Gper1 (G protein-coupled estrogen receptor 1)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Gper1 (G protein-coupled estrogen receptor 1) Rattus norvegicus

Analyze

Symbol:

Gper1

Name:

G protein-coupled estrogen receptor 1

RGD ID:

619845

Description:

Enables G protein-coupled estrogen receptor activity and estradiol binding activity. Involved in several processes, including apoptotic nuclear changes; cellular response to organic cyclic compound; and positive regulation of signal transduction. Acts upstream of with a positive effect on vasodilation. Located in several cellular components, including dendrite; postsynaptic density; and presynaptic membrane. Orthologous to human GPER1 (G protein-coupled estrogen receptor 1); PARTICIPATES IN epidermal growth factor/neuregulin signaling pathway; estrogen signaling pathway; serotonin signaling pathway; INTERACTS WITH (S)-amphetamine; 1,3,5-trinitro-1,3,5-triazinane; 17beta-estradiol.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

chemoattractant receptor-like 2; chemokine receptor-like 2; G protein-coupled receptor 30; G-protein coupled estrogen receptor 1; G-protein coupled receptor 30; G-protein coupled receptor 41; Gper; Gpr30; GPR41; membrane estrogen receptor; mER

RGD Orthologs

Alliance Genes

More Info

more info ...

Allele / Splice:

Gper1^em1Bj

Genetic Models:

SS-Gper1^em1Bj-/-

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	12	15,217,217 - 15,222,679 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	15,217,442 - 15,221,889 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	12	16,027,880 - 16,029,158 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	12	16,651,625 - 16,652,903 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	12	15,677,933 - 15,679,211 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	12	17,309,122 - 17,315,267 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	17,309,834 - 17,311,112 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	12	19,296,086 - 19,301,691 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	12	15,718,615 - 15,719,893 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	12	15,748,542 - 15,749,821 (-)	NCBI
Celera	12	16,971,703 - 16,972,981 (-)	NCBI		Celera
Cytogenetic Map	12	q11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Breast Neoplasms (ISO)

COVID-19 (ISO)

Dysbiosis (IMP)

endometriosis (ISO)

generalized anxiety disorder (ISO)

genetic disease (ISO)

Hepatomegaly (ISO)

Hyperalgesia (ISO)

idiopathic pulmonary fibrosis (ISO)

leiomyoma (ISO)

Liver Neoplasms (ISO)

melanoma (ISO)

Multiple Abnormalities (ISO)

Spinal Cord Injuries (IMP)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(S)-amphetamine (EXP)

(S)-naringenin (ISO)

1,2-dimethylhydrazine (ISO)

1,3,5-trinitro-1,3,5-triazinane (EXP)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (EXP,ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,2',4,5'-Tetrabromodiphenyl ether (ISO)

2,2-(2-Chlorophenyl-4'-chlorophenyl)-1,1-dichloroethene (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2,3-dimethoxynaphthalene-1,4-dione (ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

3,3',5,5'-tetrabromobisphenol A (ISO)

4,4'-sulfonyldiphenol (ISO)

4,4'-thiodiphenol (ISO)

4-nonylphenol (ISO)

4-tert-Octylphenol (ISO)

5-aza-2'-deoxycytidine (ISO)

6-propyl-2-thiouracil (EXP)

afimoxifene (ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

ammonium chloride (EXP)

antirheumatic drug (ISO)

aristolochic acid A (ISO)

arsenite(3-) (ISO)

arsenous acid (ISO)

atrazine (EXP,ISO)

benzo[a]pyrene (ISO)

Benzo[ghi]perylene (ISO)

bis(2-ethylhexyl) phthalate (EXP,ISO)

bisphenol A (EXP,ISO)

Bisphenol B (ISO)

bisphenol F (EXP,ISO)

Butylparaben (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

chlordecone (ISO)

chlorpyrifos (ISO)

chromium atom (ISO)

cisplatin (ISO)

clobetasol (ISO)

cocaine (EXP)

copper(II) sulfate (ISO)

coumestrol (ISO)

cumene (ISO)

curcumin (ISO)

cyclosporin A (ISO)

cytarabine (ISO)

DDT (ISO)

dehydroepiandrosterone (ISO)

dexamethasone (ISO)

diarsenic trioxide (ISO)

dibutyl phthalate (EXP)

diethylstilbestrol (ISO)

dioxygen (ISO)

endosulfan (EXP)

folic acid (ISO)

fulvestrant (ISO)

gefitinib (ISO)

genistein (ISO)

glyphosate (EXP)

herbicide (EXP)

hydroquinone O-beta-D-glucopyranoside (ISO)

KT 5720 (EXP)

KT 5823 (ISO)

LY294002 (EXP)

manganese atom (EXP)

manganese(0) (EXP)

mercury atom (ISO)

mercury(0) (ISO)

mestranol (ISO)

methimazole (EXP)

methylparaben (ISO)

N-[2-(4-bromocinnamylamino)ethyl]isoquinoline-5-sulfonamide (EXP)

N-nitrosodimethylamine (ISO)

nickel atom (ISO)

nickel dichloride (ISO)

nickel sulfate (ISO)

Nonylphenol (EXP,ISO)

oxybenzone (EXP)

p-tert-Amylphenol (ISO)

paracetamol (ISO)

paraquat (EXP)

perfluorononanoic acid (ISO)

phenobarbital (ISO)

potassium dichromate (ISO)

propylparaben (ISO)

puerarin (ISO)

pyrrolidine dithiocarbamate (EXP)

quercetin (ISO)

quinazolines (EXP)

raloxifene (EXP,ISO)

resveratrol (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

silicon dioxide (ISO)

sirolimus (ISO)

sodium arsenite (ISO)

sulforaphane (ISO)

sunitinib (ISO)

tamoxifen (ISO)

temozolomide (ISO)

tert-butyl hydroperoxide (ISO)

testosterone (ISO)

Tetrachlorobisphenol A (ISO)

toluene (EXP)

triclocarban (EXP)

tyrphostin AG 1478 (EXP,ISO)

urethane (ISO)

valproic acid (ISO)

vinclozolin (EXP,ISO)

wortmannin (ISO)

zearalenone (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

adenylate cyclase-activating G protein-coupled receptor signaling pathway (IEA,ISO,ISS)

apoptotic chromosome condensation (IDA)

cell differentiation (IEA)

cellular response to estradiol stimulus (IBA,IDA,IEA,ISO,ISS)

cellular response to glucose stimulus (IEA,ISO,ISS)

cellular response to mineralocorticoid stimulus (IDA)

cellular response to peptide hormone stimulus (IEA,ISO,ISS)

cellular response to tumor necrosis factor (IEA,ISO,ISS)

G protein-coupled receptor signaling pathway (ISO)

inflammatory response (IEA)

innate immune response (IEA)

intracellular estrogen receptor signaling pathway (IMP)

intracellular steroid hormone receptor signaling pathway (IBA,IDA,IEA,ISO)

modulation of chemical synaptic transmission (IEA,ISO)

negative regulation of cell cycle process (IEA,ISO)

negative regulation of cell population proliferation (IDA)

negative regulation of ERK1 and ERK2 cascade (IEA,ISO)

negative regulation of fat cell differentiation (IEA,ISO,ISS)

negative regulation of gene expression (IDA,IEA,ISO)

negative regulation of inflammatory response (IEA,ISO,ISS)

negative regulation of leukocyte activation (IEA,ISO,ISS)

negative regulation of lipid biosynthetic process (IEA,ISO,ISS)

negative regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction (IEA,ISO)

negative regulation of receptor binding (IMP)

negative regulation of vascular associated smooth muscle cell migration (ISO)

negative regulation of vascular associated smooth muscle cell proliferation (IEA,ISO)

nervous system development (IEA)

neuronal action potential (ISS)

nuclear fragmentation involved in apoptotic nuclear change (IDA)

positive regulation of apoptotic process (IDA,IMP)

positive regulation of cardiac vascular smooth muscle cell differentiation (IEA,ISO)

positive regulation of cell migration (IEA,ISO,ISS)

positive regulation of cell population proliferation (IEA,ISO,ISS)

positive regulation of cytosolic calcium ion concentration (IEA,ISO,ISS)

positive regulation of endothelial cell apoptotic process (IDA)

positive regulation of epidermal growth factor receptor signaling pathway (IEA,IMP,ISO)

positive regulation of ERK1 and ERK2 cascade (IDA,IEA,IMP,ISO)

positive regulation of extrinsic apoptotic signaling pathway (IDA)

positive regulation of G protein-coupled receptor signaling pathway (IEA,ISO,ISS)

positive regulation of gene expression (IDA,IEA,IMP,ISO)

positive regulation of inositol trisphosphate biosynthetic process (IEA,ISO,ISS)

positive regulation of insulin secretion (IEA,ISO,ISS)

positive regulation of MAPK cascade (ISO,ISS)

positive regulation of neurogenesis (IEA,ISO,ISS)

positive regulation of neurotransmitter secretion (ISS)

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction (IDA,IEA,IMP,ISO)

positive regulation of protein import into nucleus (IMP)

positive regulation of protein localization to plasma membrane (IEA,ISO,ISS)

positive regulation of protein phosphorylation (IEA,IMP,ISO)

positive regulation of release of cytochrome c from mitochondria (IDA)

positive regulation of release of sequestered calcium ion into cytosol (IEA,ISO,ISS)

positive regulation of transcription by RNA polymerase II (IEA,ISO,ISS)

positive regulation of uterine smooth muscle contraction (IEA,ISO,ISS)

positive regulation of voltage-gated sodium channel activity (IMP)

regulation of cell cycle (ISO,ISS)

regulation of cytosolic calcium ion concentration (ISS)

serotonin receptor signaling pathway (IMP)

steroid hormone mediated signaling pathway (ISO)

vasodilation (IDA,IMP)

Cellular Component

axon (IDA)

axon terminus (IDA)

cytoplasm (IDA,ISO,ISS)

cytoplasmic vesicle membrane (IEA,ISO,ISS)

cytosol (IEA,ISO)

dendrite (IDA)

dendritic shaft (IDA)

dendritic spine head (IDA)

dendritic spine membrane (IDA)

early endosome (IEA,ISO,ISS)

endoplasmic reticulum (IEA,ISO,ISS)

endoplasmic reticulum membrane (IDA)

Golgi apparatus (IBA,IDA,ISO,ISS)

Golgi membrane (IEA)

hippocampal mossy fiber to CA3 synapse (IEA,ISO)

intracellular membrane-bounded organelle (ISO)

keratin filament (IEA,ISO,ISS)

mitochondrial membrane (IDA)

neuronal cell body (IDA)

nuclear envelope (IEA,ISO,ISS)

nucleolus (IEA,ISO)

nucleoplasm (IEA,ISO)

nucleus (ISO,ISS)

perinuclear region of cytoplasm (IEA,ISO,ISS)

plasma membrane (IDA,IEA,ISO)

postsynaptic density (IDA)

presynaptic active zone (IDA)

presynaptic membrane (IDA)

recycling endosome (IEA,ISO,ISS)

trans-Golgi network (IEA,ISO,ISS)

Molecular Function

chromatin binding (IEA,ISO)

estradiol binding (IMP)

G protein-coupled estrogen receptor activity (IDA)

G protein-coupled receptor activity (IEA)

nuclear estrogen receptor activity (IBA,IEA,ISO)

protein binding (ISO)

steroid binding (ISO)

steroid hormone binding (IEA,ISO,ISS)

Molecular Pathway Annotations Click to see Annotation Detail View

bisphenol A response pathway (ISO)

epidermal growth factor/neuregulin signaling pathway (IMP)

estrogen signaling pathway (IDA,IMP,ISO)

G protein mediated signaling pathway via Galphas family (ISO)

serotonin signaling pathway (IMP)

the extracellular signal-regulated Raf/Mek/Erk signaling pathway (IMP)

Phenotype Annotations Click to see Annotation Detail View

Mammalian Phenotype

abnormal free fatty acids level (IMP)

decreased mean systemic arterial blood pressure (IMP)

decreased pulse pressure (IMP)

decreased systemic arterial diastolic blood pressure (IMP)

decreased systemic arterial systolic blood pressure (IMP)

increased body length (IMP)

increased body weight (IMP)

increased vasodilation (IMP)

References

References - curated

#	Reference Title	Reference Citation
1.	Estrogen receptors are found in glia and at extranuclear neuronal sites in the dorsal striatum of female rats: evidence for cholinergic but not dopaminergic colocalization.	Almey A, etal., Endocrinology. 2012 Nov;153(11):5373-83. doi: 10.1210/en.2012-1458. Epub 2012 Aug 23.
2.	The roles of membrane estrogen receptor subtypes in modulating dopamine transporters in PC-12 cells.	Alyea RA, etal., J Neurochem. 2008 Aug;106(4):1525-33. Epub 2008 May 19.
3.	Breast cancer, estrogen receptor and ligands.	Bai Z and Gust R, Arch Pharm (Weinheim). 2009 Mar;342(3):133-49.
4.	Molecular cloning and tissue expression of a novel orphan G protein-coupled receptor from rat lung.	Bonini JA, etal., Biochem Biophys Res Commun 1997 May 8;234(1):190-3.
5.	Selective GPER activation decreases proliferation and activates apoptosis in tumor Leydig cells.	Chimento A, etal., Cell Death Dis. 2013 Aug 1;4:e747. doi: 10.1038/cddis.2013.275.
6.	Structural and mechanistic insights into bisphenols action provide guidelines for risk assessment and discovery of bisphenol A substitutes.	Delfosse V, etal., Proc Natl Acad Sci U S A. 2012 Sep 11;109(37):14930-5. doi: 10.1073/pnas.1203574109. Epub 2012 Aug 27.
7.	Activation of a novel estrogen receptor, GPER, is cardioprotective in male and female rats.	Deschamps AM and Murphy E, Am J Physiol Heart Circ Physiol. 2009 Nov;297(5):H1806-13. Epub 2009 Aug 28.
8.	Serum levels of G protein-coupled estrogen receptor 1 (GPER1) in drug-naive patients with generalized anxiety disorder.	Fındıklı E, etal., Psychiatry Res. 2016 Oct 30;244:312-6. doi: 10.1016/j.psychres.2016.04.098. Epub 2016 Jul 22.
9.	Expression of G protein-coupled oestrogen receptor in melanoma and in pregnancy-associated melanoma.	Fábián M, etal., J Eur Acad Dermatol Venereol. 2017 Sep;31(9):1453-1461. doi: 10.1111/jdv.14304. Epub 2017 Jun 20.
10.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
11.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
12.	Estradiol activates epithelial sodium channels in rat alveolar cells through the G protein-coupled estrogen receptor.	Greenlee MM, etal., Am J Physiol Lung Cell Mol Physiol. 2013 Dec;305(11):L878-89. doi: 10.1152/ajplung.00008.2013. Epub 2013 Oct 4.
13.	Aldosterone mediates its rapid effects in vascular endothelial cells through GPER activation.	Gros R, etal., Am J Physiol Cell Physiol. 2013 Mar;304(6):C532-40. doi: 10.1152/ajpcell.00203.2012. Epub 2013 Jan 2.
14.	G-protein coupled estrogen receptor 1 mediated estrogenic neuroprotection against spinal cord injury.	Hu R, etal., Crit Care Med. 2012 Dec;40(12):3230-7. doi: 10.1097/CCM.0b013e3182657560.
15.	2-methoxyestradiol binding of GPR30 down-regulates angiotensin AT(1) receptor.	Koganti S, etal., Eur J Pharmacol. 2014 Jan 15;723:131-40. doi: 10.1016/j.ejphar.2013.10.064. Epub 2013 Nov 18.
16.	G protein-coupled estrogen receptor1 (GPER1) may mediate Rho-kinase (ROCK-2) up-regulation in coronary endothelial cells.	Kurt AH, etal., Endocr Regul. 2013 Apr;47(2):75-84. doi: 10.4149/endo_2013_02_75.
17.	Expression and signaling of G protein-coupled estrogen receptor 1 (GPER) in rat sertoli cells.	Lucas TF, etal., Biol Reprod. 2010 Aug 1;83(2):307-17. Epub 2010 May 5.
18.	The unfolding stories of GPR30, a new membrane-bound estrogen receptor.	Maggiolini M and Picard D, J Endocrinol. 2010 Feb;204(2):105-14. Epub 2009 Sep 18.
19.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
20.	Spatial and temporal changes in the expression of steroid hormone receptors in mouse model of endometriosis.	Mishra A, etal., J Assist Reprod Genet. 2020 May;37(5):1069-1081. doi: 10.1007/s10815-020-01725-6. Epub 2020 Mar 9.
21.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
22.	Bisphenol A and human chronic diseases: Current evidences, possible mechanisms, and future perspectives.	Rezg R, etal., Environ Int. 2014 Mar;64C:83-90. doi: 10.1016/j.envint.2013.12.007. Epub 2013 Dec 29.
23.	GOA pipeline	RGD automated data pipeline
24.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
25.	Expression of the G protein-coupled estrogen receptor (GPER) in endometriosis: a tissue microarray study.	Samartzis N, etal., Reprod Biol Endocrinol. 2012 Apr 20;10:30. doi: 10.1186/1477-7827-10-30.
26.	G-protein oestrogen receptor 1: trials and tribulations of a membrane oestrogen receptor.	Srivastava DP and Evans PD, J Neuroendocrinol. 2013 Nov;25(11):1219-30. doi: 10.1111/jne.12071.
27.	Attenuation of Microbiotal Dysbiosis and Hypertension in a CRISPR/Cas9 Gene Ablation Rat Model of GPER1.	Waghulde H, etal., Hypertension. 2018 Nov;72(5):1125-1132. doi: 10.1161/HYPERTENSIONAHA.118.11175.
28.	Extra-nuclear estrogen receptor GPR30 regulates serotonin function in rat hypothalamus.	Xu H, etal., Neuroscience. 2009 Feb 18;158(4):1599-607. doi: 10.1016/j.neuroscience.2008.11.028. Epub 2008 Nov 21.

Additional References at PubMed

PMID:15539556	PMID:15705806	PMID:16780796	PMID:17872373	PMID:18586395	PMID:19125412	PMID:19179659	PMID:19220308	PMID:19420011	PMID:19523168	PMID:19741198	PMID:19912997
PMID:19931550	PMID:20132863	PMID:20347696	PMID:20434187	PMID:20551055	PMID:20596598	PMID:20696528	PMID:20969598	PMID:21149639	PMID:21242460	PMID:21365775	PMID:21427217
PMID:21540189	PMID:21673097	PMID:21844484	PMID:21865584	PMID:22265196	PMID:22328091	PMID:22378360	PMID:22645130	PMID:22828404	PMID:23066016	PMID:23285008	PMID:23300088
PMID:23545157	PMID:23610132	PMID:23659385	PMID:23673155	PMID:23674134	PMID:23836701	PMID:23840305	PMID:23871778	PMID:23950890	PMID:24115158	PMID:24594140	PMID:24736568
PMID:24793639	PMID:25150623	PMID:25211590	PMID:25256868	PMID:25280432	PMID:25310566	PMID:25712524	PMID:25893735	PMID:25936661	PMID:26070386	PMID:26181370	PMID:26187146
PMID:26241029	PMID:26345541	PMID:26371374	PMID:26391661	PMID:26408543	PMID:26497404	PMID:26628039	PMID:27080432	PMID:27173878	PMID:27249584	PMID:27311857	PMID:27608844
PMID:27698063	PMID:27849354	PMID:27908726	PMID:28472669	PMID:28733475	PMID:29369009	PMID:29421611	PMID:30218860	PMID:30227089	PMID:30400046	PMID:30570746	PMID:30731078
PMID:31728701	PMID:32007102	PMID:32272225	PMID:32303987	PMID:32321426	PMID:32632943	PMID:32908490	PMID:33127751	PMID:33193095	PMID:33345973	PMID:33629579	PMID:34076791
PMID:34255932	PMID:34274445	PMID:34352396	PMID:34399010	PMID:35124781	PMID:35170266	PMID:35729568	PMID:35803362	PMID:36108979	PMID:36152742	PMID:36845134	PMID:37257405

Genomics

Comparative Map Data

Gper1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	12	15,217,217 - 15,222,679 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	15,217,442 - 15,221,889 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	12	16,027,880 - 16,029,158 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	12	16,651,625 - 16,652,903 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	12	15,677,933 - 15,679,211 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	12	17,309,122 - 17,315,267 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	17,309,834 - 17,311,112 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	12	19,296,086 - 19,301,691 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	12	15,718,615 - 15,719,893 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	12	15,748,542 - 15,749,821 (-)	NCBI
Celera	12	16,971,703 - 16,972,981 (-)	NCBI		Celera
Cytogenetic Map	12	q11	NCBI

GPER1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	7	1,087,118 - 1,093,810 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	7	1,082,208 - 1,093,815 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	7	1,126,754 - 1,133,446 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	7	1,092,969 - 1,099,977 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	7	899,752 - 906,692	NCBI
Celera	7	1,094,088 - 1,101,068 (+)	NCBI		Celera
Cytogenetic Map	7	p22.3	NCBI
HuRef	7	1,041,713 - 1,048,693 (+)	NCBI		HuRef
CHM1_1	7	1,126,080 - 1,133,090 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	7	1,192,020 - 1,198,681 (+)	NCBI		T2T-CHM13v2.0
CRA_TCAGchr7v2	7	1,180,870 - 1,187,850 (+)	NCBI

Gper1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	5	139,408,905 - 139,413,555 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	5	139,408,906 - 139,413,555 (+)	Ensembl		GRCm39 Ensembl
GRCm38	5	139,423,150 - 139,427,800 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	5	139,423,151 - 139,427,800 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	5	139,899,133 - 139,903,754 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	5	139,676,821 - 139,681,430 (+)	NCBI		MGSCv36	mm8
Celera	5	136,477,197 - 136,481,822 (+)	NCBI		Celera
Cytogenetic Map	5	G2	NCBI
cM Map	5	78.58	NCBI

Gper1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955460	8,790,798 - 8,794,902 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955460	8,790,798 - 8,794,902 (+)	NCBI	ChiLan1.0	ChiLan1.0

GPER1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	7	54,349,340 - 54,364,886 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	7	1,331,586 - 1,338,194 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	7	1,454,768 - 1,461,376 (+)	NCBI	panpan1.1	PanPan1.1	panPan2

GPER1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	6	15,792,072 - 15,796,922 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	6	15,792,897 - 15,794,051 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	6	17,265,181 - 17,311,159 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	6	15,922,801 - 15,968,766 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	6	15,922,807 - 15,927,433 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	6	15,725,481 - 15,771,429 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	6	15,652,239 - 15,698,182 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	6	15,940,139 - 15,986,136 (-)	NCBI		UU_Cfam_GSD_1.0

Gper1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409344	143,716,868 - 143,723,998 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936754	1,288,912 - 1,293,427 (+)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936754	1,288,891 - 1,293,555 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

GPER1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	3	712,160 - 715,980 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	3	711,427 - 715,982 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	3	828,578 - 833,139 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

GPER1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	28	20,491,874 - 20,497,966 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	28	20,492,188 - 20,493,315 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666090	1,198,018 - 1,204,300 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Gper1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624740	26,627,473 - 26,632,027 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624740	26,627,560 - 26,632,483 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Gper1
18 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	83
Count of miRNA genes:	74
Interacting mature miRNAs:	74
Transcripts:	ENSRNOT00000001732
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2312418	Kidm41	Kidney mass QTL 41	3.7	0.0001	kidney mass (VT:0002707)	single kidney wet weight to body weight ratio (CMO:0000622)	12	1	19611090	Rat
10755457	Coatc14	Coat color QTL 14		0.01759	coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	12	1	22591684	Rat
6893681	Bw109	Body weight QTL 109	2.3	0.004	body mass (VT:0001259)	body weight (CMO:0000012)	12	1	23297788	Rat
1581516	Cm56	Cardiac mass QTL 56	4.2	0.05	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	12	1	29333307	Rat
1598855	Bp294	Blood pressure QTL 294	3.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	1	34851688	Rat
7411660	Foco28	Food consumption QTL 28	10.9	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	1	42110980	Rat
9590086	Insglur6	Insulin/glucose ratio QTL 6	18.97	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	12	1	42110980	Rat
8694179	Bw150	Body weight QTL 150	2.9	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	12	1	42110980	Rat
7411586	Foco5	Food consumption QTL 5	5.4	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	1	42110980	Rat
7411595	Foco9	Food consumption QTL 9	4	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	1	42110980	Rat
7411545	Bw128	Body weight QTL 128	5.2	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	12	1	42110980	Rat
9590147	Scort7	Serum corticosterone level QTL 7	13.61	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	12	1	42110980	Rat
2303575	Insul14	Insulin level QTL 14	4		blood insulin amount (VT:0001560)	blood insulin level (CMO:0000349)	12	1	42450532	Rat
737979	Pia22	Pristane induced arthritis QTL 22	53.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	1	44465750	Rat
634351	Apr5	Acute phase response QTL 5	6.7		blood interleukin-6 amount (VT:0008595)	plasma interleukin-6 level (CMO:0001927)	12	1	44503507	Rat
2302042	Pia38	Pristane induced arthritis QTL 38	3.5	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	12	1	44503507	Rat
634350	Apr4	Acute phase response QTL 4	6		orosomucoid 1 amount (VT:0010541)	plasma orosomucoid 1 level (CMO:0001467)	12	1172005	46172005	Rat
8552918	Pigfal7	Plasma insulin-like growth factor 1 level QTL 7			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	5564495	46669029	Rat
7411547	Bw129	Body weight QTL 129		0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	6	5564495	46669029	Rat
7411597	Foco10	Food consumption QTL 10		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	5564495	46669029	Rat
7411641	Foco19	Food consumption QTL 19	27.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	5564495	46669029	Rat
8552964	Pigfal17	Plasma insulin-like growth factor 1 level QTL 17	3.5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	5564495	46669029	Rat
7411588	Foco6	Food consumption QTL 6		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	5564495	46669029	Rat
8552912	Pigfal6	Plasma insulin-like growth factor 1 level QTL 6	5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	5564498	46669029	Rat
10059594	Kidm46	Kidney mass QTL 46	3.79	0.025	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	12	6107579	46669029	Rat
1600391	Edcs2	Endometrial carcinoma susceptibility QTL2	3.5	0.01	uterus morphology trait (VT:0001120)	percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759)	12	6833190	17870186	Rat
1302792	Scl21	Serum cholesterol level QTL 21	3.8	0.0011	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	12	7196730	46669029	Rat
2293086	Iddm30	Insulin dependent diabetes mellitus QTL 30	3.82		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	8449490	28302290	Rat
61331	Eau2	Experimental allergic uveoretinitis QTL 2		0.0005	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	12	8525423	28064601	Rat
1300157	Rf21	Renal function QTL 21	4.4		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	12	9318216	32103380	Rat
1549829	Scl48	Serum cholesterol level QTL 48	5		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	12	9603277	46669029	Rat
2293699	Bss49	Bone structure and strength QTL 49	5.61	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra trabecular cross-sectional area (CMO:0001692)	12	10474137	46669029	Rat
2300186	Bmd59	Bone mineral density QTL 59	7.1	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	12	10474137	46669029	Rat
1331786	Kidm11	Kidney mass QTL 11	3.571		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	12	11073825	24234895	Rat
1331755	Bp219	Blood pressure QTL 219	3.041		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	12	11073825	28064557	Rat
1331761	Bp218	Blood pressure QTL 218	2.973		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	12	11073825	45055165	Rat
61404	Bw120	Body weight QTL 120	5.1		body mass (VT:0001259)	body mass index (BMI) (CMO:0000105)	12	12351619	46669029	Rat
1641928	Alcrsp5	Alcohol response QTL 5			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	12	12812385	46669029	Rat
2303569	Gluco44	Glucose level QTL 44	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	12812385	46669029	Rat
7204484	Bp358	Blood pressure QTL 358		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	12	13008296	19212979	Rat
1549902	Bp269	Blood pressure QTL 269			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	13182736	46669029	Rat
1549912	Bp268	Blood pressure QTL 268			arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	10	13182736	46669029	Rat
2302060	Pia37	Pristane induced arthritis QTL 37	6.1	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	12	13198157	46669029	Rat
61416	Pia4	Pristane induced arthritis QTL 4	8.4		joint integrity trait (VT:0010548)	arthritic paw count (CMO:0001460)	12	13635523	30827399	Rat
61421	Cia12	Collagen induced arthritis QTL 12	4.6		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	13635523	35682913	Rat
61443	Btemp2	Thermal response to stress QTL 2	3.3	0.000094	body temperature trait (VT:0005535)	core body temperature (CMO:0001036)	12	15025183	20794014	Rat

Genetic Models

This gene Gper1 is modified in the following models/strains

SS-Gper1^em1Bj-/-

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium
Low	2	32	24	8	18	8	4	5	68	29	27	11	4
Below cutoff	1	11	26	26	1	26	4	6	6	6	14		4

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_133573	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006248914	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039089048	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH474012	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000225	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U92802	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000001732 ⟹ ENSRNOP00000001732

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	12	15,217,442 - 15,221,889 (-)	Ensembl
Rnor_6.0 Ensembl	12	17,309,834 - 17,311,112 (-)	Ensembl

RefSeq Acc Id:

NM_133573 ⟹ NP_598257

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	12	15,217,935 - 15,219,213 (-)	NCBI
Rnor_6.0	12	17,309,834 - 17,311,112 (-)	NCBI
Rnor_5.0	12	19,296,086 - 19,301,691 (-)	NCBI
RGSC_v3.4	12	15,718,615 - 15,719,893 (-)	RGD
Celera	12	16,971,703 - 16,972,981 (-)	RGD

Sequence:

show sequence

TTCTGTGACCCTTTCAGCAAGTCCTGAAAGCTTCTACGGGAAGCCATGGCTGCAACTACTCCAG
CACAAGATGTTGGCGTAGAGATCTACCTAGGTCCCGTGTGGCCAGCCCCTTCCAACAGCACCCC
TCTGGCCCTCAACCTGTCCCTGGCGCTGCGGGAAGATGCCCCGGGGAACCTCACTGGGGACCTC
TCTGAACATCAGCAATATGTGATCGCTCTCTTCCTCTCCTGCCTCTACACCATCTTCCTCTTCC
CCATCGGCTTTGTGGGCAACATCCTCATCTTGGTGGTGAACATCAGCTTCCGGGAGAAGATGAC
TATCCCAGACCTGTACTTCATCAACCTGGCAGCGGCTGACCTCATCCTGGTGGCCGACTCCCTG
ATCGAGGTGTTCAACCTGGACGAGCAGTATTACGATATCGCCGTGCTCTGCACCTTCATGTCCC
TCTTCCTGCAGATCAACATGTACAGCAGCGTCTTCTTCCTCACCTGGATGAGCTTCGACAGGTA
CCTGGCGCTGGCCAAAGCCATGCGCTGTGGCCTCTTCCGCACCAAGCACCACGCGCGGCTCAGC
TGTGGCCTCATCTGGATGGCCTCAGTGTCCGCCACGCTGGTGCCCTTCACGGCCGTGCATCTGC
GGCACACCGAGGAGGCCTGCTTCTGCTTTGCCGATGTCAGGGAGGTGCAGTGGCTGGAGGTCAC
GCTGGGCTTCATTGTGCCCTTCGCCATCATCGGCCTGTGCTATTCCCTCATCGTGCGGGCCCTC
ATCCGGGCCCACAGGCATCGTGGCCTGCGCCCACGCAGGCAGAAAGCCCTGAGGATGATCTTCG
CAGTGGTCCTTGTCTTCTTCATCTGCTGGCTGCCGGAGAACGTCTTCATCAGCGTCCACCTACT
GCAGTGGGCGCAGCCAGGGGACACTCCCTGCAAGCAGTCTTTCCGTCATGCCTACCCCTTGACA
GGCCACATAGTCAACCTGGCAGCCTTCTCCAACAGCTGCCTGAGTCCCCTCATCTATAGCTTCC
TGGGAGAGACCTTCAGGGACAAGCTCAGGCTGTATGTGGCGCAGAAGACGAGCCTGCCAGCTCT
CAACCGCTTCTGCCATGCCACGCTCAAGGCAGTCATACCAGACAGCACGGAGCAGTCAGATGTC
AAGTTCAGCAGTGCTGTATGAGAGGTACCTCCTAGAGGAAAACGGACAGGGGAGCAGGCGTGCC
CAGGAGCTGCACACTCTAGCACAGGTGGTGGGCGAGCTGAGCCATGTCATACTCTAAACCCC

hide sequence

RefSeq Acc Id:

XM_006248914 ⟹ XP_006248976

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	12	15,217,217 - 15,222,679 (-)	NCBI
Rnor_6.0	12	17,309,122 - 17,315,267 (-)	NCBI
Rnor_5.0	12	19,296,086 - 19,301,691 (-)	NCBI

Sequence:

show sequence

ACACACACACACACACACACACACACACACAGAGCTATCTACATGCAGGTAACTGCTTCATTTT
TTATAAATAAAAATATGTTATGTGTATGACTGTCTTATCAGCATGTGTGCCACCTGTGTGCCTG
GTTCTCAGAGTCTGAGAGAGGGAGTTGGATCTCCTAGGTTCAGATTTACAGATGATGATGAGCC
ACCATATGGGTGCTGGGAATCGAACCTGTGTCCTCTTCAGGAGCAACAAATTTTAACTGCTGAG
CCATCTCTGCAACCCAGTACCTGCTTCTTCCTGCTCCAGACAGCCTGCCTTTTAGGGAGCAGCC
TGGGGTGGTTTCTGCAGTCCTCAGCCAGCAGAAGCATGCACTGTTCATGCTCAGAACACAAATG
CCAGCTCAATGTACTCAATATCCCAGACTGCCAACCATCAAAAAGACAGCAAGAGAAAAGCACA
GAGGTCTGCACTGAAGGAGAAGAGGGGGAACCCTGCCGGTCTCTTGCCAGCCAGCCTAGCTGTA
TTGGCGAGCTCTAGGCCAATGAGAGACCCTGCCTTAAAAAAACAAGGTGAACACAACAATAGCT
AACAGAGGGTCTCTAACCTCCGCAACCACACACATTCATACATATATACATGAACATGTACTCA
TACTCAGATACAAAGAAGAGAGTACAAACGAGACCAATGAACTCTAAATTATCATGAGTACATA
ATAATTTGACTGGATGGCTCAGGTCAGAGCTGTTAGAGGTCTGATCATGTGGTGAAGCCCAGTT
CCCCATGCTTGTCTCCACCCCCAGGGCAACAATTCTAAGCCCACCCCAGTGTTGTGGGTGAAAC
TCCAACAACCGGAAGGTGGGATGCTTGGGGATGGCAATAAGTCACAAGGCTGCTCAGCTCCCAG
GGCCCTGGTCTCCCCAACCTTGGCTATACAAGGCCTAGAACGGGAAACAGAGAGAAGACAGGTG
GTGGCTCACCTGACCCCTGGGCAGAGGGACACTACCCCCGGCTCACATTAAAGCAGAAAACCTA
CCTGATTCCTAACTTCTGAACAAAATGTCTGCTATTTGTGGACTGTATTTCCCGCTACAAGCAT
CCCTCGGAAAACTGTAGCTTACATTCGCTGTGTGACTGCTGCCCTACTATGCTGGTGGAGGAAA
CTCAGTGTTCAGTTTTAAAGCCAGCACCAGCTGAAATAACCAAGGGTATCATTGCGTCCACAAA
TGAGGAAGGATTCTTACCTAAAAGGTAAACAATATTACAATCCTTTCACACTTCAAGATAATTA
TGTCAGTGGGTGAAAAACAGCAGTCACCCTGGAAATGTCCATACAATACATGCCTAACAGGACC
GTTTTCACTGTTTACATGTGGGAGGAAAAAACTGCCAGCAAAAAAATGGTTAATGCTGGCCTTA
AAAGGAGGCTGGCCAGAGCCCAGTGAGTAGGCTTGGGAAGTCTATAAAGGAGGCGCTGTGCCAA
GGGGGCCAGACACTGCGGGACAGCCACAGGCATCCACAGGCATGGTGAGCCTGCTCCCTTCCAG
ACCTGACACTCTTCTTTTCCTCTCCTGCTGTATCCCTGCTGGGCACCATCCCCAAGGTGCTACG
AGTCCAGGGACAATCCCTGTGAGCAACCTCCAGAAGCACCTCCAGCAGATGGTTCAGTGACTCC
ATGGCCCAGGTCCTCAGAAGGTAAGCAGGCAGCAGGCGTTCCTGCCCGGCACCAGCCCAGACGC
CCTGTCTGCCCTTCTGGTTTTCTGAGACAAACAGGCTCCCAGGACGATTCTTCCTGCCTCACGC
ATGCCTGGCTCACTTCCCAGGGAATCACCTTTGTGAAGATGGAGCTGTCACGTAAAACAGACTT
CTGTGACCCTTTCAGCAAGTCCTGAAAGCTTCTACGGGAAGCCATGGCTGCAACTACTCCAGCA
CAAGATGTTGGCGTAGAGATCTACCTAGGTCCCGTGTGGCCAGCCCCTTCCAACAGCACCCCTC
TGGCCCTCAACCTGTCCCTGGCGCTGCGGGAAGATGCCCCGGGGAACCTCACTGGGGACCTCTC
TGAACATCAGCAATATGTGATCGCTCTCTTCCTCTCCTGCCTCTACACCATCTTCCTCTTCCCC
ATCGGCTTTGTGGGCAACATCCTCATCTTGGTGGTGAACATCAGCTTCCGGGAGAAGATGACTA
TCCCAGACCTGTACTTCATCAACCTGGCAGCGGCCGACCTCATCCTGGTGGCCGACTCCCTGAT
CGAGGTGTTCAACCTGGACGAGCAGTACTACGATATCGCCGTGCTCTGCACCTTCATGTCCCTC
TTCCTGCAGATCAACATGTACAGCAGCGTCTTCTTCCTCACCTGGATGAGCTTCGACAGGTACC
TGGCGCTGGCCAAAGCCATGCGCTGTGGCCTCTTCCGCACCAAGCACCACGCGCGGCTCAGCTG
TGGCCTCATCTGGATGGCCTCAGTGTCCGCCACGCTGGTGCCCTTCACGGCCGTGCATCTGCGG
CACACCGAGGAGGCCTGCTTCTGCTTTGCCGATGTCAGGGAGGTGCAGTGGCTGGAGGTCACGC
TGGGCTTCATTGTGCCCTTCGCCATCATCGGCCTGTGCTATTCCCTCATCGTGCGGGCCCTCAT
CCGGGCCCACAGGCATCGTGGCCTGCGCCCACGCAGGCAGAAAGCCCTGAGGATGATCTTCGCA
GTGGTCCTTGTCTTCTTCATCTGCTGGCTGCCGGAGAACGTCTTCATCAGCGTCCACCTACTGC
AGTGGGCGCAGCCAGGGGACACTCCCTGCAAGCAGTCTTTCCGTCATGCCTACCCCTTGACAGG
CCACATAGTCAACCTGGCAGCCTTCTCCAACAGCTGCCTGAATCCCCTCATCTATAGCTTCCTG
GGAGAGACCTTCAGGGACAAGCTCAGGCTGTATGTGGCGCAGAAGACGAGCCTGCCAGCTCTCA
ACCGCTTCTGCCATGCCACGCTCAAGGCAGTCATACCAGACAGCACGGAGCAGTCAGATGTCAA
GTTCAGCAGTGCTGTATGAGAGGTACCTCCTAGAGGAAAACGGACAGGGGAGCAGGCGTGCCCA
GGAGCTGCACACTCCTAGCACAGGTGGTGGGCGAGCTGAGCCATGTCATACTCTAAACCCCAGT
GGCTAGGGGGAAATGTCACATGGCTGGGTCACCTCTGGGGCTGCTGGGATTCTTCCTGACTGCC
CAGCTCATGGATACTGCCATCCAGATTCAAGGCAGTGGGCCACATGACATTGACCTCTGCCCTC
AAAGGGCACCACGAAGGCCTGACGCTTGGTTTTCTTTCCATACCCTATGTTTCCAGAAGACAAG
TCTGTTGTTGATTAAGTAACAGCCCAAAGGACAGGCCACCCTATGGCACTACCATGGTTATATC
TTCTGTTACGTGCCTGCTACACGGAAGAGCCTAGAAACAGAGCATATGTACCAGACCCAAACTG
GCTACGTTCCCTTTGCTTGTGACGTGTGATTGATCATGTACACTCTGTCCAGTGCAGCCAAAGC
TAAGGACCCCAGAGCCTTCTTCCTGTCTTCCAGAAGGCTGTGAGGTCATCCCAGATGCCACTCC
TAACTCCTCAGTGAACAGCATGTCTGAGCTGAGAAAGGCCCTTTAACAAACCACCTCCCTGCTC
TGGGATGCTCCTCTCACAAAGCTTGTTTACAAAGGTGTTTGCCCTTCTGTGAAGGTGGAAGGAG
ACCGTGGGTGCTGCTGTGCAGGCTGCTGGGAATCCCATCATAAGACATTTGTCGGAAGGACTTG
ACTCCACAGAAAATAATACTGGGAACGGTGAGCTGTAAACGGATCTCATTAAAATGTAAAAAGA
AAGAA

hide sequence

RefSeq Acc Id:

XM_039089048 ⟹ XP_038944976

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	12	15,217,217 - 15,222,679 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_598257	(Get FASTA)	NCBI Sequence Viewer
	XP_006248976	(Get FASTA)	NCBI Sequence Viewer
	XP_038944976	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAC53208	(Get FASTA)	NCBI Sequence Viewer
	EDL89767	(Get FASTA)	NCBI Sequence Viewer
	O08878	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_598257 ⟸ NM_133573

- UniProtKB:

O08878 (UniProtKB/Swiss-Prot), G3V654 (UniProtKB/TrEMBL), A6K1V7 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MAATTPAQDVGVEIYLGPVWPAPSNSTPLALNLSLALREDAPGNLTGDLSEHQQYVIALFLSCL
YTIFLFPIGFVGNILILVVNISFREKMTIPDLYFINLAAADLILVADSLIEVFNLDEQYYDIAV
LCTFMSLFLQINMYSSVFFLTWMSFDRYLALAKAMRCGLFRTKHHARLSCGLIWMASVSATLVP
FTAVHLRHTEEACFCFADVREVQWLEVTLGFIVPFAIIGLCYSLIVRALIRAHRHRGLRPRRQK
ALRMIFAVVLVFFICWLPENVFISVHLLQWAQPGDTPCKQSFRHAYPLTGHIVNLAAFSNSCLS
PLIYSFLGETFRDKLRLYVAQKTSLPALNRFCHATLKAVIPDSTEQSDVKFSSAV

hide sequence

RefSeq Acc Id:	XP_006248976 ⟸ XM_006248914
- Peptide Label:	isoform X1
- UniProtKB:	O08878 (UniProtKB/Swiss-Prot), G3V654 (UniProtKB/TrEMBL), A6K1V7 (UniProtKB/TrEMBL)
- Sequence:	show sequence MAATTPAQDVGVEIYLGPVWPAPSNSTPLALNLSLALREDAPGNLTGDLSEHQQYVIALFLSCL YTIFLFPIGFVGNILILVVNISFREKMTIPDLYFINLAAADLILVADSLIEVFNLDEQYYDIAV LCTFMSLFLQINMYSSVFFLTWMSFDRYLALAKAMRCGLFRTKHHARLSCGLIWMASVSATLVP FTAVHLRHTEEACFCFADVREVQWLEVTLGFIVPFAIIGLCYSLIVRALIRAHRHRGLRPRRQK ALRMIFAVVLVFFICWLPENVFISVHLLQWAQPGDTPCKQSFRHAYPLTGHIVNLAAFSNSCLN PLIYSFLGETFRDKLRLYVAQKTSLPALNRFCHATLKAVIPDSTEQSDVKFSSAV hide sequence

RefSeq Acc Id:

ENSRNOP00000001732 ⟸ ENSRNOT00000001732

RefSeq Acc Id:	XP_038944976 ⟸ XM_039089048
- Peptide Label:	isoform X1
- UniProtKB:	O08878 (UniProtKB/Swiss-Prot), G3V654 (UniProtKB/TrEMBL), A6K1V7 (UniProtKB/TrEMBL)

Protein Domains

G-protein coupled receptors family 1 profile

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-O08878-F1-model_v2	AlphaFold	O08878	1-375	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:619845	AgrOrtholog
BioCyc Gene	G2FUF-19895	BioCyc
Ensembl Genes	ENSRNOG00000001287	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000001732	ENTREZGENE
	ENSRNOP00000001732.1	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000001732	ENTREZGENE
	ENSRNOT00000001732.4	UniProtKB/TrEMBL
Gene3D-CATH	Rhodopsin 7-helix transmembrane proteins	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	GPCR_Rhodpsn	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	GPCR_Rhodpsn_7TM	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	GPER1-like	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:171104	UniProtKB/Swiss-Prot
NCBI Gene	171104	ENTREZGENE
PANTHER	G-PROTEIN COUPLED ESTROGEN RECEPTOR 1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	G-PROTEIN COUPLED RECEPTOR 182 AND ESTROGEN RECEPTOR 1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	7tm_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Gper1	PhenoGen
PRINTS	GPCRRHODOPSN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	G_PROTEIN_RECEP_F1_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	G_PROTEIN_RECEP_F1_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	Family A G protein-coupled receptor-like	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A6K1V7	ENTREZGENE, UniProtKB/TrEMBL
	G3V654	ENTREZGENE, UniProtKB/TrEMBL
	GPER1_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2013-09-16	Gper1	G protein-coupled estrogen receptor 1	Gper	G protein-coupled estrogen receptor 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-02-22	Gper	G protein-coupled estrogen receptor 1	Gpr30	G protein-coupled receptor 30	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-02-26	Gpr30	G protein-coupled receptor 30			Symbol and Name status set to approved	625702	APPROVED
2002-08-07	Gpr30	G protein-coupled receptor 30			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

RGD Manual Annotations

Mammalian Phenotype

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

RGD Manual Annotations

Mammalian Phenotype