Fah (fumarylacetoacetate hydrolase)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes Community Projects (beta) QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease Coronavirus Disease Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Presentations Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Fah (fumarylacetoacetate hydrolase) Rattus norvegicus

Analyze

Symbol:

Fah

Name:

fumarylacetoacetate hydrolase

RGD ID:

61932

Description:

Predicted to enable fumarylacetoacetase activity. Predicted to be involved in L-phenylalanine catabolic process; lipid metabolic process; and tyrosine catabolic process. Predicted to act upstream of or within arginine catabolic process. Used to study liver cirrhosis and tyrosinemia type I. Biomarker of hypertension. Human ortholog(s) of this gene implicated in tyrosinemia type I. Orthologous to human FAH (fumarylacetoacetate hydrolase); PARTICIPATES IN alkaptonuria pathway; disulfiram pharmacodynamics pathway; dopamine beta-hydroxylase deficiency pathway; INTERACTS WITH (+)-schisandrin B; 17alpha-ethynylestradiol; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

beta-diketonase; FAA; fumarylacetoacetase

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	FAH (fumarylacetoacetate hydrolase)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, Treefam
Mus musculus (house mouse):	Fah (fumarylacetoacetate hydrolase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Fah (fumarylacetoacetate hydrolase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	FAH (fumarylacetoacetate hydrolase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	FAH (fumarylacetoacetate hydrolase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Fah (fumarylacetoacetate hydrolase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	FAH (fumarylacetoacetate hydrolase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	FAH (fumarylacetoacetate hydrolase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Fah (fumarylacetoacetate hydrolase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	KCNAB3 (potassium voltage-gated channel subfamily A regulatory beta subunit 3)	HGNC	OMA
Alliance orthologs ³
Mus musculus (house mouse):	Fah (fumarylacetoacetate hydrolase)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	FAH (fumarylacetoacetate hydrolase)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	fah (fumarylacetoacetate hydrolase (fumarylacetoacetase))	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Faa	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	fah-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	fah	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Allele / Splice:

Fah^em3Mcwi Fah^em15Dlli-/- Fah^em10Dlli-/-

Genetic Models:

SD-Fah^em3Mcwi SD-Fah^em15Dlli-/- SD-Fah^em10Dlli-/-

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	1	138,548,830 - 138,571,599 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	138,548,834 - 138,571,505 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	146,501,260 - 146,524,074 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	153,670,263 - 153,693,077 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	146,545,471 - 146,568,281 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	146,713,663 - 146,736,339 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	146,713,676 - 146,736,261 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	147,640,316 - 147,662,920 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	140,851,975 - 140,876,187 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	140,930,382 - 140,954,593 (-)	NCBI
Celera	1	130,566,888 - 130,589,532 (-)	NCBI		Celera
Cytogenetic Map	1	q31	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Bloom syndrome (ISO)

colorectal cancer (ISO)

COVID-19 (ISO)

genetic disease (ISO)

hepatoblastoma (ISO)

hypertension (IEP)

liver cirrhosis (IMP)

liver disease (ISO)

Liver Failure (IMP)

tyrosinemia (ISO)

tyrosinemia type I (IMP,ISO,ISS)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

(S)-nicotine (ISO)

1,1-dichloroethene (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (EXP,ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dinitrotoluene (EXP)

2-methoxyethanol (EXP)

3,3',4,4',5-pentachlorobiphenyl (EXP)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

5-fluorouracil (ISO)

6-propyl-2-thiouracil (EXP)

acetamide (EXP)

acrolein (ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

alpha-pinene (ISO)

amitrole (EXP)

ammonium chloride (EXP)

amphetamine (ISO)

arotinoid acid (ISO)

benzo[a]pyrene (ISO)

benzo[e]pyrene (ISO)

benzoates (ISO)

bis(2-ethylhexyl) phthalate (EXP)

bisphenol A (EXP,ISO)

Bisphenol B (ISO)

bisphenol F (ISO)

bromobenzene (EXP)

butyric acid (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

CGP 52608 (ISO)

CHIR 99021 (ISO)

cisplatin (EXP,ISO)

clofibrate (EXP,ISO)

cobalt dichloride (EXP)

cortisol (ISO)

coumestrol (ISO)

Cuprizon (EXP)

cyclosporin A (ISO)

cyproconazole (ISO)

dexamethasone (EXP,ISO)

dibutyl phthalate (EXP)

diethyl maleate (ISO)

dorsomorphin (ISO)

endosulfan (EXP)

epoxiconazole (ISO)

ethylisopropylamiloride (ISO)

fenofibrate (ISO)

fenthion (ISO)

flutamide (EXP)

folic acid (ISO)

fumonisin B1 (ISO)

furan (EXP)

indometacin (ISO)

ivermectin (ISO)

L-ascorbic acid (ISO)

L-ascorbic acid 2-phosphate (ISO)

lead diacetate (EXP)

methamphetamine (EXP)

methapyrilene (EXP,ISO)

methidathion (ISO)

methimazole (EXP)

methylmercury chloride (ISO)

mifepristone (ISO)

N-ethyl-N-nitrosourea (ISO)

N-nitrosodimethylamine (ISO)

nicotine (ISO)

nitrofen (EXP)

ozone (ISO)

paracetamol (EXP,ISO)

perfluorobutanesulfonic acid (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (ISO)

pirinixic acid (ISO)

propiconazole (ISO)

pyrogallol (ISO)

quercetin (ISO)

resveratrol (ISO)

rotenone (EXP)

SB 431542 (ISO)

sodium arsenite (EXP)

sodium dichromate (EXP,ISO)

sodium dodecyl sulfate (ISO)

sulfadimethoxine (EXP)

tauroursodeoxycholic acid (EXP)

temozolomide (ISO)

tert-butyl hydroperoxide (EXP)

testosterone (EXP,ISO)

tetrachloromethane (EXP,ISO)

tetrahydropalmatine (ISO)

thimerosal (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

triadimefon (EXP)

trichostatin A (ISO)

triclosan (ISO)

tris(2-butoxyethyl) phosphate (ISO)

troglitazone (EXP)

urethane (ISO)

valproic acid (EXP,ISO)

vancomycin (ISO)

vorinostat (ISO)

XAV939 (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

arginine catabolic process (IEA,ISO)

biological_process (ND)

homogentisate catabolic process (IBA)

L-phenylalanine catabolic process (IBA,IEA)

lipid metabolic process (IEA)

tyrosine catabolic process (IBA,IEA)

Molecular Function

fumarylacetoacetase activity (IBA,IEA,ISO,TAS)

metal ion binding (IEA)

protein binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

alkaptonuria pathway (ISO)

disulfiram pharmacodynamics pathway (ISO)

dopamine beta-hydroxylase deficiency pathway (ISO)

hawkinsinuria pathway (ISO)

phenylketonuria pathway (ISO)

tyrosine metabolic pathway (IEA,ISO)

tyrosinemia type I pathway (ISO)

tyrosinemia type II pathway (ISO)

tyrosinemia type III pathway (ISO)

Phenotype Annotations Click to see Annotation Detail View

Mammalian Phenotype

decreased body weight (IMP)

increased circulating tyrosine level (IMP)

moribund (IMP)

postnatal lethality, complete penetrance (IMP)

References

References - curated

#	Reference Title	Reference Citation
1.	Point mutations in the murine fumarylacetoacetate hydrolase gene: Animal models for the human genetic disorder hereditary tyrosinemia type 1.	Aponte JL, etal., Proc Natl Acad Sci U S A 2001 Jan 16;98(2):641-5.
2.	Silent Tyrosinemia Type I Without Elevated Tyrosine or Succinylacetone Associated with Liver Cirrhosis and Hepatocellular Carcinoma.	Blackburn PR, etal., Hum Mutat. 2016 Oct;37(10):1097-105. doi: 10.1002/humu.23047. Epub 2016 Aug 8.
3.	Dendrimer-Based Lipid Nanoparticles Deliver Therapeutic FAH mRNA to Normalize Liver Function and Extend Survival in a Mouse Model of Hepatorenal Tyrosinemia Type I.	Cheng Q, etal., Adv Mater. 2018 Dec;30(52):e1805308. doi: 10.1002/adma.201805308. Epub 2018 Oct 25.
4.	Complete rescue of lethal albino c14CoS mice by null mutation of 4-hydroxyphenylpyruvate dioxygenase and induction of apoptosis of hepatocytes in these mice by in vivo retrieval of the tyrosine catabolic pathway.	Endo F, etal., J Biol Chem 1997 Sep 26;272(39):24426-32.
5.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
6.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
7.	Pharmacological correction of neonatal lethal hepatic dysfunction in a murine model of hereditary tyrosinaemia type I.	Grompe M, etal., Nat Genet 1995 Aug;10(4):453-60.
8.	KEGG: Kyoto Encyclopedia of Genes and Genomes	KEGG
9.	Cloning and expression analysis of a cDNA encoding fumarylacetoacetate hydrolase: post-transcriptional modulation in rat liver and kidney.	Labelle Y, etal., Gene 1991 Aug 15;104(2):197-202.
10.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
11.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
12.	Analysis of the mouse transcriptome based on functional annotation of 60,770 full-length cDNAs.	Okazaki Y, etal., Nature. 2002 Dec 5;420(6915):563-73.
13.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
14.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
15.	SMPDB Annotation Import Pipeline	Pipeline to import SMPDB annotations from SMPDB into RGD
16.	GOA pipeline	RGD automated data pipeline
17.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
18.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
19.	Comprehensive gene review and curation	RGD comprehensive gene curation
20.	Cas9-nickase-mediated genome editing corrects hereditary tyrosinemia in rats.	Shao Y, etal., J Biol Chem. 2018 May 4;293(18):6883-6892. doi: 10.1074/jbc.RA117.000347. Epub 2018 Mar 5.
21.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
22.	Tentative Sequence Identification Numbers	Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
23.	Identification of hypertension-related genes through an integrated genomic-transcriptomic approach.	Yagil C, etal., Circ Res. 2005 Apr 1;96(6):617-25. Epub 2005 Feb 24.
24.	Efficient liver repopulation of transplanted hepatocyte prevents cirrhosis in a rat model of hereditary tyrosinemia type I.	Zhang L, etal., Sci Rep. 2016 Aug 11;6:31460. doi: 10.1038/srep31460.

Additional References at PubMed

PMID:8364576	PMID:15489334	PMID:19056867	PMID:23376485	PMID:23533145	PMID:25677510

Genomics

Comparative Map Data

Fah
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	1	138,548,830 - 138,571,599 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	138,548,834 - 138,571,505 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	146,501,260 - 146,524,074 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	153,670,263 - 153,693,077 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	146,545,471 - 146,568,281 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	146,713,663 - 146,736,339 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	146,713,676 - 146,736,261 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	147,640,316 - 147,662,920 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	140,851,975 - 140,876,187 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	140,930,382 - 140,954,593 (-)	NCBI
Celera	1	130,566,888 - 130,589,532 (-)	NCBI		Celera
Cytogenetic Map	1	q31	NCBI

FAH
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	15	80,152,789 - 80,186,949 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	15	80,152,490 - 80,186,946 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	15	80,445,131 - 80,479,291 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	15	78,232,396 - 78,265,737 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	15	78,232,395 - 78,265,737	NCBI
Celera	15	57,382,789 - 57,416,130 (+)	NCBI		Celera
Cytogenetic Map	15	q25.1	NCBI
HuRef	15	57,208,400 - 57,236,922 (+)	NCBI		HuRef
CHM1_1	15	80,563,191 - 80,596,880 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	15	78,016,209 - 78,050,378 (+)	NCBI		T2T-CHM13v2.0

Fah
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	7	84,234,367 - 84,255,150 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	7	84,234,367 - 84,255,930 (-)	Ensembl		GRCm39 Ensembl
GRCm38	7	84,585,159 - 84,605,942 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	7	84,585,159 - 84,606,722 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	7	91,733,669 - 91,754,452 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	7	84,461,355 - 84,481,937 (-)	NCBI		MGSCv36	mm8
Celera	7	81,987,620 - 82,008,470 (-)	NCBI		Celera
Cytogenetic Map	7	D3	NCBI
cM Map	7	48.36	NCBI

Fah
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955533	904,295 - 921,730 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955533	904,294 - 921,730 (+)	NCBI	ChiLan1.0	ChiLan1.0

FAH
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	15	73,571,710 - 73,605,514 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	15	59,121,657 - 59,155,229 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	15	78,081,523 - 78,115,169 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	15	78,048,571 - 78,115,098 (+)	Ensembl	panpan1.1		panPan2

FAH
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	3	57,300,422 - 57,326,546 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	3	57,300,441 - 57,326,486 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	3	59,958,877 - 59,985,019 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	3	57,726,930 - 57,753,060 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	3	57,702,957 - 57,753,270 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	3	57,232,805 - 57,258,945 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	3	57,439,515 - 57,465,634 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	3	57,786,369 - 57,812,502 (-)	NCBI		UU_Cfam_GSD_1.0

Fah
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	120,292,223 - 120,326,410 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936471	38,140,273 - 38,174,702 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936471	38,140,324 - 38,174,472 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

FAH
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	7	49,047,902 - 49,087,783 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	7	49,047,833 - 49,087,790 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	7	54,556,153 - 54,596,338 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

FAH
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	26	3,223,327 - 3,259,367 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	26	3,223,079 - 3,258,657 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666048	138,616,632 - 138,652,526 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Fah
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624941	1,039,429 - 1,056,568 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624941	1,039,389 - 1,056,568 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Fah
93 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	29
Count of miRNA genes:	27
Interacting mature miRNAs:	29
Transcripts:	ENSRNOT00000068167
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
70225	Bp58	Blood pressure QTL 58	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32356093	162846471	Rat
10059597	Bp377	Blood pressure QTL 377	3.42	0.025	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32737458	199368955	Rat
2313402	Anxrr24	Anxiety related response QTL 24			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	1	48963584	144267916	Rat
1578654	Bss10	Bone structure and strength QTL 10	4		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	1	49393172	159356837	Rat
634314	Niddm44	Non-insulin dependent diabetes mellitus QTL 44			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	49393289	199050459	Rat
2298545	Neuinf8	Neuroinflammation QTL 8	4.6		nervous system integrity trait (VT:0010566)	spinal cord beta-2 microglobulin mRNA level (CMO:0002125)	1	57336763	151090257	Rat
1578780	Cm52	Cardiac mass QTL 52	3.3	0.0001	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	1	81591954	219808434	Rat
724529	Cm16	Cardiac mass QTL 16	2.7		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	1	87580395	150700247	Rat
724521	Uae1	Urinary albumin excretion QTL 1	3.8	0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	90508614	173018436	Rat
1358902	Bw47	Body weight QTL 47	1.67		body mass (VT:0001259)	body weight (CMO:0000012)	1	90508614	180359386	Rat
1300153	Bp171	Blood pressure QTL 171	3.37		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	90664883	143200202	Rat
724567	Tcas6	Tongue tumor susceptibility QTL 6	6.85		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	1	92948896	144267916	Rat
1331793	Bp200	Blood pressure QTL 200	3.71601		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	94494440	172949803	Rat
1331751	Bp199	Blood pressure QTL 199	3.60022		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	94494440	181830018	Rat
1331749	Hrtrt11	Heart rate QTL 11	2.973		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	1	94494440	198211706	Rat
70209	Niddm23	Non-insulin dependent diabetes mellitus QTL 23	2.82		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	94494440	198324465	Rat
731168	Bp154	Blood pressure QTL 154	3.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	94642644	214537671	Rat
61346	Rf2	Renal disease susceptibility QTL 2	3.7		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	1	99267916	144267916	Rat
61399	Tcat1	Tongue tumor resistance QTL 1	3.3		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 5 mm (CMO:0001879)	1	99267916	144267916	Rat
8655649	Arrd1	Age-related retinal degeneration QTL 1	4.89		retinal layer morphology trait (VT:0003727)	percentage of study population developing retinopathy during a period of time (CMO:0002453)	1	100357752	183970443	Rat
2317833	Alcrsp19	Alcohol response QTL 19	12.4	0.001	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	1	100979852	145979852	Rat
1641897	Alcrsp1	Alcohol response QTL 1			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	1	100979852	145979852	Rat
2303591	Gluco41	Glucose level QTL 41	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	102168504	147168504	Rat
61370	Mcs3	Mammary carcinoma susceptibility QTL 3	2.15		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	1	102268556	147268556	Rat
1354623	Rf46	Renal function QTL 46	3.8		blood creatinine amount (VT:0005328)	plasma creatinine level (CMO:0000537)	1	102813953	151162766	Rat
1354591	Cm36	Cardiac mass QTL 36	4.1		heart left ventricle mass (VT:0007031)	calculated heart weight (CMO:0000073)	1	102813953	201278233	Rat
1354615	Cm32	Cardiac mass QTL 32	5.2		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	1	102813953	201278233	Rat
1354606	Bp246	Blood pressure QTL 246	3.6		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	1	102813953	218753816	Rat
9590300	Scort16	Serum corticosterone level QTL 16	4.39	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	1	103111621	148111621	Rat
8694370	Bw154	Body weight QTL 154	8.91	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	1	103111621	148111621	Rat
631496	Bp97	Blood pressure QTL 97	3.08		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	106047847	151047847	Rat
1300158	Bp173	Blood pressure QTL 173	3.48		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	1	115540693	185145286	Rat
7794788	Mcs32	Mammary carcinoma susceptibility QTL 32	2.61		mammary gland integrity trait (VT:0010552)	mammary tumor incidence/prevalence measurement (CMO:0000946)	1	115540693	238914717	Rat
631199	Cm23	Cardiac mass QTL 23	4.6	0.0004	heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	1	115585465	172949803	Rat
7421630	Bp362	Blood pressure QTL 362		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	118608292	241799120	Rat
2313060	Bss71	Bone structure and strength QTL 71	2.6	0.0001	long bone metaphysis morphology trait (VT:0000133)	tibia midshaft total cross-sectional area (CMO:0001715)	1	118944747	163944747	Rat
631205	Bp196	Blood pressure QTL 196	4	0.0001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	118944897	199050459	Rat
1598850	Bp297	Blood pressure QTL 297	2.1		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	121006655	166006655	Rat
1598866	Bp287	Blood pressure QTL 287	5.1		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	121006655	166006655	Rat
61442	Strs1	Sensitivity to stroke QTL 1	7.4		cerebrum integrity trait (VT:0010549)	post-insult time to onset of cerebrovascular lesion (CMO:0002343)	1	121767634	166767634	Rat
2293140	Bp313	Blood pressure QTL 313			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	121833674	166833674	Rat
631544	Bp84	Blood pressure QTL 84	5.6		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	123350408	181759564	Rat
1358189	Cstrr1	Cold stress response QTL 1		0.0001	catecholamine amount (VT:0010543)	urine norepinephrine level (CMO:0001629)	1	123350408	182418476	Rat
1641895	Bp298	Blood pressure QTL 298			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	123350408	182418476	Rat
1578770	Stresp23	Stress response QTL 23			kidney sympathetic nerve activity (VT:0004050)	stimulated renal sympathetic nerve activity to basal renal sympathetic nerve activity ratio (CMO:0001786)	1	123350408	182418476	Rat
631549	Bp89	Blood pressure QTL 89	5.7		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	123350581	201284552	Rat
631570	Bp94	Blood pressure QTL 94		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	123479780	142990467	Rat
634348	Bp138	Blood pressure QTL 138			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	125611501	168883176	Rat
9685799	Bp375	Blood pressure QTL 375			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	125611501	170611501	Rat
631654	Bp107	Blood pressure QTL 107			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	125611501	170611501	Rat
9685802	Bp376	Blood pressure QTL 376			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	126540680	171540680	Rat
738006	Anxrr14	Anxiety related response QTL 14	4	0.00035	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	1	130636910	175636910	Rat
738028	Anxrr12	Anxiety related response QTL 12	4.9	0.00001	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	1	130636910	175636910	Rat
631202	Gluco13	Glucose level QTL 13		0.0001	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	131763437	159756369	Rat
6893347	Bw98	Body weight QTL 98	0.2	0.53	body mass (VT:0001259)	body weight (CMO:0000012)	1	133680936	178680936	Rat
6893361	Bw104	Body weight QTL 104	0.59	0.27	body mass (VT:0001259)	body weight (CMO:0000012)	1	133680936	178680936	Rat
1558645	Bw55	Body weight QTL 55	3.2	0.004	body mass (VT:0001259)	body weight (CMO:0000012)	1	133680936	178680936	Rat
631206	Niddm40	Non-insulin dependent diabetes mellitus QTL 40			blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	1	136745990	163747690	Rat
71118	Thym1	Thymus enlargement QTL 1	10.17	0.001	thymus mass (VT:0004954)	thymus weight to body weight ratio (CMO:0000612)	1	136829932	181829932	Rat
724550	Thym3	Thymus enlargement QTL 3	7.82	0.001	thymus mass (VT:0004954)	thymus weight to body weight ratio (CMO:0000612)	1	136829932	181829932	Rat
631519	Pia11	Pristane induced arthritis QTL 11	5.3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	1	136830018	181830018	Rat

Markers in Region

BM390454

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	138,548,904 - 138,549,114 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	146,713,738 - 146,713,947	NCBI	Rnor6.0
Rnor_5.0	1	147,640,391 - 147,640,600	UniSTS	Rnor5.0
RGSC_v3.4	1	140,852,050 - 140,852,259	UniSTS	RGSC3.4
Celera	1	130,566,963 - 130,567,172	UniSTS
RH 3.4 Map	1	1108.1	UniSTS
Cytogenetic Map	1	q31	UniSTS

Genetic Models

This gene Fah is modified in the following models/strains:

SD-Fah^em3Mcwi SD-Fah^em15Dlli-/- SD-Fah^em10Dlli-/-

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	10	53	41	10	41			26	31	34	11
Low		33	4		9		8	11	48	4	7		8
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_017181	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039108811	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC076381	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473980	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ210811	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ219602	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000040	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M77694	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000068167 ⟹ ENSRNOP00000061132

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	138,548,834 - 138,571,505 (-)	Ensembl
Rnor_6.0 Ensembl	1	146,713,676 - 146,736,261 (-)	Ensembl

RefSeq Acc Id:

NM_017181 ⟹ NP_058877

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	1	138,548,830 - 138,571,505 (-)	NCBI
Rnor_6.0	1	146,713,663 - 146,736,339 (-)	NCBI
Rnor_5.0	1	147,640,316 - 147,662,920 (-)	NCBI
RGSC_v3.4	1	140,851,975 - 140,876,187 (-)	RGD
Celera	1	130,566,888 - 130,589,532 (-)	RGD

Sequence:

show sequence

TGAATCTAAAGGCTCTCAGCTAGGCTGATCTTTGCCCTAAGCATAATCCCGCTAGCCAACCCCT
ACCCGTTGTGGGTTCTGCTGCCCAGTGCTCTTCAGCATGTCCTTTATTCCGGTGGCCGAGGACT
CCGACTTTCCCATCCAAAACCTGCCCTATGGCGTTTTCTCCACTCAAAGCAACCCAAAGCCACG
GATTGGTGTGGCCATCGGTGACCAGATCTTGGACCTGAGTGTCATTAAACACCTCTTTACCGGA
CCTGTCCTCTCCAAACATCAGCATGTCTTCGATGAGACAACTCTCAATAGCTTTATGGGCCTCG
GCCAAGCGGCATGGAAGGAGGCAAGAGCATCCTTACAGAACTTACTGTCTGCCAGCCAAGCCCA
GCTCAGAGATGACAAGGAGCTTCGGCAGCGTGCATTCACCTCCCAGGCTTCTGCCACGATGCAC
CTTCCTGCTACCATAGGAGACTACACGGACTTCTACTCCTCTCTGCAGCATGCCACTAACGTTG
GCATTATGTTCAGGGGCAAGGAGAATGCGCTGTTGCCCAATTGGCTCCACTTACCTGTGGGATA
CCATGGCCGAGCTTCCTCCGTTGTGGTGTCTGGTACCCCAATTCGAAGACCCATGGGACAGATG
AGACCTGATAACTCAAAGCCTCCTGTGTATGGTGCCAGCAAACGCTTAGACATGGAGTTGGAAA
TGGCTTTCTTTGTAGGCCCTGGGAACAGATTCGGCGAGCCAATCCCCATTTCCAAGGCCCAGGA
GCACATTTTCGGGATGGTCCTCATGAACGACTGGAGTGCTCGAGACATCCAGCAATGGGAGTAC
GTCCCCCTTGGGCCATTCCTGGGGAAAAGTTTTGGAACCACCATCTCCCCATGGGTGGTGCCCA
TGGATGCTCTCATGCCCTTTGTGGTGCCAAACCCAAAGCAGGACCCTAAGCCCCTGCCATATCT
CTGCCACAGCCAGCCCTACACATTTGATATCAACCTGTCCGTTGCTTTGAAAGGAGAAGGAATG
AGCCAGGCAGCTACCATCTGCAGGTCCAACTTTAAGCACATGTACTGGACCATTCTGCAGCAAC
TGACACACCACTCTGTTAATGGATGCAATCTGAGACCTGGGGACCTCTTGGCTTCTGGAACCAT
CAGTGGATCAGACCCTGAAAGCTTTGGCTCCATGCTGGAACTGTCCTGGAAGGGAACAAAGGCT
ATCGATGTGGGGCAGGGGCAAACCAGGACCTTTCTTCTGGACGGAGATGAAGTCATCATAACAG
GTCACTGCCAGGGGGATGGCTACCGTGTTGGTTTTGGCCAATGTGCTGGGAAAGTGCTGCCTGC
CCTCTCGCCAGCCTGAAGCTCCAGAATCCACAGAACACAGCCTTGCCTTGTGAGGATCATACTG
CAACTGCATGAGTCAGGAATGAATAAAGCTATTTTGATTGGGGAAGTGCCACAGAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039108811 ⟹ XP_038964739

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	1	138,548,830 - 138,571,599 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_058877	(Get FASTA)	NCBI Sequence Viewer
	XP_038964739	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA41142	(Get FASTA)	NCBI Sequence Viewer
	AAH76381	(Get FASTA)	NCBI Sequence Viewer
	EDM08767	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000061132
GenBank Protein	P25093	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_058877 ⟸ NM_017181

- UniProtKB:

P25093 (UniProtKB/Swiss-Prot), A6JCP0 (UniProtKB/TrEMBL), F1M6W1 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MSFIPVAEDSDFPIQNLPYGVFSTQSNPKPRIGVAIGDQILDLSVIKHLFTGPVLSKHQHVFDE
TTLNSFMGLGQAAWKEARASLQNLLSASQAQLRDDKELRQRAFTSQASATMHLPATIGDYTDFY
SSLQHATNVGIMFRGKENALLPNWLHLPVGYHGRASSVVVSGTPIRRPMGQMRPDNSKPPVYGA
SKRLDMELEMAFFVGPGNRFGEPIPISKAQEHIFGMVLMNDWSARDIQQWEYVPLGPFLGKSFG
TTISPWVVPMDALMPFVVPNPKQDPKPLPYLCHSQPYTFDINLSVALKGEGMSQAATICRSNFK
HMYWTILQQLTHHSVNGCNLRPGDLLASGTISGSDPESFGSMLELSWKGTKAIDVGQGQTRTFL
LDGDEVIITGHCQGDGYRVGFGQCAGKVLPALSPA

hide sequence

RefSeq Acc Id:

ENSRNOP00000061132 ⟸ ENSRNOT00000068167

RefSeq Acc Id:	XP_038964739 ⟸ XM_039108811
- Peptide Label:	isoform X1
- UniProtKB:	F1M6W1 (UniProtKB/TrEMBL)

Protein Domains

Fumarylacetoacetase N-terminal Fumarylacetoacetase-like C-terminal

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P25093-F1-model_v2	AlphaFold	P25093	1-419	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13690170

Promoter ID:

EPDNEW_R694

Type:

initiation region

Name:

Fah_1

Description:

fumarylacetoacetate hydrolase

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	1	146,736,306 - 146,736,366	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:61932	AgrOrtholog
BioCyc Gene	G2FUF-58649	BioCyc
BioCyc Pathway	TYRFUMCAT-PWY [L-tyrosine degradation I]	BioCyc
Ensembl Genes	ENSRNOG00000013223	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000068167	ENTREZGENE, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Gene3D-CATH	2.30.30.230	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	3.90.850.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7108528	IMAGE-MGC_LOAD
InterPro	Fumarylacetoacetase	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Fumarylacetoacetase-like_C	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Fumarylacetoacetase_C_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Fumarylacetoacetase_N	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Fumarylacetoacetase_N_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:29383	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:93536	IMAGE-MGC_LOAD
NCBI Gene	29383	ENTREZGENE
PANTHER	FUMARYLACETOACETASE	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR43069	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	FAA_hydrolase	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	FAA_hydrolase_N	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Fah	PhenoGen
RatGTEx	ENSRNOG00000013223	RatGTEx
Superfamily-SCOP	SSF56529	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SSF63433	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
TIGR	TC219968
UniProt	A6JCP0	ENTREZGENE, UniProtKB/TrEMBL
	F1M6W1	ENTREZGENE, UniProtKB/TrEMBL
	FAAA_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2002-06-10	Fah	fumarylacetoacetate hydrolase			Name updated	70584	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_disease	identified as a possible hypertension gene	1559295
gene_expression	mRNA expression is higher in liver than in kidneys	61580
gene_protein	cDNA codes a 419 aa, 45,946 kDa protein	61580
gene_regulation	post-transcriptionally regulated in liver and kidneys	61580

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

Mammalian Phenotype

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

Mammalian Phenotype