Cdc123 (cell division cycle 123) - Rat Genome Database

Name: Cdc123
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Community Projects Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Presentations Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Cdc123 (cell division cycle 123) Rattus norvegicus

Analyze

Symbol:

Cdc123

Name:

cell division cycle 123

RGD ID:

619766

Description:

Predicted to be involved in cell division. Predicted to be active in cytoplasm. Orthologous to human CDC123 (cell division cycle 123); INTERACTS WITH 2,6-dinitrotoluene; 3-chloropropane-1,2-diol; alachlor.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

cell division cycle 123 homolog; cell division cycle 123 homolog (S. cerevisiae); cell division cycle protein 123 homolog; D123; D123 gene product

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	CDC123 (cell division cycle 123)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Cdc123 (cell division cycle 123)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Cdc123 (cell division cycle 123)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	CDC123 (cell division cycle 123)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	CDC123 (cell division cycle 123)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Cdc123 (cell division cycle 123)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	CDC123 (cell division cycle 123)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	CDC123 (cell division cycle 123)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Cdc123 (cell division cycle 123)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	CDC123 (cell division cycle 123)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Cdc123 (cell division cycle 123)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	cdc123 (cell division cycle 123 homolog (S. cerevisiae))	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	CDC123	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	cdc123	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Candidate Gene For:

Gluco49

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	17	72,459,270 - 72,503,316 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	17	72,459,282 - 72,503,316 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	17	75,965,092 - 76,010,233 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	17	79,786,550 - 79,831,696 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	17	73,836,809 - 73,881,953 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	17	76,410,629 - 76,454,275 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	17	76,410,585 - 76,454,282 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	17	78,066,927 - 78,109,297 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	17	83,520,539 - 83,562,898 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	17	83,531,378 - 83,574,098 (+)	NCBI
Celera	17	71,909,202 - 71,950,416 (+)	NCBI		Celera
Cytogenetic Map	17	q12.3	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

genetic disease (ISO)

hypoparathyroidism-deafness-renal disease syndrome (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2,6-dinitrotoluene (EXP)

3-chloropropane-1,2-diol (EXP)

acrolein (ISO)

aflatoxin B1 (ISO)

alachlor (EXP)

alpha-hexachlorocyclohexane (EXP)

alpha-pinene (ISO)

ammonium chloride (EXP)

Aroclor 1254 (ISO)

benzo[a]pyrene (ISO)

benzo[e]pyrene (ISO)

bisphenol A (EXP,ISO)

carbon nanotube (ISO)

chlordecone (ISO)

crocidolite asbestos (ISO)

cyclosporin A (ISO)

dibutyl phthalate (ISO)

dicrotophos (ISO)

dimethylarsinic acid (EXP)

doxorubicin (ISO)

ethanol (ISO)

flavonoids (EXP)

flutamide (EXP)

folic acid (ISO)

ivermectin (ISO)

methapyrilene (ISO)

methoxychlor (EXP)

ozone (ISO)

paracetamol (ISO)

pirinixic acid (ISO)

resveratrol (ISO)

Salinomycin (ISO)

sodium arsenite (ISO)

trichloroethene (EXP)

triptonide (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cell division (IEA)

Cellular Component

cytoplasm (IBA,IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
3.	An amino acid change in novel protein D123 is responsible for temperature-sensitive G1-phase arrest in a mutant of rat fibroblast line 3Y1.	Okuda A and Kimura G, Exp Cell Res 1996 Mar 15;223(2):242-9.
4.	Reversion of temperature-sensitive mutation by inhibition of proteasome-mediated degradation of mutated D123 protein.	Okuda A, etal., Cell Struct Funct 2001 Aug;26(4):205-14.
5.	GOA pipeline	RGD automated data pipeline
6.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
7.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Additional References at PubMed

PMID:9683532	PMID:10698258	PMID:10942595	PMID:15489334

Genomics

Comparative Map Data

Cdc123
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	17	72,459,270 - 72,503,316 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	17	72,459,282 - 72,503,316 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	17	75,965,092 - 76,010,233 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	17	79,786,550 - 79,831,696 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	17	73,836,809 - 73,881,953 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	17	76,410,629 - 76,454,275 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	17	76,410,585 - 76,454,282 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	17	78,066,927 - 78,109,297 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	17	83,520,539 - 83,562,898 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	17	83,531,378 - 83,574,098 (+)	NCBI
Celera	17	71,909,202 - 71,950,416 (+)	NCBI		Celera
Cytogenetic Map	17	q12.3	NCBI

CDC123
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	10	12,196,188 - 12,250,589 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	10	12,195,965 - 12,250,589 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	10	12,238,187 - 12,292,588 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	10	12,277,971 - 12,332,593 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	10	12,277,970 - 12,332,593	NCBI
Celera	10	12,167,494 - 12,221,810 (+)	NCBI		Celera
Cytogenetic Map	10	p14-p13	NCBI
HuRef	10	12,154,403 - 12,209,871 (+)	NCBI		HuRef
CHM1_1	10	12,237,973 - 12,292,300 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	10	12,207,199 - 12,261,555 (+)	NCBI		T2T-CHM13v2.0

Cdc123
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	5,799,105 - 5,849,988 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	5,799,105 - 5,849,975 (-)	Ensembl		GRCm39 Ensembl
GRCm38	2	5,794,294 - 5,845,177 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	5,794,294 - 5,845,164 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	2	5,715,340 - 5,766,006 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	2	5,711,566 - 5,762,232 (-)	NCBI		MGSCv36	mm8
Celera	2	5,745,348 - 5,796,007 (-)	NCBI		Celera
Cytogenetic Map	2	A1	NCBI
cM Map	2	3.62	NCBI

Cdc123
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955462	212,090 - 274,334 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955462	212,090 - 270,168 (+)	NCBI	ChiLan1.0	ChiLan1.0

CDC123
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	10	24,733,809 - 24,788,696 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	10	12,206,174 - 12,260,583 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	10	12,186,494 - 12,241,496 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	10	12,186,494 - 12,245,147 (+)	Ensembl	panpan1.1		panPan2

CDC123
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	2	24,184,780 - 24,239,495 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	2	24,184,807 - 24,240,081 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	2	21,209,470 - 21,264,203 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	2	24,555,639 - 24,610,440 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	2	24,554,623 - 24,610,311 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	2	21,683,213 - 21,737,932 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	2	22,525,581 - 22,580,288 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	2	23,240,639 - 23,295,423 (-)	NCBI		UU_Cfam_GSD_1.0

Cdc123
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409344	26,934,029 - 26,983,813 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936484	3,099,011 - 3,149,514 (-)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936484	3,099,221 - 3,149,005 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CDC123
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	10	59,718,340 - 59,765,621 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	10	59,718,340 - 59,765,621 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	10	65,505,120 - 65,552,394 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

CDC123
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	9	12,246,949 - 12,299,832 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	9	12,247,231 - 12,299,841 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666051	17,753,033 - 17,805,645 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Cdc123
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624805	4,922,677 - 4,983,629 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624805	4,922,912 - 4,983,104 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Cdc123
261 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	191
Count of miRNA genes:	137
Interacting mature miRNAs:	157
Transcripts:	ENSRNOT00000024016
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
8552928	Pigfal9	Plasma insulin-like growth factor 1 level QTL 9	9		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	17	28409147	73409147	Rat
9590107	Sffal7	Serum free fatty acids level QTL 7	4.81	0.001	blood free fatty acid amount (VT:0001553)	plasma free fatty acids level (CMO:0000546)	17	28409147	73409147	Rat
2324621	Coatc5	Coat color QTL 5			coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	17	31368391	73951021	Rat
724549	Niddm56	Non-insulin dependent diabetes mellitus QTL 56		0.03	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	17	31990784	76990784	Rat
1354663	Bvd5	Brain ventricular dilatation QTL 5	3.51	0.001	brain ventricle morphology trait (VT:0000822)	hydrocephalus severity score (CMO:0001881)	17	31990784	81292925	Rat
1300148	Bp192	Blood pressure QTL 192	3.47		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	17	34550843	73951021	Rat
2301412	Kidm40	Kidney mass QTL 40		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	17	37479847	82479847	Rat
2317054	Aia12	Adjuvant induced arthritis QTL 12	4.24		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	17	38281509	83281509	Rat
2317060	Aia26	Adjuvant induced arthritis QTL 26	3.22		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	17	38281509	83281509	Rat
1598871	Memor5	Memory QTL 5	5.3		exploratory behavior trait (VT:0010471)	total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443)	17	40540041	80387013	Rat
1358295	Aocep1	Aortic cell protein QTL 1	6.1	0.00000071	thoracic aorta cellular protein amount (VT:0010598)	aortic cell percentage	17	40990005	85990005	Rat
7411575	Bw140	Body weight QTL 140	30.2	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	17	48560935	86533673	Rat
8694181	Bw151	Body weight QTL 151	4.36	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	17	48560935	86533673	Rat
2317038	Ginf3	Gastrointestinal inflammation QTL 3	2.89	0.005	liver integrity trait (VT:0010547)	liver granuloma severity score (CMO:0002157)	17	49920154	86533673	Rat
2303580	Gluco49	Glucose level QTL 49	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	17	50040271	86533673	Rat
4889894	Eae33	Experimental allergic encephalomyelitis QTL 33	5.2	0.0001	nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis severity score (CMO:0001419)	17	50909099	86022412	Rat
1354588	Bvd4	Brain ventricular dilatation QTL 4	5.31	0.001	brain ventricle morphology trait (VT:0000822)	hydrocephalus severity score (CMO:0001881)	17	53498828	82479847	Rat
2302365	Gluco40	Glucose level QTL 40	4.79		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	17	57246843	82046127	Rat
7488963	Bp369	Blood pressure QTL 369		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	59005649	77910000	Rat
2317045	Aia11	Adjuvant induced arthritis QTL 11	4.06		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	17	60781426	86533673	Rat
7411577	Bw141	Body weight QTL 141		0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	17	62619516	86533673	Rat
1300131	Bp193	Blood pressure QTL 193	3.3		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	63640009	73951021	Rat
631502	Cm26	Cardiac mass QTL 26	3.71		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	17	65703580	81153923	Rat
1300129	Rf25	Renal function QTL 25	3.03		blood creatinine amount (VT:0005328)	creatinine clearance (CMO:0000765)	17	71003325	81153923	Rat
12904736	Cm121	Cardiac mass QTL 121		0.043	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	17	71774621	82479847	Rat

Markers in Region

BE109264

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	17	72,502,130 - 72,502,831 (+)	MAPPER	mRatBN7.2
Rnor_6.0	17	76,453,459 - 76,454,158	NCBI	Rnor6.0
Rnor_5.0	17	78,108,481 - 78,109,180	UniSTS	Rnor5.0
RGSC_v3.4	17	83,562,082 - 83,562,781	UniSTS	RGSC3.4
Celera	17	71,949,602 - 71,950,299	UniSTS
RH 3.4 Map	17	717.3	UniSTS
Cytogenetic Map	17	q12.3	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	43	57	41	19	41	8	11	74	35	41	11	8
Low
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_053877	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC141220	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC061527	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473990	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ213222	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000294	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U34843	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000024016 ⟹ ENSRNOP00000024016

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	17	72,459,282 - 72,502,958 (+)	Ensembl
Rnor_6.0 Ensembl	17	76,410,585 - 76,454,282 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000113414 ⟹ ENSRNOP00000083559

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	17	72,459,282 - 72,502,957 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000116923 ⟹ ENSRNOP00000096017

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	17	72,459,293 - 72,503,316 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000117639 ⟹ ENSRNOP00000089218

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	17	72,459,320 - 72,503,313 (+)	Ensembl

RefSeq Acc Id:

NM_053877 ⟹ NP_446329

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	17	72,459,270 - 72,503,316 (+)	NCBI
Rnor_6.0	17	76,410,629 - 76,454,275 (+)	NCBI
Rnor_5.0	17	78,066,927 - 78,109,297 (+)	NCBI
RGSC_v3.4	17	83,520,539 - 83,562,898 (+)	RGD
Celera	17	71,909,202 - 71,950,416 (+)	RGD

Sequence:

show sequence

GGGAGAGGGGACAGGGCAGCGATTGACGCGGCAGCTGGAGGATGAAGAAGGAGCATGTTAGTCA
CTGTCAGTTCTCCGCGTGGTACCCACTCTTCCGAAGCCTTACCATCAAGAGTGTCATCCTCCCG
CTTCCTCAGAATGTGAAAGACTATTTACTTGACGACGGGACTCTGGTGGTCTCAGGAAGGGAAG
ACCCACCAACATGCTCTCAGCCAGACAGTGGTGACGAAGCAGAGGAAACACAGTGGTCCGATGA
TGAGAGCACAGCCACACTTACGGCACCCGAGTTTCCTGAGTTCAATACTCAAGTCCAAGAAGCT
ATCAATTCGCTGGGGGGCAGTGTCTTCCCTAAGCTTAACTGGAGTGCCCCAAGGGATGCATACT
GGATAGCAATGAACAGTTCTCTGAAGTGTAAAAGCCTCAGTGACATCTTCCTGCTTTTCAAGAG
TTCGGACTTCATCACTCATGACTTCACACAGCCGTTTATTCATTGTAATGATGATTCTCCAGAT
CCTTGTATAGAGTACGAGCTTGTTCTCCGAAAATGGTGTGAATTAATCCCTGGGGCTGAGTTCC
GATGTTTTGTCAAGGAAAACAAGCTTATTGGTATTTCTCAGAGGGACTACACGCAGTACTATGA
TCATATCTCTAAGCAAAAAGAAGAAATTTGCAGATGCATTCAAGACTTTTTCAAGGAACACCTG
CAGTACAAATTCTTAGATGAAGACTTTGTGTTTGATATATACAGAGACAGTAGGGGCAAGGTGT
GGCTGATCGACTTTAACCCATTTGGGGAGGTCACAGACTCTCTGCTGTTTACTTGGGAAGAGCT
GACATCGGAGAACAATCTGCGAGGCGACGTCAGTGAGGCGGACGCTCTGGAGCAGGATTCTCCA
GCCTTCCGTTGTACGAACAGTGAAGTCACGGTCCAGCCCAGCCCCTATCTGAGCTACGGCCTGC
CCAAGGACTTCGTAGACCTTTCCACCGGGGAAGATGCTCACAAGCTCATAGATTTTCTTAAGCT
GAAAAGAAATCAGCAAGAGGACGACTGAGCGCTGCTTGGAGAATAAGTCAAGAGGGAAACAGCT
TTTCAGAAGCCTCATATAGAACACAACTTCCCAGTGACCCAAACTAGGTGCAGATGGGTGGGCA
GTATGCAAAATCATCAGCTTTTATATTCGTGTATATTTACCTGGAGAAAGATGGAGGACCTTTG
GTACTTGTAAAAGAAATAACAATATAATAAATAGATCTCGAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_446329	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAB60521	(Get FASTA)	NCBI Sequence Viewer
	AAH61527	(Get FASTA)	NCBI Sequence Viewer
	EDL78661	(Get FASTA)	NCBI Sequence Viewer
	EDL78662	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000024016.7
	ENSRNOP00000083559.1
	ENSRNOP00000089218.1
	ENSRNOP00000096017
GenBank Protein	Q62834	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_446329 ⟸ NM_053877

- UniProtKB:

Q62834 (UniProtKB/Swiss-Prot), A6JLY4 (UniProtKB/TrEMBL), A0A8I5ZX90 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MKKEHVSHCQFSAWYPLFRSLTIKSVILPLPQNVKDYLLDDGTLVVSGREDPPTCSQPDSGDEA
EETQWSDDESTATLTAPEFPEFNTQVQEAINSLGGSVFPKLNWSAPRDAYWIAMNSSLKCKSLS
DIFLLFKSSDFITHDFTQPFIHCNDDSPDPCIEYELVLRKWCELIPGAEFRCFVKENKLIGISQ
RDYTQYYDHISKQKEEICRCIQDFFKEHLQYKFLDEDFVFDIYRDSRGKVWLIDFNPFGEVTDS
LLFTWEELTSENNLRGDVSEADALEQDSPAFRCTNSEVTVQPSPYLSYGLPKDFVDLSTGEDAH
KLIDFLKLKRNQQEDD

hide sequence

RefSeq Acc Id:

ENSRNOP00000024016 ⟸ ENSRNOT00000024016

RefSeq Acc Id:

ENSRNOP00000089218 ⟸ ENSRNOT00000117639

RefSeq Acc Id:

ENSRNOP00000096017 ⟸ ENSRNOT00000116923

RefSeq Acc Id:

ENSRNOP00000083559 ⟸ ENSRNOT00000113414

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q62834-F1-model_v2	AlphaFold	Q62834	1-336	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13700571

Promoter ID:

EPDNEW_R11094

Type:

initiation region

Name:

Cdc123_1

Description:

cell division cycle 123

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	17	76,410,617 - 76,410,677	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:619766	AgrOrtholog
BioCyc Gene	G2FUF-8705	BioCyc
Ensembl Genes	ENSRNOG00000017770	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000024016.7	UniProtKB/TrEMBL
	ENSRNOT00000113414.1	UniProtKB/TrEMBL
	ENSRNOT00000116923	ENTREZGENE, UniProtKB/Swiss-Prot
	ENSRNOT00000117639.1	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:6920755	IMAGE-MGC_LOAD
InterPro	CDC123	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:116656	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:72665	IMAGE-MGC_LOAD
NCBI Gene	116656	ENTREZGENE
PANTHER	CELL DIVISION CYCLE PROTEIN 123 HOMOLOG	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR15323	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	D123	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Cdc123	PhenoGen
PIRSF	Cdc123	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000017770	RatGTEx
UniProt	A0A8I5ZX90	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6A9Q9_RAT	UniProtKB/TrEMBL
	A0A8L2QDG3_RAT	UniProtKB/TrEMBL
	A6JLY4	ENTREZGENE, UniProtKB/TrEMBL
	CD123_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2013-01-23	Cdc123	cell division cycle 123	Cdc123	cell division cycle 123 homolog (S. cerevisiae)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-02-22	Cdc123	cell division cycle 123 homolog (S. cerevisiae)	D123	D123 gene product	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-11-17	D123	D123 gene product			Symbol and Name status set to approved	1299863	APPROVED
2002-08-07	D123	D123 gene product			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_mutations_overexpression	degradation of mutated protein inhibited by selective proteasome inhibitors lactacystin and MG132	632555

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar