9,943,845 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	18	10,071,028 - 10,144,177 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	18	10,071,028 - 10,144,163 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	18	10,047,951 - 10,121,169 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	18	10,023,815 - 10,096,978 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	18	10,132,824 - 10,205,970 (-)	NCBI		UU_Cfam_GSD_1.0

Rala
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	95,943,354 - 95,974,863 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936478	15,167,751 - 15,186,633 (+)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936478	15,167,651 - 15,186,594 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

RALA
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	18	54,550,238 - 54,588,980 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	18	54,548,523 - 54,630,746 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	18	59,906,510 - 59,921,749 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

RALA
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	21	18,826,569 - 18,911,379 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	21	18,826,582 - 18,911,357 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666062	3,483,982 - 3,570,415 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Rala
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624740	21,281,602 - 21,346,928 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624740	21,281,678 - 21,347,109 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Rala
146 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	14
Count of miRNA genes:	14
Interacting mature miRNAs:	14
Transcripts:	ENSRNOT00000018190
Prediction methods:	Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1354658	Spl8	Serum phospholipid level QTL 8	3.8		blood VLDL phospholipid amount (VT:0010507)	blood very low density lipoprotein phospholipid level (CMO:0001571)	17	1	60781592	Rat
1354581	Bp247	Blood pressure QTL 247	4.5		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	17	1	69599340	Rat
1354662	Rf49	Renal function QTL 49	2.9		blood creatinine amount (VT:0005328)	plasma creatinine level (CMO:0000537)	17	1	69599340	Rat
1354596	Bw32	Body weight QTL 32	4.5		body mass (VT:0001259)	body weight (CMO:0000012)	17	4299130	60781592	Rat
1354630	Cm34	Cardiac mass QTL 34	8.7		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	17	4299130	69599340	Rat
1354638	Insul1	Insulin level QTL 1	4.8		blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	17	4299130	69599340	Rat
1354651	Lmblg2	Limb length QTL 2	6		tibia length (VT:0004357)	tibia length (CMO:0000450)	17	4299130	69599340	Rat
2303627	Vencon8	Ventilatory control QTL 8		0.001	respiration trait (VT:0001943)	tidal volume (CMO:0000222)	17	4528038	49528038	Rat
10054088	Scort28	Serum corticosterone level QTL 28	2.04	0.0102	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	17	4528038	49528038	Rat
2303561	Bw91	Body weight QTL 91	2		body mass (VT:0001259)	body weight (CMO:0000012)	17	8868462	53868462	Rat
1331765	Hrtrt15	Heart rate QTL 15	4.094		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	17	15330613	55836425	Rat
1354640	Scl32	Serum cholesterol level QTL 32	5.4		blood HDL cholesterol amount (VT:0000184)	blood high density lipoprotein cholesterol level (CMO:0000052)	17	15781592	60781592	Rat
1354659	Scl68	Serum cholesterol level QTL 68	3.9		blood VLDL cholesterol amount (VT:0005144)	blood very low density lipoprotein cholesterol level (CMO:0000648)	17	15781592	60781592	Rat
7394837	Memor18	Memory QTL 18			exploratory behavior trait (VT:0010471)	measurement of voluntary locomotion into, out of or within a discrete space in an experimental apparatus (CMO:0000957)	17	18640182	63640182	Rat
1354628	Stl13	Serum triglyceride level QTL 13	3.8		blood triglyceride amount (VT:0002644)	blood triglyceride level (CMO:0000118)	17	21293039	60781592	Rat
70157	Niddm32	Non-insulin dependent diabetes mellitus QTL 32	4.34		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	17	22454924	50909196	Rat
61394	Bp8	Blood pressure QTL 8	2.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	17	23080567	59555013	Rat
7488966	Bp370	Blood pressure QTL 370		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	23653184	57246843	Rat
12903978	Cm118	Cardiac mass QTL 118		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	17	23653184	68653184	Rat
12903979	Cm119	Cardiac mass QTL 119		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	17	23653184	68653184	Rat
12903980	Cm120	Cardiac mass QTL 120		0.002	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	17	23653184	68653184	Rat
12903981	Am17	Aortic mass QTL 17		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	17	23653184	68653184	Rat
1559055	Bp278	Blood pressure QTL 278		0.04	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	23653184	68653184	Rat
12903982	Kidm70	Kidney mass QTL 70		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	17	23653184	70974005	Rat
1354619	Bp242	Blood pressure QTL 242	6.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	17	24599340	69599340	Rat
1581512	Cm55	Cardiac mass QTL 55	2.8	0.05	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	17	27027949	56836890	Rat
4889955	Bss93	Bone structure and strength QTL 93	4.4		tibia size trait (VT:0100001)	tibia cortical bone volume to tibia total bone volume ratio (CMO:0001727)	17	27027949	60463643	Rat
2302377	Scl61	Serum cholesterol level QTL 61	4.36		blood HDL cholesterol amount (VT:0000184)	serum high density lipoprotein cholesterol level (CMO:0000361)	17	27389946	53481766	Rat
8552928	Pigfal9	Plasma insulin-like growth factor 1 level QTL 9	9		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	17	28409147	73409147	Rat
9590107	Sffal7	Serum free fatty acids level QTL 7	4.81	0.001	blood free fatty acid amount (VT:0001553)	plasma free fatty acids level (CMO:0000546)	17	28409147	73409147	Rat
10450503	Bp386	Blood pressure QTL 386		0.28	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	31368391	62109574	Rat
2324621	Coatc5	Coat color QTL 5			coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	17	31368391	73951021	Rat
2313854	Bp343	Blood pressure QTL 343	3.9		life span trait (VT:0005372)	age at time of death (CMO:0001193)	17	31990784	50909196	Rat
724549	Niddm56	Non-insulin dependent diabetes mellitus QTL 56		0.03	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	17	31990784	76990784	Rat
1354663	Bvd5	Brain ventricular dilatation QTL 5	3.51	0.001	brain ventricle morphology trait (VT:0000822)	hydrocephalus severity score (CMO:0001881)	17	31990784	81292925	Rat
1300148	Bp192	Blood pressure QTL 192	3.47		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	17	34550843	73951021	Rat
724528	Uae4	Urinary albumin excretion QTL 4	4.9	0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	17	35837085	69599340	Rat
2301412	Kidm40	Kidney mass QTL 40		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	17	37479847	82479847	Rat
2317054	Aia12	Adjuvant induced arthritis QTL 12	4.24		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	17	38281509	83281509	Rat
2317060	Aia26	Adjuvant induced arthritis QTL 26	3.22		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	17	38281509	83281509	Rat
1598871	Memor5	Memory QTL 5	5.3		exploratory behavior trait (VT:0010471)	total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443)	17	40540041	80387013	Rat
1358295	Aocep1	Aortic cell protein QTL 1	6.1	0.00000071	thoracic aorta cellular protein amount (VT:0010598)	aortic cell percentage	17	40990005	85990005	Rat
631497	Bp98	Blood pressure QTL 98	3.66		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	17	41354651	60463643	Rat
1354635	Bp245	Blood pressure QTL 245	6		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	17	42073160	69599340	Rat
1354635	Bp245	Blood pressure QTL 245	6		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	42073160	69599340	Rat

Markers in Region

Rasl1

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	17	47,133,327 - 47,133,456 (+)	MAPPER	mRatBN7.2
Rnor_6.0	17	49,717,271 - 49,717,399	NCBI	Rnor6.0
Rnor_5.0	17	47,773,947 - 47,774,075	UniSTS	Rnor5.0
RGSC_v3.4	17	55,020,425 - 55,020,553	UniSTS	RGSC3.4
Celera	17	43,217,895 - 43,218,023	UniSTS
Cytogenetic Map	17	q12.1	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	43	57	41	19	41	8	11	74	35	41	11	8
Low
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001414180	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_031093	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017600664	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039096109	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039096110	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039096111	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039096112	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH474030	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000293	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000018190 ⟹ ENSRNOP00000018190

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	17	47,092,207 - 47,144,063 (+)	Ensembl
Rnor_6.0 Ensembl	17	49,714,294 - 49,727,664 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000102020 ⟹ ENSRNOP00000090376

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	17	47,092,253 - 47,143,462 (+)	Ensembl

RefSeq Acc Id:

NM_001414180 ⟹ NP_001401109

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	17	47,092,163 - 47,145,192 (+)	NCBI

RefSeq Acc Id:

NM_031093 ⟹ NP_112355

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	17	47,092,163 - 47,145,192 (+)	NCBI
Rnor_6.0	17	49,714,290 - 49,727,401 (+)	NCBI
Rnor_5.0	17	47,733,086 - 47,785,809 (+)	NCBI
RGSC_v3.4	17	55,017,444 - 55,030,555 (+)	RGD
Celera	17	43,214,914 - 43,228,029 (+)	RGD

Sequence:

show sequence

CAGATTCTTTTCAGTCCTCTGAAGACTGCACACAGGATGGCTGCAAACAAGCCCAAGGGTCAGA
ATTCTTTGGCCTTACACAAAGTCATCATGGTGGGCAGTGGTGGTGTGGGCAAGTCTGCTCTGAC
TCTGCAGTTCATGTATGATGAGTTTGTAGAAGACTATGAACCTACCAAAGCAGACAGCTACAGG
AAGAAGGTAGTGCTGGATGGGGAGGAAGTGCAGATCGACATCTTAGATACAGCAGGGCAGGAAG
ACTACGCTGCAATTAGAGACAACTACTTCCGAAGTGGGGAAGGATTCCTCTGTGTCTTCTCTAT
CACAGAGATGGAGTCCTTTGCAGCTACAGCGGACTTCAGGGAACAGATTTTAAGAGTAAAAGAA
GATGAGAATGTCCCATTTCTCCTGGTTGGTAACAAATCAGATTTAGAAGATAAAAGGCAGGTTT
CTGTAGAAGAGGCAAAAAACAGAGCTGACCAGTGGAACGTTAACTATGTGGAGACGTCTGCTAA
AACGCGCGCCAACGTTGACAAGGTATTTTTTGATTTAATGAGGGAAATACGAGCCAGAAAGATG
GAAGACAGCAAAGAAAAAAATGGAAAAAAGAAGAGGAAAAGTTTAGCCAAGAGAATCAGAGAAA
GATGCTGCATTTTATAATCAAAGCCCAAACTCCTTTCTTATCCTGACCTGACCATACTAATAAA
TATAATTTAT

hide sequence

RefSeq Acc Id:

XM_039096109 ⟹ XP_038952037

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	17	47,123,475 - 47,145,192 (+)	NCBI

RefSeq Acc Id:

XM_039096110 ⟹ XP_038952038

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	17	47,129,356 - 47,145,192 (+)	NCBI

RefSeq Acc Id:

XM_039096111 ⟹ XP_038952039

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	17	47,093,065 - 47,145,192 (+)	NCBI

RefSeq Acc Id:

XM_039096112 ⟹ XP_038952040

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	17	47,092,604 - 47,145,192 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001401109	(Get FASTA)	NCBI Sequence Viewer
	NP_112355	(Get FASTA)	NCBI Sequence Viewer
	XP_038952037	(Get FASTA)	NCBI Sequence Viewer
	XP_038952038	(Get FASTA)	NCBI Sequence Viewer
	XP_038952039	(Get FASTA)	NCBI Sequence Viewer
	XP_038952040	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL87394	(Get FASTA)	NCBI Sequence Viewer
	EDL87395	(Get FASTA)	NCBI Sequence Viewer
	EDL87396	(Get FASTA)	NCBI Sequence Viewer
	P63322	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_112355 ⟸ NM_031093

- UniProtKB:

P63322 (UniProtKB/Swiss-Prot), A6K9A2 (UniProtKB/TrEMBL), A0A8L2Q942 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MAANKPKGQNSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQI
DILDTAGQEDYAAIRDNYFRSGEGFLCVFSITEMESFAATADFREQILRVKEDENVPFLLVGNK
SDLEDKRQVSVEEAKNRADQWNVNYVETSAKTRANVDKVFFDLMREIRARKMEDSKEKNGKKKR
KSLAKRIRERCCIL

hide sequence

RefSeq Acc Id:

ENSRNOP00000018190 ⟸ ENSRNOT00000018190

RefSeq Acc Id:	XP_038952040 ⟸ XM_039096112
- Peptide Label:	isoform X2
- UniProtKB:	P63322 (UniProtKB/Swiss-Prot), A6K9A2 (UniProtKB/TrEMBL), A0A8L2Q942 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038952039 ⟸ XM_039096111
- Peptide Label:	isoform X2
- UniProtKB:	P63322 (UniProtKB/Swiss-Prot), A6K9A2 (UniProtKB/TrEMBL), A0A8L2Q942 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038952037 ⟸ XM_039096109
- Peptide Label:	isoform X1
- UniProtKB:	A0A8L2Q942 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038952038 ⟸ XM_039096110
- Peptide Label:	isoform X2
- UniProtKB:	P63322 (UniProtKB/Swiss-Prot), A6K9A2 (UniProtKB/TrEMBL), A0A8L2Q942 (UniProtKB/TrEMBL)

RefSeq Acc Id:

ENSRNOP00000090376 ⟸ ENSRNOT00000102020

RefSeq Acc Id:	NP_001401109 ⟸ NM_001414180
- UniProtKB:	P63322 (UniProtKB/Swiss-Prot), A6K9A2 (UniProtKB/TrEMBL), A0A8L2Q942 (UniProtKB/TrEMBL)

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P63322-F1-model_v2	AlphaFold	P63322	1-206	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:619851	AgrOrtholog
BioCyc Gene	G2FUF-9115	BioCyc
Ensembl Genes	ENSRNOG00000013454	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000018190	ENTREZGENE
	ENSRNOP00000018190.3	UniProtKB/TrEMBL
	ENSRNOP00000090376	ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000018190	ENTREZGENE
	ENSRNOT00000018190.5	UniProtKB/TrEMBL
	ENSRNOT00000102020	ENTREZGENE, UniProtKB/Swiss-Prot
Gene3D-CATH	3.40.50.300	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	P-loop_NTPase	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Small_GTP-bd_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Small_GTPase	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Small_GTPase_Ras-type	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:81757	UniProtKB/Swiss-Prot
NCBI Gene	81757	ENTREZGENE
PANTHER	PTHR24070	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR24070:SF174	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Ras	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Rala	PhenoGen
PRINTS	RASTRNSFRMNG	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	RAB	UniProtKB/TrEMBL
	RAS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	RHO	UniProtKB/TrEMBL
SMART	RAB	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	RAN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	RAS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	RHO	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF52540	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A8L2Q942	ENTREZGENE, UniProtKB/TrEMBL
	A6K9A1_RAT	UniProtKB/TrEMBL
	A6K9A2	ENTREZGENE, UniProtKB/TrEMBL
	A6K9A3_RAT	UniProtKB/TrEMBL
	P63322	ENTREZGENE, UniProtKB/Swiss-Prot
UniProt Secondary	P05810	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-08-24	Rala	RAS like proto-oncogene A	Rala	RALA Ras like proto-oncogene A	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2016-05-20	Rala	RALA Ras like proto-oncogene A	Rala	v-ral simian leukemia viral oncogene homolog A (ras related)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-09-10	Rala	v-ral simian leukemia viral oncogene homolog A (ras related)			Symbol and Name status set to approved	1299863	APPROVED
2002-08-07	Rala	#NAME?			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_transcript	has two transcripts approximately 1.1 kb in size and a 2.9 kb transcript	633818

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)